realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 April 2015
realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013
-
Upload
eac-realestateworldcomau -
Category
Documents
-
view
236 -
download
4
description
Transcript of realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013
![Page 1: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/1.jpg)
Cover Details Page 3
Thursday 9 May 2013
68 PAGES OF PROPERTY | OPEN HOUSE LIFTOUT PAGES 33- 36
Illawarra
Commercial Properties Pages 65-66
![Page 2: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/2.jpg)
Call 1300 METRICON or visit metricon.com.auLOVE TO CONNECT
Photograph depicts items not supplied by Metricon, namely landscaping, swimming pool and pergola. ̂ Metricon 50% off COLORBOND® roof offer available only on deposits from 26/11/12 for all NSW build regions. COLORBOND® corrugated iron roof to standard roof design is in lieu of standard concrete roof tiles. The COLORBOND® offer is based on the standard house roof area only and does not allow for any additional rooms area that has been added by non-standard variations, options or displayed option. Offer does not include COLORBOND® Ultra for severe coastal conditions. ~Steel frame available only to single storey Metricon designs in the Newcastle, Hunter, Upper Hunter and Illawarra build regions only. A COLORBOND® steel roof must be selected in conjunction with a steel frame.1) *Metricon More Love To Give Promotion applies to new home deposits on Metro and Designer range homes from 26/11/2012 and is not available in conjunction with any other offer unless stipulated. 2)There are no credits for any items deleted. 3) Metricon makes no warranties for the accuracy or completeness of the information and reserves the right to alter the terms of the offer without notice. 3) Items are in addition to or in lieu of Metricon’s NSW Metro and Designer standard specifications. 4) Tender must be accepted within 14 days of presentation for offer to be valid. 5) Offer available only in Sydney, Newcastle, Central Coast and Illawarra build regions. 6) For a detailed list of inclusions and exclusions of this promotion please refer to a sales quotation estimate read in conjunction with the NSW Metro and Designer standard inclusions brochure dated November 2012 available from a NSW sales consultant or visit www.metricon.com.au. BL 174699C MET_0902
DISPLAYS OPEN EVERYDAY 10AM - 5PM
NEW Horsley (Dapto)Brooks Reach Estate3 Brooks Reach Rd (cnr Bong Bong Rd)Ph 4261 2222
$5,900*
AND RECEIVE 24 PROMOTIONAL
LUXURY UPGRADES!VISIT OUR WEBSITE FOR
THESE INCLUSIONS
YOU PAY ONLY
METRICON.COM.AU/NSW/CAMPAIGN
BUNYA STREET
BONG BONG ROAD
MORSON AVENUE
BR
OO
KS
REA
CH
RO
AD
LOVE WHERE YOU LIVE?BUILD THE HOME YOU HAVE ALWAYS WANTED
Featured: Soho 32 with upgrade items.
MORELOVE TO GIVE Mantra 25 Chateau, on display at Horsley.Featured: Mitchell 22 Vogue with upgrade items.
Call (02) 6543 4594 for more information
Timber look laminate flooring
Carpet to remainder of home
Upgraded Fisher & Paykel stainless steel appliances
OFFERENDSMAY 31ST
![Page 3: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/3.jpg)
REAL ESTATE
arre.com.au 4228 2555 (formerly FANNING REAL ESTATE)
West Wollongong
Potential & Possibilities!For Sale: $445,000Open: Sat 12:30 - 1:30pm
• Filled with plenty of character & original features
• 831m2 block, 18.29m street frontage, R2 zoning• Garage, carport, workshop & utility room under• Gilmore Park Tennis Club & playground and end of street
• Handy to University, Village Shops and Wollongong CBD• Opportunity to renovate or rent out as an investment
13 Reserve Street
Renee Lambert0418 423 636
arre.com.au/2129
129 Koloona Avenue
Perfect Family RetreatFor Sale: $510,000 - $539,000
Open: Sat 11:00 - 11:30am
• Incredible value for a completely renovated home
• Offering 5 good size bedrooms, study & 3 bathrooms
• Generous modern kitchen with stainless steel appliances
• Undercover pergola area overlooks the level rear yard
• Situated close to schools, parks, shops, Uni & beaches
• Inspect this weekend to see for yourself the value available
Flynn Rutty0401 867 111
arre.com.au/2099
Mount Keira
Mount Kembla
245 Cordeaux Road
Tranquil Lifestyle Setting
For Sale: $589,000Open: By AppointmentFlynn Rutty 0401 867 111arre.com.au/2065
• North facing, sun drenched indoor & outdoor areas
• Four bedrooms plus study, main with ensuite
• Open plan kitchen & dining flowing to alfresco area
• Great size double lock up garage plus extra parking
Warrawong
15/6 Eyre Place
Top Of The World!
For Sale: $197,000Open: By AppointmentFlynn Rutty 0401 867 111arre.com.au/2128
• Fantastic top floor unit with lake glimpses
• Good size built-in wardrobes in both bedrooms
• Completely private with no common walls
• Security building access with single lockup garage
9 May 2013 3
FOR SALE
WHERE
CONTACT
WEB
INSPECT
AGENT
Offers above $880,000
24a Station Street, Stanwell Park
Wendy Lepre 0431 322 192
www.helensburgh.bevans.com.au
By Appointment
Bevans Thirroul - 4267 3444
Watergum GroveFront Cover Feature Property
For the first time Stanwell Park’s Watergum Grove is now being offered for sale. One of the most successful bed and breakfast in the park, a business and lifestyle change is just the thing for the overworked corporate couple.
Maybe you have a large family you need to accommodate, or a place for the inlaws, either way this home has so much opportunity. Just lock the internal door and you have two fully self-contained residences. This expansive property is located in such an enviable position. Backing onto parkland and a short stroll to the beach, fall asleep to the soothing sounds of the ocean as it lulls you to sleep.
![Page 4: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/4.jpg)
R E A L E S T A T E
Level 1, 65 Market Street, Wollongong
View more properties: www.mcphailrealestate.com
5/24 Cowper Street, Fairy Meadow $409,000
Open For Inspection : Saturday 11 am till 11.30 am
4/46-48 Corrimal Street WOLLONGONG Offers Over $495,000
Open For Inspection : Saturday 12.00pm to 12.30 pm
8 Mount Ousley Road, Fairy Meadow Fairy Meadow $379,000
Open For Inspection : Saturday 11am to 11.30am
2 Boundary Road Windang $485,000
Open For Inspection : Saturday 11.30 am - 12 Noon
15 Lantarra Place , Figtree Offers Over $690,000
Open for Inspection : By Appointment
9/1 View Street North Wollongong $1,250,000
Inspections: By Appointment
![Page 5: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/5.jpg)
R E A L E S T A T E
Level 1, 65 Market Street, Wollongong
View more properties: www.mcphailrealestate.com
20 Spoonbill Place , Albion Park Rail $549,000
Open For Inspection : Saturday 9.30 am till 10.00 am
5/82 New Dapto Road, Wollongong $349,900
Open For Inspection : Saturday 9.30 am till 10.15 am
8/57 Illowra Cres Primbee $319,000
Open For Inspection : Saturday 12.30 pm till 1 pm
89 Chillawong Circuit Blackbutt $390,000
Open For Inspection: Saturday 10.30 am till 11.00 am
Kirkwood Place, Mt Kembla Expressions Of Interest
Inspection: By Appointment
43 Beacon Avenue Bulli Offers Over $545,000
Open For Inspection : Saturday 2.00 pm till 2.30 pm
![Page 6: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/6.jpg)
All information contained herein is gathered from sources we consider to be reliable. However we cannot guarantee or give any warranty about the information provided andinterested parties must solely rely on their own enquiries. Residential | Commercial | Rural | Finance
ljhooker.com.au
1
Positioned in a quiet cul-de-sac location offering allocated building envelopes;Lot 2 - 551.7m2 - $130,000-$140,000Lot 3 - 586.6m2 - $140,000-$150,000Lot 7 - 7,560m2 - $170,000-$180,000
LJ Hooker Dapto 4261 344464 Princes Highway
Building Blocks
For Sale $130,000 - $180,000View By Appointment Contact Patrick Ciocca 0405 373 916
1
Sick of working for someone else? Want the opportunity to be your own boss. This may be the opportunity you have been looking for. Positioned in a high traffic location offering a great return with a good client base.
LJ Hooker Dapto 4261 344464 Princes Highway
Cafe & Sandwich Bar
For Sale $150,000View By Appointment Contact Patrick Ciocca 0405 373 916
1
Great entry into the property market. Spacious one bedroom unit with Mezzanine bedroom and bathroom. Features include modern kitchen, large open plan living area, balcony, swimming pool and tennis court facilities.
LJ Hooker Dapto 4261 344464 Princes Highway
Northgate Apartment - Location Location
For Sale $239,000View By Appointment Contact Sharon Horner 0402 844 636
1
Only 5 yrs young with 4 bedrooms plus study, the master room having WIR & ensuite. 2 living areas plus theatre room, Dressage Arena & stables. Town water, 2 rain water tanks, triple garage & large American barn.
LJ Hooker Dapto 4261 344464 Princes Highway
The Penderosa - Over 2 Acres
For Sale $1,195,000View Saturday 11:30am-12:00pm Contact Sharon Horner 0402 844 636
1
On offer is this 1225m2 industrially zoned parcel of land and 551m2 of residential property that consists of a large warehouse, ideal for those who wish to run their own business or after a storage area.
LJ Hooker Dapto 4261 344464 Princes Highway
Work, Live, Expand
For Sale $480,000 - $500,000View By Appointment Contact Patrick Ciocca 0405 373 916
1
Three bedroom brick veneer home is positioned on a near level block with a good size yard and side access to a 2yr old double garage. With some work this home could make for a fantastic first home or a great investment.
LJ Hooker Dapto 4261 344464 Princes Highway
Solid Start
For Sale $299,000View By Appointment Contact Patrick Ciocca 0405 373 916
1
Beautifully presented three bedroom residence on a large 679m2 block. Huge master bedroom with two of the three bedrooms having built-in robes, kitchen with separate dining area, brand new bathroom and two spacious living areas.
LJ Hooker Dapto 4261 344464 Princes Highway
Don’t Miss This One
For Sale $339,000View Saturday 12:30pm-1:00pm Contact Sharon Horner 0402 844 636
1
Beautiful elevated building block of 912m2 with stunning views, in a whisper quiet cul de sac. Has full development approval to build with Architect designed plans by well known Architect Richard Dal Santo. Plans available on request.
LJ Hooker Dapto 4261 344464 Princes Highway
Living On Top Of The World
For Sale $170,000 - $179,000View By Appointment Contact Sharon Horner 0402 844 636
1
Positioned in the well established Hermitage Estate is this stunning ultra modern townhouse. Features include ducted air conditioning throughout, a private covered entertainment area and great views from the balcony.
LJ Hooker Dapto 4261 344464 Princes Highway
Free Standing Townhouse
For Sale $389,000View Saturday 11:00am-11:45am Contact Patrick Ciocca 0405 373 916
1
Light & airy residence on 638m2 block. With brand new bathroom, modernised kitchen, high ceilings, polished floors & large windows. All 3 bedrooms are spacious & have BIW’s. There is a carport & a large shed. Rental potential for $360 p/wk.
LJ Hooker Dapto 4261 344464 Princes Highway
Excellent Investment Opportunity
For Sale $295,000 - $305,000View Saturday 12:00pm-12:30pm Contact Patrick Ciocca 0405 373 916
1
Great opportunity to buy into Commercial property. Currently leased and occupied as a restaurant but would suit a variety of uses. Features full commercial kitchen, dining area and freezer room. Quite a unique opportunity.
LJ Hooker Dapto 4261 344464 Princes Highway
Commercial Shop - Forest Grove
For Sale $170,000 +GSTView By Appointment Contact Sharon Horner 0402 844 636
1
With a full DA approval to build a 2nd dwelling. The existing dwelling is a 3 bedroom double storey home, having front & rear lane access. Large balcony, separate kitchen, good sized bedrooms, internal laundry & timber deck.
LJ Hooker Dapto 4261 344464 Princes Highway
Opportunity Is Knocking
For Sale $330,000View Saturday 10:30am-11:00am Contact Sharon Horner 0402 844 636
1
Architecturally designed home with a practical tri-level layout. All bedrooms include built-in wardrobes with the large master room including ensuite. Private covered entertainment area, plenty of storage and wonderful views.
LJ Hooker Dapto 4261 344464 Princes Highway
Spectacular Views
For Sale $350,000 - $370,000View Saturday 10:00am-10:30am Contact Patrick Ciocca 0405 373 916
1
Great opportunity to build your dream home surrounded by prestige properties. Over 670m2 (approx), these blocks are a rare find. Set on the high side of the street with spectacular views of the escarpment. Be quick.
LJ Hooker Dapto 4261 344464 Princes Highway
Mount Brown Land
For Sale $220,000 - $240,000View By Appointment Contact Daniel Lambert 0468 944 961
1
Beautifully presented with no work to do, this functional home will be the envy of family and friends with the tranquil landscaped gardens, huge 4 car garage and large workshop. Upper level perfect for retreat or 4th bedroom.
LJ Hooker Dapto 4261 344464 Princes Highway
Four Car Garage
For Sale $340,000-$360,000View By Appointment Contact Daniel Lambert 0468 944 961
1
Spacious family home offering two large separate living rooms with a good flowing floor plan and a modern kitchen. Large pergola and huge double lock-up workshop is ideal for entertaining family and friends, with ample storage.
LJ Hooker Dapto 4261 344464 Princes Highway
Large family home with workshop and study
For Sale $345,000 - $365,000View Saturday 11:00am-11:30am Contact Daniel Lambert 0468 944 961
![Page 7: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/7.jpg)
All information contained herein is gathered from sources we consider to be reliable. However we cannot guarantee or give any warranty about the information provided andinterested parties must solely rely on their own enquiries. Residential | Commercial | Rural | Finance
ljhooker.com.au
1
Ideally located for the astute investor, which is always looking for multiple opportunities not to mention with rear lane access. This investment opportunity will be a great start to your property portfolio, with potential rental return of $260pw.
LJ Hooker Warrawong 4274 0334Shop 3, 53-57 King Street
Cheap Cheap...
For Sale $239,000View Saturday 10am-10:30am Contact Dusko Vasileski 0411 713 523
1
This beautifully renovated cottage style home has been created for that picture perfect life whilst still keeping its character charm. The top floor includes an ultra- modern kitchen with an island bar that overlooks stunning water views of Lake Illawarra, Port Kembla Beach and Harbour .
LJ Hooker Warrawong 4274 0334Shop 3, 53-57 King Street
For Sale Offers Above $440,000View Saturday 11am-11:30am Contact Dusko Vasileski 0411 713 523
1
This home is an ideal start for a young family or a great return on your investment, at a potential $350pw return. Featuring 3 large bedrooms, all with built in wardrobes and an updated kitchen with ample bench and cupboard space.
LJ Hooker Warrawong 4274 0334Shop 3, 53-57 King Street
Perfect Starter
For Sale Offers Above $250,000View Saturday 2pm to 2:30pm Contact Dusko Vasileski 0411 713 523
1
This home offers three original sized bedrooms and two sunrooms with polished timber floors throughout. The kitchen has been updated with plenty of cupboard space. Currently receiving $330 pw with the lease expiring in March 2014.
LJ Hooker Warrawong 4274 0334Shop 3, 53-57 King Street
Investors Dream
For Sale Offers Above $300,000View By Appointment Contact Dusko Vasileski 0411 713 523
1
2LJ Hooker Warrawong 4274 0334Shop 3, 53-57 King Street
Auction 18th May 2013, 0n-Site 1:30pmView Saturday 1pm - 1:30pmContact Dusko Vasileski 0411 713 523
Address in one of Port Kembla’s most picturesque streets, it showcases a choice of expansive indoor and outdoor living, generous accommodation and child friendly easy care and landscaped gardens. The home conveys timeless sophistication through an innovative renovation keeping to the characteristics sense of style. This beautiful home offers single level family functionality whilst enjoying an enormous amount of natural light on a large parcel of land.
1
2LJ Hooker Warrawong 4274 0334Shop 3, 53-57 King Street
Auction 1st of June 2013, On-site 12:30pmView Saturday 12pm-12:30pmContact Dusko Vasileski 0411 713 523
Ideally located in one of the best streets that Windang has to offer, the home is less the 500m away to the unspoiled sands of Windang Beach and the beautiful waters of Lake Illawarra you will be on holidays all year around. The home offers single level living whilst enjoying an enormous amount of natural light, with an array of features which include three generously sized bedrooms, a formal lounge and dining, not to mention a fabulous open plan living with your second lounge room.
Wake up to the warm sun glistening into your bedroom window, open the curtains to breathe in and embrace the country life style.
This warm and welcoming family home has been redesigned into elegance and style with open plan living areas, modern touches and a resort style alfresco BBQ area. With four large bedrooms, ensuite, study and modern kitchen this unique property gives you a blissful satisfaction when watching ducklings swim in your very own dam.
If the family home isn’t enough, your children, parents or guests can enjoy their very own one bedroom home right next door, with a kitchen, lounge, bathroom, garage and a private undercover entertainment area.
LJ Hooker Warrawong4274 0334Shop 3, 53-57 King Street
For Sale $1.2 million
View By Appointment
Contact Dusko Vasileski 0411 713 523
Over the years, the proud owner of this magnificent acreage has enhanced Mother Nature with perfectly landscaped gardens boasting a grand three -tiered fountain. The horse stables were created to provide a holiday feel with a fireplace and kitchenette overlooking the curves of the mountains.
With two homes, one land, stables and a dam, this rare opportunity to live your dream won’t last long.
*Agent´s interest expressed.
![Page 8: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/8.jpg)
All information contained herein is gathered from sources we consider to be reliable. However we cannot guarantee or give any warranty about the information provided andinterested parties must solely rely on their own enquiries. Residential | Commercial | Rural | Finance
ljhooker.com.au
LJ Hooker Wollongong4229 105568 Market Street
Enviable rooftop position commanding an ocean, city and mountain panorama. Free flowing from the open plan indoor living space to outdoor entertaining with this unique garden setting perfect for intimate cocktail parties you will host. Most practical and versatile in design allowing for up to four bedroom accommodation, or that extra room for the home office or library. Three car garaging in security basement, lift access and video camera entry.
For Sale$1,199,000
ViewBy Appointment
ContactPhil Oppenauer 0408 422 864,Marnie Oppenauer 0421 039 659
32
1
LJ Hooker Wollongong4229 105568 Market Street
Only mins from Kiama Harbour & popular shopping strip. Nestled in an elevated semi-rural setting with Northerly views over rolling hills. Ready to occupy packages incl landscaping, air cond to living areas, carpets, stainless steel appliances, dishwashers; & much more. First home buyers receive in excess of $30,000 in benefits (NO stamp duty & $15,000 Gov grant) Other purchasers receive $5,000. Ideal for self managed super funds or negative gearing.
For SaleFrom $435,000 to $469,000
ViewBy Appointment
ContactPhil Oppenauer 0408 422 864,Marnie Oppenauer 0421 039 659
14x2 Bedroom & 6x3 Bedroom split level townhouses - 5 already SOLD!
1
2LJ Hooker Wollongong 4229 105568 Market Street
For Sale $459,900View Saturday 11th May - 11:00 - 11:30amContact Phil Oppenauer 0408 422 864
Is this the one you have been waiting for? Appealing rendered 3 bedroom villa with new carpet and new paint throughout. The black granite and polyurethane kitchen with stainless steel appliances services open plan lounge and dining. Dual vanities in master bathroom plus ensuite to main bedroom. Very large double lock up garage with internal access. Built-in wardrobes in each bedroom. Internal laundry. So close to shops, public transport and Wollongong Hospital.
1
2LJ Hooker Wollongong 4229 105568 Market Street
For Sale $569,000View By AppointmentContact Marnie Oppenauer 0421 039 659
Glorious mountain views from this brick home sited on 870sqm allotment in a cul-de-sac location. North facing backyard hosts pool, fully fenced & terraced lawn. Freshly painted home with new flooring and 2 brand new bathrooms! Custom designed kitchen, black granite benchtops. Raked cathedral ceilings in open plan living opening onto balcony. Downstairs to rumpus room, 4th bedroom plus internal laundry. Ideal home for the family with teenagers!
1
2LJ Hooker Wollongong 4229 105568 Market Street
For Sale $225,000View Saturday 11th May - 10:15 - 10:45amContact Phil Oppenauer 0408 422 864
A must see for a first home buyer. This 2 bedroom unit has new kitchen with polished timber floors, wall oven & dishwasher plus loads of cupboards space. Good sized lounge & fully renovated bathroom, incorporating internal laundry. Front unit in a well maintained brick veneer & tile block of only 6 with off-street parking. Easy walk to railway station & only a few minutes drive to town.
1
2nd floor, huge undercover terrace with ocean glimpses/city views. Defined dining area adjoins white poly kitchen with black granite benchtops. Open plan air conditioned living area, bigger than most! Double lock up garage. Lift access.
LJ Hooker Wollongong 4229 105568 Market Street
One block back from Cliff Road!
For Sale $585,000View By Appointment Contact Marnie Oppenauer 0421 039 659
1
• High exposure site adjoining railway station• Government funded tenant pays council &
water rates• $37,120 pa net income lease to 30/6/15• Solid full brick building
LJ Hooker Wollongong 4229 105568 Market Street
8% Return Ideal For Super Fund!
For Sale $445,000View By Appointment Contact Phil Oppenauer 0408 422 864
![Page 9: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/9.jpg)
All information contained herein is gathered from sources we consider to be reliable. However we cannot guarantee or give anywarranty about the information provided and interested parties must solely rely on their own enquiries. Residential l Commercial l Rural l Finance
ljhooker.com.au
1
2LJ Hooker Albion Park Rail 4256 3344
195 Princes Highway
For Sale $359,000
View Saturday 11th May 12.30pm - 1.15pm
Contact Craig Hyde 0404 497 521
This home is nestled in a quiet & handy location. You have the added advantage in the
home with 2 separate living areas, an extra long double tandem garage + storage & there is parking at the front of the property. The yard is to die for, level & almost un-obstructed so if
you want apool (STCA) you can. The home is free flowing and has homely features like reverse cycle a-c, diswasher, timber kitchen,
freshly painted & polished timber floors throughout. I say “Come have a look” you wont be disappointed.
LJ Hooker Albion Park Rail4256 3344195 Princes Highway
For sale via Public Auction is this cosy cement rendered home in leafy Figtree. The property is situated close to transport, shopping centres, schools & is only10 minutes to Wollongong CBD. Featuring 4 bedrooms, polish timber floors, 2 neat bathrooms, 2 living area’s, separate dining area, wrap around balcony, 2 kitchens one in separate teenagers retreat, Single car garage with heaps of under building storage & small internal laundry. The back yard is basically a blank canvas - your options are endless.
AuctionSaturday 25th May at 3pm on site.
ViewSaturday 11th May 2pm - 3pm
ContactCraig Hyde 0404 497 521
32
1
1
2LJ Hooker Albion Park Rail 4256 3344
195 Princes Highway
For Sale $339,000
View Saturday 11th May 12.30pm - 1.15pm
Contact Vito Scioscia 0402 121 870
Perfectly presented home located in a super quiet street, so close to everything. Neat, fresh
and light filled this family home features 3 good sized bedrooms - 2 with built in robes, neat & tidy kitchen, open plan lounge & dining with reverse cycle air conditioning unit.
Step outside to a gardeners paradise with manicured lawns, garage/workshop, high
clearance drive through carport and plenty of room & access for a boat or caravan.
9 May 2013 9
![Page 10: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/10.jpg)
AUCTION THIS SAT
11 MAY 11:30AM
Fig
tree
Owner Loves• Large north facing single level home with bull-nose verandah & ranch style fencing• Timber kitchen with ample cupboard space including pantry and dishwasher• Huge undercover deck area, perfect for entertaining
Inspect: Sat 11 May 11:00-11:30amAuction: On Site Sat 11 May 11:30amContact: Danny O´Neill 0416 089 884 [email protected]
33 Uralba StreetAUCTION
5
2
2
Plus• Level full fenced rear yard & kids cubby house built to resemble main residence• Large double garage with internal access• Located close to Westfield Figtree with easy access to the highway in both directions
AUCTION THIS S
UN
12 MAY 11:00AM
Mo
un
t K
em
bla
4 BLOCKS FOR SEPARATE PUBLIC AUCTIONNestled in the idyllic rolling hills of Mount Kembla is this new exclusive subdivision.4 large near level north facing blocks are already fenced and surrounded by landscaped public areas including walking/cycle way offering a rural feel with city ease.
Inspect: Agent on Site 11:00am-12:00 noon Saturday 11 MayAuction: Sunday 12 May 2013 at 11:00amContact: Ted Hanson 0418 421 281 [email protected]
LOTS 1-4 Kirkwood PlaceEXCEPTIONAL, UNIQUE & EXCLUSIVE
• Lot 1 - 1,271 sqm• Lot 2 - 1,297 sqm• Lot 3 - 1,245 sqm• Lot 4 - 2,377 sqm
Mo
un
t K
eir
a
Hidden from the road resting amid a private leafy enclave lies this charming colonial home with unrivalled prospects. The unique and freestanding canvas has a flexible layout catering for your own grand design. Positioned on just over 2 acres (8,370 sqm) of stunning Mount Keira land, this gardener´s paradise rekindles memories of a by-gone era.
Inspect: Agent on Site 12:30-1:30pm each Saturday until AuctionAuction: On Site Saturday 25 May 1:30pmContact: Ted Hanson 0418 421 281 [email protected]
218 Mount Keira RoadA GRAND COLONIAL WITH EXQUISITE BACKDROP
4
1
1
• Classic true central hallway• 4 bedrooms plus study or 5th bedroom• 4 original fire places
To
wra
dg
i
Owner Loves• Rare opportunity to secure this level block of land• DA Approved for a 4 bedroom home OR design your own• Only a 5 minute drive to nearby Towradgi beach
Inspect: Direct - On SiteSale: $285,000Contact: Danny O´Neill 0416 089 [email protected]
51 Florence StreetNew! $285,000
Plus• Appealing cul-de-sac location with direct access to the walk/
cycle way and nearby child friendly parks and sporting fields• Conveniently located close to schools, shops & public transport
Lake H
eig
hts
Owner Loves• Perfect opportunity to build your dream home!• Close to schools, Westfield Warrawong & Lake Illawarra• Just 10 minutes by car to Wollongong CBD and Shellharbour
Inspect: Direct - Vacant BlocksSale: $142,500Contact: Danny O’Neill 0416 089 [email protected]
Lot Shearwater Dr & Whimbrel Ave$142,500
Plus• ONLY 4 BLOCKS REMAINING• Block sizes ranging from 664 sqm to 856 sqm• Be surrounded by new homes
![Page 11: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/11.jpg)
top performers providing a diverse range of real estate solutions
Daniel Hastings0416 283 876
David Geary0418 423 782
Phil Jones0418 421 468
Paul Baxter0428 371 532
Maurice Bertapelle0412 029 131
Daniel Frazer0408 944 434
Chris Black0418 999 001
Sam O’Halloran0423 825 072
George Szymkiewicz0448 046 450
Amy Andersen02 4253 2743
Yenson Mui0421 882 541
Geoff Jones0418 421 074
Tim Jones0409 456 299
Travis Machan0447 300 800
MMJWollongong.com.au6-8 Regent Street, WollongongPhone 4229 5555 | Email [email protected]
Deb Cummins0412 426 495
Pat Cummins02 4256 6666
Dale Whittaker0414 376 720
Mark De Cresci0422 744 097
Joyce Mantuano02 4256 6666
Natalie Reale0405 998 211
MMJshellharbourcity.com.au57 Central Road, Oak flats Phone 4256 6666 | Email [email protected]
Luke Fox0424 248 165
Julie Taylor0415 160 683
Greg Truebody0412 626 964
Troy Phipps0412 425 801
Roger Hughes0412 424 071
Greg Ellul0412 421 214
Glenice McMahon0407 293 466
Jade O’Byrne0405 180 593
Frank Belsito0416 032 986
MMJNorth.com.au251-253 Princes Highway, CorrimalPhone 4285 5999 | Email [email protected]
Luke Collins0401 405 874
Adam Martin0408 411 723
MMJSouth.com.au231 Windang Road, Windang Phone 4296 4444 | Email [email protected]
John Tisma0409 612 000
Ian Fitzgibbon0418 333 149
Bradd O’Brien0400 002 255
Alan Chaffers02 4261 3822
Greg Edwards0438 613 822
MMJDapto.com.au49 Princes Highway, DaptoPhone 4261 3822 | Email [email protected]
stay connectedGet the latest news, property updates & more online. #mmjrealestate @mmjrealestatewww.facebook.com/mmjrealestatewww.youtube.com/mmjrealestate
what’s open this weekend?Find out what’s open this weekend. Scan this code with your smart phone to go straight to our open house list.
MMJ’s weekly hot tip!Selling Your Home In Autumn.
You may have noticed the temperature steadily beginning to drop, and the leaves beginning to turn brown - this means autumn is here!
And if you’re planning on selling real estate in Wollongong this autumn, we have some tips to help you on your way...
Head to our blog for tips on selling your home in autumn >>>Dimitty Tabor0434 745 520
Caroline Ash4296 4444
Natalie Lowe0401 745 678
![Page 12: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/12.jpg)
MMJ Wollongong l 4229 [email protected]
first time advertised!
WOLLONGONG, 5/47 Gipps Street
•A unique yet practical townhouse in small block•2 bedrooms on the top level, both with built-in-wardrobes•Modern kitchen and bathroom, 2 balconies, second toilet•Open-plan lounge and dining area, low maintenance courtyard•Garage downstairs with internal access, security intercom•Pleasant escarpment views, popular Smiths Hill location close to schools and beaches
2 1 1
This townhouse would be a perfect buy for the young couple or investor alike. It offers convenience in location, easy maintenance and privacy.
OFFERS ABOVE $329,000View Saturday 12:00 - 12:30pmContact Daniel Frazer 4253 2743 Paul Baxter 0428 371 532Email [email protected] iD mmj.com.au/3P3944
![Page 13: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/13.jpg)
MMJ Wollongong l 4229 [email protected]
new listing!
WOLLONGONG, 4/55 Bligh Street
•Comfortable two bedroom apartment in solid brick building•Modernised kitchen with stainless steel appliances•A generous garage with big storage room• Internal laundry, built-in wardrobes, balcony•Large lounge room and separate dining area, open aspect with pleasant views•Security building, close to free bus, hospital and CBD
2 1 1
A superb location with easy access to the free bus route, hospital, University and Wollongong CBD
OFFERS ABOVE $299,999View Saturday 11:00 - 11:30amContact Daniel Frazer 4253 2743 Paul Baxter 0428 371 532Email [email protected] iD mmj.com.au/3P3907
![Page 14: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/14.jpg)
MMJ Wollongong l 4229 [email protected]
Contemporary Smith’s Hill Residence
WOLLONGONG, 33 Edward Street• Spacious4bedroomhomeplushomeoffice,formalloungewithaccesstofrontbalconytakinginstunningescarpmentaspect•Opendiningspaceoffthestonefinishedkitchen,upstairsretreatandrumpusthatopenstotheyardandentertaining•Triple garage with a drive through access•Spacious 20m x 40m (approx.) allotment, with smartly landscaped yard•Surrounded by numerous homes with minimal strata development in the direct area•Approximate 5 minute walk to Wollongong’s CBD, Beaches, walking/cycling track and train station•Popular restaurants situated at the end of the street
4 3 3
Rare opportunity to secure a generous, contemporary residence in Wollongong’s ever popular Smith’s Hill where lifestyle is the significant consideration.
FOR SALE $1,290,000View Saturday 1:00 - 1:30pmContact Daniel Hastings 0416 283 876Email [email protected] iD mmj.com.au/3P0438
![Page 15: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/15.jpg)
MMJ Wollongong l 4229 [email protected]
fully renovatedBERKELEY, 16 Newcombe Street
• One level family home in Lyndsay Heights• Open-plan living area opens out to an outdoor pergola entertaining area• Generous bedrooms with loads of storage, great cross ventiliation• An exceptional kitchen with a contemporary and practical design• Massive detached double-garage with power• Fantastic location, approximately 2km to Unanderra shopping centre
3 1 1
for sale $349,000View Saturday 10:30 - 11:00amContact Yenson Mui 0421 882 541Email [email protected] iD mmj.com.au/3P3823
YES, now complete!towradgi, 102 Balmoral Towers, Caters Lane
• A brand new apartment in a resort style complex with huge courtyard• Ample space, with an open outlook over the reserve towards Wollongong• Can be set up as either a 2 or 3 bedroom apartment• Fullyintegratedpolyurethanefinishkitchenfeaturingcaesarstonebenchtops
and splashbacks, Smeg cooktop, oven and dishwasher• Alarm system to the apartment plus security lift system
2/3 1 1
offers above $449,000View Saturday 11:30 - 12:00pmContact Yenson Mui 0421 882 541Email [email protected] iD mmj.com.au/3P3729
First time advertised! MANGERTON, 15/25 Woodlawn Avenue
•Free standing townhouse in sunny position•3 bedrooms, ensuite and walk-in wardrobe in main•Double garage, with internal access•Hugeopenplanlivingspacewithqualityfittings•Polishedtimberfloorsthroughoutwithgourmetkitchen
3 2 2
A house-sized property andone of the best locations in the complex.
for sale $499,000View By AppointmentContact Yenson Mui 0421 882 541Email [email protected] iD mmj.com.au/3P3951
![Page 16: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/16.jpg)
MMJ Wollongong l 4229 [email protected]
New Listing!gwynneville, 2/19 John Street
• Two bedroom unit in a convenient location• Off-street parking space, balcony, built-in-wardrobes• Internal laundry, full brick construction, security building• Groundfloorpositioninasmallblock• Within close proximity to the University and Botanical Gardens
2 1 1
for sale $259,999View Saturday 10:00 - 10:30amContact Daniel Frazer 4253 2743 Paul Baxter 0428 371 532Email [email protected] iD mmj.com.au/3P3942
Funky townhouse with huge backyardCONISTON, 6/41-43 Robertson Street
• An immaculate townhouse with enormous yard• 3 bedrooms with built-in-wardrobes• Open-plan living, garage and private courtyard• Neat kitchen and bathroom with 2 separate toilets• Large wrap-around yard with garden shed for storage• Asmartpurchasefortheyoungfamily,firsthomebuyerorinvestor
3 1 1
Offers Above $349,000View Saturday 2:00 - 2:30pmContact Daniel Frazer 4253 2743 Paul Baxter 0428 371 532Email [email protected] iD mmj.com.au/3P3925
Large Entertainer’s Apartmentwollongong, 5/78 - 82 Campbell Street
• Comfortable 3 bedroom apartment• Modern security building in central location• All bedrooms with BIW’s, master with ensuite and walk-in-robe• Double lock-up garage, recently carpeted and painted• Large undercover balcony for entertaining• Expected rental $500+ per week, well run strata
3 2 2
offers above $449,999View Saturday 1:00 - 1:30pmContact Daniel Frazer 0408 944 434 Bradd O’Brien 0400 002 255Email [email protected] iD mmj.com.au/3P3637
a home to loveWEST WOLLONGONG, 18 Booyong Street
• Charming double brick and tile roof home, garage under set in quiet street• Three spacious bedrooms with built in robes• Renovated kitchen with party size stove• Light, bright and sunny interior• Secureyardfeaturinglargesandstoneflaggedcourtyard• Two new bathrooms and new laundry
3 2 1
offers above $449,000View Saturday 11:00 - 11:30amContact Phil Jones 0418 421 468Email [email protected] iD mmj.com.au/3P3918
![Page 17: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/17.jpg)
MMJ North l 4285 [email protected]
brand new ultra modern townhousescorrimal, 273 Rothery Street
• Architecturallydesignedformaximumbenefit.Interiorsaremodern&vibrant• Offering an abundance of light and space throughout• Front and rear courtyards• Spaciouslivingareas• Centrallocation.Only2left!
3 2 2
FROM $450,000View Sat11/0511.00-12.00pmContact Greg Ellul 0412 421 214Email [email protected] iD mmj.com.au/4P3585
tree studded hideawaybulli, 14CopePlace• ThistrilevelresidenceispositionedonacornerlotbackingontoGrevilleaPark• Recently refurbished interiors with new Berber carpet and freshly painted• Featurescathedralceilings,ensuiteandW.I.Wtomainbedroom• Separatediningplusfamilyroom.Internalaccesstogarage• Ampletimberdecksaffordtranquilviewswithchildfriendlyyardspace
4 2 2
offers above $580,000View Sat 26/01Contact Roger Hughes 0412 424 071Email [email protected] iD mmj.com.au/4P3621
tree studded hideaway! bulli, 14CopePlace• ThistrilevelresidenceispositionedonacornerlotbackingontoGrevilleaPark• Recently refurbished interiors with new Berber carpet and freshly painted• Featurescathedralceilings,ensuiteandW.I.Wtomainbedroom• Separatediningplusfamilyroom.Internalaccesstogarage• Ampletimberdecksaffordtranquilviewswithchildfriendlyyardspace
4 2 2
offers above $560,000View Sat11/0511.00-11.45amContact Roger Hughes 0412 424 071Email [email protected] iD mmj.com.au/4P3621
vacant landfigtree, 45 Redgum Forest Way
• LocatedinFigtree’spremierestatesurroundedbyluxuryexecutivehomes• Elevatedcornerblockwithbeautifulnortherlyaspect&viewstoapublicreserve• Purchaseandbuildyourowndreamhomeorbuildthealreadyapprovedhome• PlansapprovedforanimmediatestartofacontemporaryDavidJenningshome• FamilyfriendlyestatewitheasyaccesstoWestfield,schools&transport
for sale $314,900View By AppointmentContact Greg Ellul 0412 421 214Email [email protected] iD mmj.com.au/4P3798
brand new homeFIGTREE, 29aLamertonDrive• Justcompleted,superbarchitecturallydesignedfamilyresidence• Boasting4largebedrooms,mainwithWIWandensuite• Spaciousopenplanfamily/diningopeningtohugeentertainersdeck• Boastinglargeformallounge,downstairsrumpusandqualityinclusions• Tranquillocationofferingfantasticviews!
4 2 2
offers above $600,000View Sat11/0512.00-12.30pmContact TroyPhipps0412425801Email [email protected] iD mmj.com.au/4P3425
MMJ Wollongong l 4229 [email protected] North l 4285 [email protected]
Superb City Ground Floor UnitWOLLONGONG, 2/1 Mercury Street• PerfectfirsthomeorinvestmentpropertyinneedofsomeTLC• Wonderfultwobedroomunitsetinaconvenientin-townlocation• LocatedontheGongFreeBusroute• BIWinmainbedroom,showeroverbathinthebathroom• Internallaundryandsinglecarport• Withasmalltouch-upthepotentialrentwouldbeapprox$320perweek
2 1 1
for sale $259,990View Saturday11:00-11:30amContact SamO’Halloran0423825072Email [email protected] iD mmj.com.au/3P3855
walk to everythingWOLLONGONG, 21/4BankStreet• Magnificent3bedroomapartmentdesignedwithdistinction• Canbeusedasa2b/rm+officewithprivatesecuritygatedaccessforclients• Loadsofextrastorageinallrooms• Spectacularviewsover-lookingWollongongGolfCourse+CityBeach• LookingforsomethingspectacularwitharealWOWfactor?Thenthisisforyou!
3 3 2
for sale $579,990View Saturday12:00-12:30pmContact SamO’Halloran0423825072Email [email protected] iD mmj.com.au/3P0393
Beach side cul-de-sac & adjacent reservebulli, 54WillcathStreet
•Wellpresented3bd/rresidenceplus1bd/rflatwithstudy•Northfacinglivingareawithgasfire,opensontooutdoorentertaining•Amplespaceforhomeofficeorstudy•Pleasantreservebeyondrearboundary•Beaches,biketrack,schools,trainstationallwithin5minutestroll•Deckedpoolofftheentertainingarea
4 3 1
offers above $729,000View Saturday12:00-12:30pmContact DanielHastings0416283876Email [email protected] iD mmj.com.au/3P3667
Something Old, Something NewTOWRADGI, 14JohnStreet• Impressivebrickresidencemadeprivatebyahighfrontfencewithautogate• OpenplanL-shapedlivingarea,highceilingsuptoamaximum11foot• Modernkitchen,diningareaopensontoacoveredoutdoorentertainingarea• Generoussizeb/rm’swithbuilt-inrobes,ensuiteandwalk-inrobeoffthemaster• Drivewayextendsdowntotherearyardamdcarport• Approximate5minutedrivetoWollongongCBDviaNorthernDistributor
3 2 2
Offers Over $495,000View Saturday11:00-11:30amContact DanielHastings0416283876Email [email protected] iD mmj.com.au/3P3941
*Agentsinterestdisclosed.
![Page 18: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/18.jpg)
MMJ North l 4285 [email protected]
beachside ‘Duplex style’ townhousebulli east, 2/31 Park Road
• Sunny North facing aspect, conventional street frontage & beachside location
• The townhouse offers lounge with split level design to dining and kitchen
• Handy L shaped wrap around courtyard with pedestrian access
• Single garage plus allocated carspace in small tidy complex
• Low maintenance lifestyle allows you plenty of time to relax!
3 1 1
for sale $495,950View Sat 11/05 11.00 - 11.45amContact Greg Truebody 0412 626 964Email [email protected] iD mmj.com.au/4P3805
family havenBALGOWNIE, 13 Margaret Street
• A true recipe for a laid back family lifestyle
• 3 large bedrooms, 2 with BIW’s and modern bathroom
• Boasting timber kitchen, separate family room & formal lounge with air-con
• Large level yard with covered outdoor entertaining area
• Desirably nestled within an easy walk to village, schools and transport
3 2 1
for sale $485,000View Sat 11/05 11.00 - 11.45amContact Troy Phipps 0412 425 801Email [email protected] iD mmj.com.au/4P3497
“northview”woonona, 105-107 Campbell Street
• Brand new, boutique low maintenance lifestyle
• 2 & 3 bedroom single and double storey designs
• Featuring double garages, ensuites and large courtyards
• Boastingqualityfinishesandtastefuldesignerinteriors
• First home buyers save over $30,000 with Government Grants
3 2 2
for sale $395,000 - $535,000View Sat 11/05 12.15 - 1.30pmContact Troy Phipps 0412 425 801Email [email protected] iD mmj.com.au/4P3435
room for mum or extra income!west wollongong, 1 Phillips Avenue
• Largecharacterfilledfamilyhomeplusadetachedselfcontainedvilla
• Hugeopenplanlivingwithpolishedfloorsandhighornateceilings
• A large chefs kitchen and two bathrooms
• Lock up garage plus carport and ample off street parking
• Villaboaststimberkitchen,polishedfloors.1mainbedroomplusstudy
5 3 3
offers above $590,000View Sat 11/05 11.00 - 11.45amContact Troy Phipps 0412 425 801Email [email protected] iD mmj.com.au/4P3778
![Page 19: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/19.jpg)
Big is beautiful - VIEWSblackbutt, 4 Dunnart Place
• Superb property built as owner’s DREAM PROPERTY• Immaculately kept show home like presentation• Big open space spoiled by the essence of natural light• Too much to mention. Come and look, you will be IMPRESSED
4 3 2
Guide above $640,000View Saturday 2:10pm - 2:40pmContact Adam Martin 0408 411 723 [email protected] Luke Collins 0401 405 874 [email protected] Web iD mmj.com.au/6P1617
Great valueberkeley, 39 Massey Street
• Perfect time to buy a first home or investment property• Top condition with still stacks of potential . Best hurry• Ticks all of the boxes and is located on a quiet street• With the market as hot as ever, we predict this WILL SELL FAST
2 1 2
Guide above $260,000View Saturday 11:30am - 11:50amContact Adam Martin 0408 411 723 [email protected] Dimitty Tabor 0434 745 520 [email protected] Web iD mmj.com.au/6P1615
Move straight inbarrack heights, 39 Cassia Street
• Fully renovated property ready to be lived in• New kitchen, new carpets, freshly painted and blinds• Big tandem garage and perfectly manicured yard• Great first home or investment. You’d best hurry
3 2 1
Guide above $370,000View Saturday 1:30pm - 1:50pmContact Adam Martin 0408 411 723 [email protected] Dimitty Tabor 0434 745 520 [email protected] Web iD mmj.com.au/6P1622
Perched on Nob Hilloak flats, 127 Barton Street
• Character filled North facing cottage in great quiet street• Double roller door shed PLUS workshop/rumpus at rear• Great quiet street with sundrenched yard to boot• Great time to buy – LIVE IN OR RENT OUT!
3 1 OSP
BIG IS BEAUTIFULberkeley, 5 Whimbrel Avenue
• A monster in construction with a touch of Europe• Big enough to comfortably sleep 16+ adults• Designed to impress and built to out last• They just don’t make them like this anymore
8 3 2
Contact Adam Martin 0408 411 723 Dimitty Tabor 0434 745 520Web iD mmj.com.au/6P1531
guide above $490,000 View Saturday 10:50am - 11:20am
Tranquil LivingAlbion park, 7 Jerrara Street
• State of the art character filled home in Tullimbar• Big open plan design with formal and informal areas• High ceilings and manicured gardens• Move straight in, with nothing left to do!
4 2 2
guide above $450,000 View By Appointment
Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1408
You Won’t Be Disappointedunanderra, 156 Princes Highway
• Big home ready for moving in and or home business• Freshly painted throughout with beds up and down stairs• Large living, great floor and undercover entertaining area• Centrally located to all amenities - 10 mins to Wollongong• Great little money making investment at this price!
4 1 1
guide above $290,000 View Saturday 10:10am - 10:30am
Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1379
Class Actwindang, 86 Kruger Avenue
• Breathtaking family home in top location• A few minutes’ walk to Windang Beach• Open plan living with cool rear entertaining• Awesome property – WILL SELL QUICKLY!
4 2 3
guide above $540,000 View By Appointment
Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1520
BEACHSIDE HAVENport kembla, 15 Surfside Drive
• Huge home on huge block adjoining Port Beach Reserve• Character filled design with stacks of space & light• Splendid opportunity like no other. Come see yourself• Potential to redevelop into 3x3 bedroom townhouses (STCA) • EVERYDAY COULD BE A HOLIDAY!
4 2 3
Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1503
guide above $790,000 View By Appointment
Apartment Living At Its BestLake illawarra, 5/78 Addison Ave
• Modern development in quiet neighbourhood• Open plan 3 bedroom top floor unit with spunk• Large sun drenched balcony with sweeping views• Hop skip and a jump to our beautiful Lake’s Entrance
3 2 2
guide above $360,000 View By Appointment
Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1491
Revamped - Will Move Quick!port kembla, 1/55 Tobruk Avenue
• Located a few minutes walk to beach & Port Kembla pool• Tastefully revamped property with balcony and car space• Suburb becoming “hot spot”, attracting great prices• 5 mins to shopping hub and 10 min to Wollongong Central
guide above $210,000 View By Appointment
Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1450
First Property Or First Investment?windang, 2/232 Windang Road
• Great unit in complex of two close to Lake Illawarra• Single garage with sun drenched yard to boot• Wonderful investment opportunity currently at $280 pw• No better time to buy than today - hurry hurry
2 1 1
guide above $230,000 View By Appointment
Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1389
MMJ South l 4296 [email protected]
MMJ South l 4296 [email protected]
Guide above $330,000View Saturday 3:00pm - 3:20pmContact Adam Martin 0408 411 723 [email protected] Luke Collins 0401 405 874 [email protected] Web iD mmj.com.au/6P1605
2 1 1
![Page 20: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/20.jpg)
MMJ Shellharbour City l 4256 [email protected]
the perfect startoak flats, 1/33 Devonshire Crescent
• Use your imagination on this 3 bedroom house/villa• With its original kitchen & bathroom, an opportunity to improve this property
makes this a “great start” or “investment”. Potential rent: $350-$360 per week• There are solid timber fl oor boards under the current fl oor coverings and we
won’t charge you any extra for the wallpaper...• New garage with auto access. Block size 627m2
3 1 1
for sale $315,000View By AppointmentContact Deb Cummins 0412 426 495Email [email protected] iD mmj.com.au/8P1123
open saturdayOak Flats, 5 Gordon Avenue
• 3 bedroom family home situated on a large 692m2 block
• Very private and peaceful established gardens
• In need of a little TLC to bring back this charmer
• Natural gas and air conditioning
• Close to all amenities
3 1 1
for sale $339,000View Saturday 11.00am - 11.30amContact Mark De Cresci 0422 744 097Email [email protected] iD mmj.com.au/8P1118
your choice of 2flinders, 1 & 2/13 Eucumbene Avenue• Buy one or buy both in this small complex of 3• Spacious living area and each with its own courtyard• Elevated location with escarpment views• Generous modern kitchen and separate dining area• Excellent rental history, always in demand
3 1 2
for sale $369,000 EACHView By AppointmentContact Dale Whittaker 0414 376 720Email [email protected] iD mmj.com.au/8P1002
OPEN SATURDAYmount warrigal, 60 Morgan Avenue
• Freshly painted 3 bedroom home boasting a renovated bathroom• Modern well appointed kitchen which overlooks a level yard and landscaped
gardens. Block size 556.4m2• Only 2 minute drive to Stocklands Shopping Centre, beach, schools, transport
and freeway. A leisurely stroll to the lake and cycleway
3 1 1
for sale $359,000View Saturday 11.00am - 11.30amContact Deb Cummins 0412 426 495Email [email protected] iD mmj.com.au/8P1115
new priceprimbee, 168 Lakeview Parade• Prime north facing lakefront property in a highly sought after area• Renovated cottage with updated kitchen and bathroom• Potential to build your dream home (subject to council approval)• Imagine the lifestyle of sitting on the back deck, taking in the unrestricted water
views with a wine or beer in hand
4 1 1
for sale $399,900 View By AppointmentContact Dale Whittaker 0414 376 720Email [email protected] iD mmj.com.au/8P1005
commercialoak flats, 3/120 Industrial Road
• Approximately 162m2 with 2 roller door access plus single gated door• 2 x air conditioned offi ces, reception counter and tea room• 3 phase power, data cabling, mezzanine storage and CCTV system• Exposure to busy Industrial Road, it’s ready to move your business into• Adjoining 160m2 (approximately) building is also For Sale
for sale $200,000View By AppointmentContact Dale Whittaker 0414 376 720Email [email protected] iD mmj.com.au/8P1086
![Page 21: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/21.jpg)
MMJ Dapto l 4261 [email protected]
open this saturday !! Horsley, 2 Appleby Close
• Situated in a beautiful quiet tree lined cul-de-sac street with views• Formal lounge, formal dining, impressive kitchen with heaps of storage• 4 bedrooms, 2 ensuites plus the main bathroom with separate toilet• Double remote controlled garage with internal access, modern décor • Great street, views, close to Dapto primary school, local shops & feilds.
4 3 2
for sale $459,900View Saturday 2.00-2.30Contact John Tisma 0409 612 000 Email [email protected] iD mmj.com.au/5P1104
stunning family home- open this saturday!! horsley, 8 Armitage Avenue
• 4 good sized bedrooms with built-in robes, ensuite, study/offi ce• Large formal lounge, formal dining and meals area, 3 bathrooms• Stunning new timber kitchen with seamless stone tops & splash• Separate rumpus room, ducted air conditioning, double garage• In-ground pool with shade sail, impressive BBQ pergola & more
4 3 2
for sale $539,900View Saturday 1.00-1.30Contact John Tisma 0409 612 000 Email [email protected] iD mmj.com.au/5P1093
quality & style throughout HORSLEY, 3 Spears Place
• Individually designed prestigious home with quality and style throughout• Formal lounge and dining, stunning kitchen with stainless appliances, breakfast bar • Fantastic Great Room with raked ceiling, as well as a separate rumpus• Master bedroom with e/s & walk in robe, 3 double bedrooms, stylish main bathroom• Separate study, covered entertaining area, double garage, landscaped gardens.
4 2 2
for sale $559,900View By AppointmentContact Ian Fitzgibbon 0418 333 149 Email ian.fi [email protected] iD mmj.com.au/5P1100
ideal for the entertainer - OPEN THIS SATURDAY HORSLEY, 8 Spears Place
• Impressive 3 bedroom home with offi ce or excellemt hobby room• Spacious 3 bedrooms with large built inns and a luxury ensuite • Open plan living areas & ultra modern kitchen with quality appliances • Magnifi cent covered outdoor area ideal for entertaining guests. • Beautifully landscaped home all located in a safe & quiet cul de sac
3 2 2
for sale $479,900View Saturday 2.00-2.30Contact Greg Edwards 0438 613 822 Email [email protected] iD mmj.com.au/5P1099
GREAT FIRST HOME - open this saturday!!Albion park rail, 29 Elm Street
• This home is a great fi rst home, situated in a quite street location• The home features a formal lounge & formal dining room • 3 good size bedrooms, separate toilet, good size bathroom• Internal laundry, detached 2+ car garage and a cover entertaining area • Side access & secured parking behind gates, with a level private yard
3 1 2
for sale $359,900View Saturday 3.00-3.30Contact John Tisma 0409 612 000 Email [email protected] iD mmj.com.au/5P1081
GREAT FAMILY HOME - open this saturday!! penrose, 10 Long Place
• Well maintained and presented brick veneer and tile family home• Formal lounge with split a/c and log fi re, separate dining, stylish modern kitchen • 3 bedrooms, modern tiled bathroom, separate toilet• Large covered entertaining area, secure yard, reserve at rear• Ample off street parking, ideal for those looking to enter the market
3 1 0
for sale $329,900View Saturday 1.00-1.30Contact Ian Fitzgibbon 0418 333 149Email ian.fi [email protected] iD mmj.com.au/5P1083
enquire now !!!Haywards bay, 20 Penterong Way
• Four bedroom home, building will start in 2 weeks, located on a 452m2 block.• Main with ensuite and walk in, ducted air conditioning throughout.• Spacious kitchen, theatre room & rumpus room for the kids to play around. • Separate family and dining room, double garage with direct access to back yard • Tiled outdoor living area with a BBQ space perfect for entertaining.
4 2 2
for sale $519,900View By AppointmentContact John Tisma 0409 612 000 Email [email protected] iD mmj.com.au/5P1082
new listing - open this saturday!!albion park rail, 3/2 Candlebark Street
• Well maintained brick and tile villa home in a complex of only 3• Formal lounge, defi ned dining area, spacious well appointed kitchen• 3 bedrooms all with built in mirror robes, tiled bathroom, separate toilet.• Beaut screened and enclosed sunroom, private landscaped yard.• Single garage with internal access. Ideal for investors or retirees.
3 1 1
for sale $339,500View Saturday 11.00-11.30Contact Ian Fitzgibbon 0418 333 149 Email ian.fi [email protected] iD mmj.com.au/5P1112
![Page 22: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/22.jpg)
MMJ Dapto l 4261 [email protected]
hidden oasis WITH STUNNING VIEWS - CALL TO INSPECTcalderwood, 102 Mellows Road
• Approximately 120 acres set at the foothills of the escarpment with stunning views• Located at the end of the street this property is private and truly impressive• Open prime pastures, tall cedar trees, rainforest walking tracks & permanent stream• Unique three bedroom family home with IG pool nestled unobtrusively into its local• Large machinery shed, spring fed water supply, 100% solar electricity, stunning
3 1 3
for sale $1,795,000View By AppointmentContact John Tisma 0409 612 000 Email [email protected] iD mmj.com.au/5P1035
immaculate townhouse dapto, 2/19 Baan Baan Street
• Immaculate brick veneer & tile townhouse, minutes to town centre. • Open plan living areas with A/C, spacious kitchen, internal laundry.• Two bedrooms with built in robes, main bathroom & corner spa • Single garage with remote door & internal access.• Living area opens onto a private courtyard and neat gardens.
2 1 1
Contact Ian Fitzgibbon 0418 333 149Email ian.fi [email protected] iD mmj.com.au/5P1057
For Sale $325,000 View By Appointment
land land land!!DAPTO, 8 Rosemount Street
• Prestigious Hermitage Park Estate, • Situated on a 641m2 block of land.• 18m frontage, elevated block, suit variety of building designs. • The Land is surrounded by executive homes. • Call today for more information.
Contact John Tisma 0409 612 000 Email [email protected] iD mmj.com.au/5P1084
For Sale $249,900 View By Appointment
EXCELLENT VALUE - CALL FOR YOUR PRIVATE VIEWING!!HORSLEY, 10 Bovard Court
• Well presented brick veneer and tile home• L shaped formal lounge and dining, neat kitchen, family room• Master bedroom with walk in robe, built ins in other bedrooms• 835m2 block with side access available to generous size yard• Quiet cul de sac location, excellent value
3 1 1
for sale $355,000View By AppointmentContact Ian Fitzgibbon 0418 333 149Email ian.fi [email protected] iD mmj.com.au/5P1042
make me an offer - open this saturday!!Wollongong, 1/18 Rowland Avenue
• Take a look at this spectacular fully renovated 2 bedroom villa • Formal lounge, timber kitchen & spacious combined formal dining. • Brand new bathroom,new carpets & freshly painted throughout• There is a spacious single car garage, outdoor BBQ/Entertaining area. • Electronic security gates at the front of the home for that added
2 1 1
for sale $359,900View Saturday 10.00-10.30Contact John Tisma 0409 612 000 Email [email protected] iD mmj.com.au/5P1030
new price - open this saturday!! kanahooka, 21 Thirroul Road
• Custom designed home is situated in popular location in the Kanahooka• The home features a formal lounge, formal dining, spacious modern kitchen• 3 spacious bedroom’s all BIW’s, modern bathroom, separate toilet• Internal laundry, x3 linen presses, wide hallways, close to schools• Spacious garage and a great back yard for the kids and family to play
3 1 1
for sale $339,900View Saturday 11.00-11.30Contact John Tisma 0409 612 000 Email [email protected] iD mmj.com.au/5P1094
two storey residence - open this saturday!!penrose, 40 Goolagong Street
• Spacious two storey residence on a level 852m2 block• Formal lounge, separate dining, functional kitchen, family, study area• 5 bedrooms, ensuite to main, modern bathroom, separate toilet• Large detached double garage with separate hobby/entertaining room.• Large carport with ample off street parking for several vehicles
5 2 2
for sale $429,900View Saturday 2.00-2.30Contact Ian Fitzgibbon 0418 333 149Email ian.fi [email protected] iD mmj.com.au/5P1088
value packed - open this saturday!! Berkeley, 27 Warwick Street
• Value packed comfortable 3 bedroom brick and tile home. • New Bathroom plus spacious loungeroom and buit inn robes • Freshly painted througout, very neat kitchen with a new stove • Good size back yard & located in a quiet neighboroughood• Ideal for the fi rst home buyer or excellent investment property.
3 1 0
for sale $312,000View Saturday 11.00-11.30Contact Greg Edwars 0438 613 822 Email [email protected] iD mmj.com.au/5P1073
make me an offer - open this saturday!!koonawarra / dapto, 31 Eleebana Crescent
• Modernised single level 4 bedroom family home in a quiet street• Large separate lounge room and defi ned dining room• Family room located off the modern galley style kitchen • New impressive bathroom, large in-ground pool, pergola • Double tandem garage, large carport, fully fenced yard and more
4 1 2
for sale $329,900View Saturday 12.00-12.30Contact John Tisma 0409 612 000Email [email protected] iD mmj.com.au/5P1075
![Page 23: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/23.jpg)
THIRROUL $649,000 +
Live amongst the rainforest with views from your private deck of Sandon point and beyond. Enjoy a low maintenance garden with no lawns to mow. Feel the space with cathedral ceilings, 4 bedrooms, study, 2 bathrooms and spa. The lower level of the home is whatever you want to make it. An office, teenage retreat, games room or all three. A workshop area completes the home under the house. Other features include a stunning rainforest reserve at the rear of the property bringing a feeling of serenity to your life.
TOWRADGI $320,000 +
The ultimate beachside location awaits. Two 2 bedroom units available in an enviable location. Smell & hear the sea from these refurbished units less than 140m to beaches, cycle way, parks & restaurants.• Quiet, well maintained complex • Freshly painted • Brand new carpet • Single carports • Downsize or investA great opportunity to secure a beachside unit in a well established complex.
OPEN 11TH MAY 2013 AT 10:30AM - 11:15AM
JUST LISTED
BULLI $1,075,000
Located in one of the Illawarra’s best beachside suburbs, this magnificent 5 bed home features large open plan living areas, informal & formal dining areas, versatile kitchen, private level north facing backyard & situated on a 562m2 (approx) block.
CORRIMAL $879,000
This beautiful 4 bedroom home has had the hard work done leaving nothing left to do but relax & take in 180 degree views. Featuring BIR’s, stunning kitchen, 3 renovated baths, rumpus, outdoor kitchen, solar panels & an in-ground pool.
BULLI $675,000
Step inside this large family home & take in the expansive ocean views. Featuring 3 large beds, 2 living areas, Tassie Oak timber kitchen, 2 baths, dbl garage, storage room/office, large undercover entertaining area, landscaped gardens & an indoor pool.
WOONONA $895,000
This tri-level family haven is positioned with a north facing aspect. The heart of the spacious home offers numerous living areas, main with fireplace and access to rear deck, abundant kitchen, 5 beds, main with ensuite, private deck & ocean views.
FIGTREE $499,000
A perfect family haven located in an ultra quiet and leafy location. Feauring 3 beds with BIR’s, dining room, open plan living, modern kitchen, ducted a/c & office/study space . The sgl garage, large yard & huge undercover area complete this home.
WOONONA $608,000
Two strata titled villas perfect for the astute investor. Situated on approx 774m2 with the potential for private dual road access. Villa 1 with 2 beds & Villa 2 with 3 beds, renovated bathrooms, open plan kitchens, polished floorboards & internal laundries.
JUST LISTED
EAST CORRIMAL $439,000
Enjoy the peace and quiet or take a short stroll to the local beaches, schools, cafes and shops. Other features include three great sized bedrooms, BIRs, timber flooring, modern kitchen & bathroom and beautiful private grassed court yard.
BELLAMBI $380,000
This unique townhouse located in a small complex of only 5 will impress the most astute of buyers. Featuring expansive open plan lounge & dining, central kitchen, ens & WIR to main, entertainer´s balcony, alarm, intercom, r/c air con & courtyard.
![Page 24: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/24.jpg)
24 9 May 2013
THE JEWEL IN THE CROWNCapitalising on its position, this commercial property of approximately 1264m2 presents an opportunity like no other. Surrounded by an upcoming Woolworths development, the site will have direct customer access to Woolworths supermarket. Enjoy being directly between the Coles Service Station and a new proposed Caltex Service Station. The site enjoys a frontage of approximately 25 metres presenting an incredible opportunity to expose and market any business. The location is less than 100 metres from the start of Memorial drive which gives you access south and 1km from Bulli pass directly to Sydney.
Not only does the site benefit from two titles, but it has approved development consent from Wollongong council. The DA allows for a wonderful building with classic design consisting of a large office building separate to a whopping factory/warehouse and storage units with ample space for your team and customers to park.
If exposure for your business is high on your agenda, the position of this property is the best in the area with thousands of rail commuters and thousands of vehicles passing the property daily.
![Page 25: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/25.jpg)
9 May 2013 25
development site | land size 1264m2
FOR SALE: Expressions of InterestWHERE: 269 – 271 Princes Highway, Bulli INSPECT: By Appointment
CONTACT: John O’Reilly 0401 675 077 Kane Downie 0409 969 032
bevansthirroul10/345 lawrence hargrave drive 4267 [email protected]
Our northern suburbs are constantly growing; 182 homes under construction in the new McCauley’s Estate and with the proposed Organs road development increasing Bulli with 260 new homes.
If you are a national company looking to grow and not sure what the next moves are, then make sure you check out this fabulous opportunity. Here is the most exciting part; Bulli is soon to be the shopping hub for the following suburbs, Woonona, Bulli, Thirroul, Austinmer, Coledale, Wombarra, Scarborough
Want to hear more then you best get on the phone and speak to either John or Kane. Get Excited, we are!
![Page 26: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/26.jpg)
26 9 May 2013
Bath Street
An exciting opportunity to secure an unusually large block of land held on the North Eastern side of Thirroul Village. Perfectly located with its famous ‘Jacksons’ Lawrence Hargrave Drive frontage, the site extends through to Bath Street at the rear and is only a short walk to Thirroul Beach. The mixed use part of the site is 2158m2, with frontage on to Lawrence Hargrave Drive. Zoned ‘B2 Local Centre’, the improvements currently include 3 shops and 6 residential apartments. The residential component that fronts Bath Street is 695m2, zoned ‘R2 Residential’ and currently has a weatherboard cottage on it. Total FSR is 3237m2. You may be interested in a business opportunity, long term investment, or a massive upside in a mixed use redevelopment of the land. Contact us for a full Planning Report produced by SET Consultants.
Visit the website: www.jacksonsforsale.com.au
COMMERCIAL & RESIDENTIAL | LAND 2158m2 & 695m2
AUCTION: Saturday 1st June at 10.30am in office WHERE: 271 - 273 Lawrence Hargrave Drive, ThirroulINSPECT: By Appointment
CONTACT: Will Soeterboek 0415 898 109 [e] [email protected] Justin Sydenham 0417 330 229 [e] [email protected]
bevansthirroul10/345 lawrence hargrave drive 4267 [email protected]
I’M GOIN’ TO JACKSONS
![Page 27: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/27.jpg)
9 May 2013 27
Romance is in the air of this alluring home, what a wonderful start for two. This very neat and well kept three bedroom home just oozes privacy from every angle. Set up high and with amazing National Park views, surround by crisp fresh air you have no choice but to feel relaxed. This home is a great starter or a jump up to the next level once the kiddies have arrived. Either way there is nothing to do but move in. Cook up a romantic dinner for your partner in the well-designed kitchen with plenty of cupboard space, a Westinghouse glass cooktop and also a Bosch dishwasher to make life easyThe open plan combined lounge, complete with a slow combustion heater, imagine those cozy winter nights and cuddling in front of the fire, with a glass of red.
Wendy Lepre 0431 322 192 [e] [email protected] bevansthirroul10/345 lawrence hargrave drive4267 3444 [email protected]
bevans
FOR SALE: Offers above $510,000 WHERE: 9a Parkes Street, HelensburghINSPECT: This Saturday 11am - 11.30am
bed 3 | bath 1 | car 2 | land size 582m2
PRIVATE ROMANTIC HIDEAWAY
Imagine sitting on your balcony, a smile on your face, peace in your heart, listening to the gentle waves on the sand and knowing you have secured your place between the mountains and the sea. Sitting on the high side of Hutton Ave facing north, this sun-drenched piece of east Bulli will tempt the fussiest of buyers. Built by the current owners, it’s history is solid. Not only is it a two minute walk to Bulli beach but schools, parks & cafes are also within a stroll. What more could you want in a location? Homes such as this rarely appear for sale with endless opportunities you are welcome to join us for an inspection.
Kane Downie 0409 969 032 [e] [email protected] bevansthirroul10/345 lawrence hargrave drive4267 3444 [email protected]
bevans
AUCTION: Saturday 25th May at 11.30am on site WHERE: 23 Hutton Avenue, BulliINSPECT: This Saturday 10am - 10.30am
bed 4 | bath 2 | car 2 | land size 569m2
ABSOLUTELY PERFECT
![Page 28: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/28.jpg)
28 9 May 2013
bevansthirroul10/345 lawrence hargrave drive4267 3444 [email protected]
bevans
Bulli $520,000 - $540,00011 Sandon Drive
• Large 602m2 elevated parcel of land set amongst the prestigious homes of Sandon Point, Bulli• It’s hard to imagine a better spot to build your ultimate family home or holiday house• Northerly aspect with escarpment views, short walk to shops, cafes, beaches, schools & parks• Prestigious Sandon Point locationContact: Daniel Field 0404 003 882 [e] [email protected]
land for sale | land size 602m2
bevansthirroul10/345 lawrence hargrave drive4267 3444 [email protected]
bevans
Balgownie $520,000 - $560,000 23 Dymock Street, Open Saturday 12.30pm - 1pm
• This beautiful family home is ready to move straight into, located in a quiet tree lined street• The living spaces provide enough room for a family to enjoy different activities at the same time• With four bedrooms, two bathrooms and two laundries and three toilets, this home’s amenities are set up well• Great for kids, there is brilliant shed space large enough to stow away, the bikes, the fishing rods, the mower, the tools and then work on the home brew!Contact: Kane Downie 0409 969 032 [e] [email protected]
bed 4 | bath 2 | car 3 | land size 601m2
bevansthirroul10/345 lawrence hargrave drive4267 3444 [email protected]
bevans
Fairy Meadow Auction Saturday 25th May at 12pm on site 17 Bassett Street, Open Saturday 11.30am – 12pm
• Perched nicely on the high side of Bassett street, this wonderful home is worthy of any family• The three bedrooms, are a wonderful size and with the added opportunity to have a fourth bedroom in the rear sunroom• The kitchen is beautiful, Caesarstone bench tops, glass splash backs and dish drawer dishwasher all add to its modern appealContact: Kane Downie 0409 969 032 [e] [email protected]
bed 3 | bath 2 | car 1 | land size 696m2
bevansthirroul10/345 lawrence hargrave drive4267 3444 [email protected]
bevans
Thirroul Auction Saturday 25th May at 10.30am on site 106 Princes Highway, Open Saturday 9am - 9.30am
• Watch the ocean from the front yard of this quaint character home• Consisting of two bedrooms plus study, the two bedrooms are large by modern standards, and potential is there for extending off the main• Park your car at the side with ready potential for a garage or carport to be built• Close to Thirroul shops, the best beaches on earth and great schools, invest in your futureContact: Kane Downie 0409 969 032 [e] [email protected]
bed 2 | bath 1 | car 1 | land size 685m2
location shotlocation shot
![Page 29: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/29.jpg)
9 May 2013 29
bevansthirroul10/345 lawrence hargrave drive 4267 3444 [email protected]
bevans
Thirroul Offers Invited1 Woodland Avenue
• Without a doubt one of the finest beachfront parcels of land with the most sublime 360° views!• Located at the end of a quiet cul-de-sac this 639sqm beachfront block is one of so few with a truly unique aspect• A spectacular home has been designed by known architects ‘Innovative’ and is DA approved• Tightly held waterfront blocks will only become harder to acquire, and much more expensive…so seize this opportunity to secure one of the best; and the lifestyle that goes with it!Contact: Daniel Field 0404 003 882 [e] [email protected]
land for sale | land size 639m2
bevanswollongong94 market street 4226 6222 [email protected]
bevans
Bulli $480,000 - $520,00041 George Avenue, Open Saturday 1pm – 1.30pm
• Hidden from the street providing absolute privacy is this gorgeous three bedroom cottage• The large rear timber deck provides gorgeous views over the bush-land and the ocean• The enormous garden is perfect for the budding botanist with established native trees• All three bedrooms are a good size, two have built-ins and one has ocean views• Under the house is a workshop area and shelving to store the quiver of surf boards• This has to be Bulli’s best buy Contact: Andrew Hedley 0410 551 554 [e] [email protected]
bed 3 | bath 2 | car 1 | land size 1132m2
bevansthirroul10/345 lawrence hargrave drive4267 3444 [email protected]
bevans
Thirroul Offers Over $365,000 2/17 Henley Road, Open Saturday 11am - 11.30am
• The opportunity is here again to purchase this popular unit• A ground floor apartment with easy access and a lovely northern outlook over the park• Great outlook, with easy level access, a cosmetic freshen up would help this cool abode shine• The kitchen, updated in the past, has dual access with a window over looking the courtyard• A small block popular with owner occupiers, a short walk to Thirroul beachContact: Daniel Field 0404 003 882 [e] [email protected]
bed 2 | bath 1 | car 1
bevanswollongong94 market street 4226 6222 [email protected]
bevans
SOLD5/24 Campbell Street, Woonona
THE STORY:- 2 weeks on market with Bevans- 25 groups through the property- 3 determined buyers- Price range $550,000 - $580,000- Sold for $618,000- OUR MARKETING AND STYLING WORKS!
Contact: Andrew Hedley 0410 551 554 [e] [email protected]
artists impression
view artists impression location shot
![Page 30: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/30.jpg)
30 9 May 2013
Enjoying a commanding position above the street, this sun filled immaculate residence is all about lifestyle. Perfectly set up for those who pursue their passions with zest, whether you are into cars, sports, birds, gardens or just a good dose of winter sunshine, this is the home for you. The bedroom layout means the master is privately separated from the rascals in the other three. The main bathroom has a separate shower and bath, a great place to soak away the stress of a busy day. There are three living spaces to escape for some peace and quiet. Now for the blokes who love a good grease and oil change, there is a double garage plus room for another three cars off the street. In addition, there is a large workshop space for tool time and a steel girder perfect for the odd motor change before work. This property is within walking distance to schools, shopping centre and public transport. If you have been looking a long time for the perfect home, the wait could be over.
Andrew Hedley 0410 551 554Dragan Balaban 0488 443 910 bevanswollongong94 market street4226 6222 [email protected]
bevans
FOR SALE: Offers above $479,000WHERE: 38 Langson Avenue, FigtreeINSPECT: This Saturday 11am - 11.30am
bed 4 | bath 1 | car 4
SUN LOVER, BIRD LOVER, CAR LOVER
Lisa Brooke 0423 901 094Andrew Hedley 0410 551 554bevanswollongong94 market street4226 6222 [email protected]
bevans
AUCTION: Saturday 1st June at 12.30pm on siteWHERE: 8 Toorak Avenue, MangertonINSPECT: This Saturday 12pm - 12.30pm
bed 3 | bath 1 | car 1 | land size 759m2
FUNKY, RENOVATED & DELIGHTFULPositioned in the quiet leafy streets of Mangerton this gorgeous home has charm, character and style. At one with nature with its clever mix of indoor and outdoor living spaces, you will never want to leave. Inside you will discover 50s classic features; high ceilings, ornate cornices and polished floor boards. Large picture windows connect you to the leafy surrounds and draw in beautiful natural light. A contemporary kitchen with oodles of cupboard space flows to a casual living area. An expansive rear deck spans the width of the home, glass of wine in hand take in stunning sunsets over the escarpment. Host a BBQ with friends in your undercover section of the deck as the kids play happily and safely in the level backyard. All three bedrooms are spacious; the third is a great option for teenagers or guest retreat. An inspection is a must because this is a wonderful place to call home.
![Page 31: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/31.jpg)
9 May 2013 31
bevanscorrimalbevans
1/183 princes highway[t] 42 442 442[e] [email protected]
East Corrimal Offers above $254,0005/16 Railway Street, Open Saturday 12pm - 12.30pm
• Live the dream of owning a recently renovated townhouse style unit• Open plan living, modern kitchen and separate laundry with access to rear yard• Upstairs features modern bathroom, two bedrooms one with two built in wardrobes• Enjoy the convenience of off street parking for a single vehicle• Excellent location in close proximity public transport, Corrimal CBD, beaches, and recreation
Contact: Phil Murray 0411 854 785 [e] [email protected]
bed 2 | bath 1
Woonona Offers above $227,00023/133a Campbell Street, Open Saturday 10.45am - 11.15am
• Light filled top floor unit ready to make your own• Open plan lounge and dining areas flow onto sunny balcony• Functional kitchen features ample cupboard space and electric appliances• Bright and airy bedrooms, both are a good size• Internal laundry adjoins the kitchen and has storage • Large single remote lock up garage is found directly downstairs from the unit
Contact: Sam Vescio 0402 083 446 [e] [email protected]
bed 2 | bath 1 | car 1
Corrimal Offers above $385,00039 Tarrawanna Road, Open Saturday 11.30am - 12pm
• This three bedroom family home enjoys amazing escarpment views and a great backyard • Providing the perfect opportunity for young families or investors looking for an excellent return• Large original kitchen with wall oven/grill, gas stove top, plenty of cupboard space and dining area • Large fully fenced yard which features patio, BBQ area and garden shed • Single garage with access to underneath the property which is ideal for storage or hobbyist
Contact: Chris Ljungdahl 0488 877 355 [e] [email protected]
bed 3 | bath 1 | car 1
Corrimal Offers above $239,0008/23 Park Road, Open Saturday 12.30pm - 1pm
• Spacious floor plan offers separate living and dining areas• Beautiful new kitchen with separate laundry and storage• Both bedrooms are large in size and master with built-in-wardrobes• Living area opens onto a private east facing balcony enjoying district views• Positioned on the 1st floor of a well maintained security complex
Contact: Chris Ljungdahl 0488 877 355 [e] [email protected]
bed 2 | bath 1 | car 1
Lake Heights Offers above $549,00089 Northcliffe Drive Open Saturday 12.45pm - 1.15pm
• Set upon picturesque Lake Illawarra this fabulous family home is a contemporary statement in lifestyle • With a versatile floor plan that could easily accommodate in laws, or a home office• Complimented by stunning water views, with your rear yard adjoining the lakefront and bike track• Huge master suite with own private bathroom, walk in robe, and parents retreat• Four separate living areas including formal dining, oversized rumpus, upstairs TV area and tiled lounge room• Sunny yard overlooking the water, making the most of this stunning location. Plenty of potential for landscaping and construction of a deck or entertaining area
Contact: Jaine Connery 0410 426 320 [e] [email protected]
bed 4 | bath 3 | car 2
Woonona Offers above $549,000167 Campbell Street, Open Saturday 10am - 10.30am
• Large commercial property at rear of residential dwelling• Located in the heart of Woonona is this home which represents an ideal opportunity • North facing three bedroom home, rear commercial dwelling on a large 752m2 block• Rear dwelling previously occupied as a successful commercial premises • With over 100 square metres of commercial space the possibilities are endless (STCA)
Contact: Sam Vescio 0402 083 446 [e] [email protected]
bed 3 | bath 1
location shot
Russell Vale Offers above $339,0002/650-652 Princes Highway, Open Saturday 11am - 11.30am
• This relaxed north facing home is one of only two townhouses in the complex • Offering comfortable living in a highly convenient location • Living and dining areas open out to the large north facing balcony • Fantastic design and only moments to local shops, schools and transport• Ideal for first home buyers or those seeking an investment opportunityContact: Phil Murray 0411 854 785 [e] [email protected]
bed 2 | bath 1 | car 2
![Page 32: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/32.jpg)
32 9 May 2013
bevansdaptobevans
25 princes highway[t] 4261 5222[e] [email protected]
bevansbevansshellharbour 123 shellharbour road
[t] 4296 5111[e] [email protected]
Dapto Offers above $362,00093 Compton Street, Inspect by Appointment
• Exuding a warm and welcoming ambiance • Salt water in-ground pool, great for those summer months• Perfect size lounge and dining rooms, polished floor boards throughout living areas• Near new kitchen + appliances and modernized bathroom with separate toilet• Reverse cycle air conditioner in the lounge room
Contact: Rebecca Coe 0413 148 509 [e] [email protected]
bed 3 | bath 1 | car 2
Horsley Offers above $339,00028 Highland Park Drive, Inspect by Appointment
• This delightful single level home provides all the ingredients for comfortable family living• The home is tucked away in a quiet enclave promoting a relaxed and low maintenance lifestyle• Impressive and spacious living area with air conditioning, flows through to dining • Three good sized bedrooms all with mirrored robes and ceiling fans• Large covered outdoor entertaining area, ideally located in a family friendly neighbourhood
Contact: Rebecca Coe 0413 148 509 [e] [email protected]
bed 3 | bath 1 | car 1
Berkeley Offers above $165,000Views
• Sloping 640m2 parcel of land • Picturesque views of Lake Illawarra• Located in a child friendly quiet cul-de-sac • Set amongst luxury homes with the popular Port Beach just minutes away• Located in close proximity to major shopping centres and schools
Contact: Rebecca Coe 0413 148 509 [e] [email protected]
land for sale
Dapto $330,000 - $380,000245 Kanahooka Road, Open Saturday 1pm - 1.30pm
• Large 708m2 block of land• Garage has a separate room at the rear for storing all your tools • Floating floors through the hall, kitchen and dining areas • Potential rental return of $360pw to $380pw• Generous size living area
Contact: Simon Halcrow 0402 371 001 [e] [email protected]
bed 3 | bath 1 | car 1
Dapto Offers above $420,00057 Lakelands Drive, Open Saturday 10am – 11am
• Featuring a flexible floor plan and a great use of space• Four sizeable bedrooms include ceiling fans• Separate living and dining options, downstairs study or sewing room• Plenty of storage space throughout the home• Large remote tandem garage with storage / workshop space• Close proximity to shops, schools and transportContact: Gino Spinelli 0409 969 202 [e] [email protected]
bed 4 | bath 1 | car 2
Albion Park Rail Offers above $769,000Blissful Horse Lovers Retreat
• Over an acre of easy care land, close to town with an impressive and substantial home• A horse friendly property with stables and four fully fenced paddocks ideal for horse enthusiasts• Flexible living spaces, three sizeable bedrooms all feature ensuites, two with walk-in robes• Well appointed kitchen has double pantry & double fridge space plus breakfast bar• North facing covered family outdoor entertaining area overlooking in-ground pool• Two car garage, gated driveway with wide access to rear of property & parking for horse floatsContact: Alastair Reid 0434 767 552 [e] [email protected]
bed 4 | bath 4 | car 2
![Page 33: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/33.jpg)
Thursday 9 to Wednesday 15 May
Albion Park 2527 11:00-11:30 Sat 34 Broughton Ave Harcourts 0405 454 624 $479,900 H11:00-11:30 Sat 7 Ashton Cl Harcourts 0405 454 624 $629,000 H12:30-1:00 Sat 66 Mayfield Cct Raine & Horne 0419 991 500 O/A$375,000 H2:00-2:30 Sat 3 Scenic Cres Ray White 4271 4000 $345,000 H
Albion Park Rail 2527 10:00-10:20 Sat 5/12 Wooroo St Harcourts 4261 3211 $259,000 U10:30-11:00 Sat 13 Jarrah Way Domain First Na 0412 717 444 O/A$300,000 H11:00-11:30 Sat 3/2 Candlebark St MMJ 0418 333 149 $339,500 V11:00-11:30 Sat 29 Shearwater Bvd PRDnationwide 0408 424 474 $540,000 - $580,000H12:00-12:30 Sat 1/212 Princes Hwy Harcourts 0405 454 624 $289,900 H12:30-1:15 Sat 14 Rose Ave LJ Hooker 0402 121 870 $339,000 H12:30-1:15 Sat 34 Maple St LJ Hooker 0404 497 521 $359,000 H1:00-1:30 Sat 3/17 Koona St PRDnationwide 4261 0333 $325,000 - $350,000 V3:00-3:30 Sat 29 Elm St MMJ 0400 002 255 $359,900 H9:30-10:00 Sat 20 Spoonbill Pl McPhail 0410 868 632 $549,000 H
Austinmer 2515 1:00-1:30 Sat 54 Lawrence Hargrave Dr Ray White 4294 7000 O/A$700,000+ H2:00-2:30 Sat 2/1 Oceana Pde Bevans 0410 551 554 $759,000 TWN
Balgownie 2519 10:00-10:30 Sat 4 Chalmers St Clayton R/E 4226 1074 $469,000 H11:00-11:30 Sat 4 Byrnes Pl Peter Taranto 0403 618 988 $699,000 H11:00-11:45 Sat 13 Margaret St MMJ North 0412 425 801 $485,000 H12:00-12:30 Sat a/22 Brian St Peter Taranto 0417 124 313 $519,000 TWN12:30-1:00 Sat 23 Dymock St Bevans 0409 969 032 $520,000 - $560,000 H
Barrack Heights 2528 10:00-10:30 Sat 3/275 Shellharbour Rd Master 0410 418 680 $279,000 V10:45-11:15 Sat 2 Bligh Pl Master 0410 418 680 O/A $345,000 H11:00-11:30 Sat 81 Strata Ave Coastside First 0411 306 323 $469,000 H11:30-12:00 Sat 2a Bligh Pl Master 0410 418 680 $379,000 H1:30-1:50 Sat 39 Cassia St MMJ 0408 411 723 O/A $370,000 H
Bellambi 2518 10:30-11:00 Sat 12/4 Edyth St Doug.Harcourts 0412 188 171 $229,000 V11:00-11:30 Sat 4/18 Byron St Professionals 0411 315 450 $229,500 H11:00-11:30 Sat 7/18-20 Byron St Park Trent 4229 1655 O/A$260,000 U1:15-1:45 Sat 4/20 Owen Park Rd Coastside First 0423 507 488 $249,990 U
Berkeley 2506 10:30-11:00 Sat 16 Newcombe St MMJ 0418 423 782 $349,900 H10:50-11:20 Sat 5 Whimbrel Ave MMJ 0408 411 723 O/A$490,000 H11:00-11:30 Sat 27 Warwick St MMJ 0438 613 822 $312,000 H11:30-11:50 Sat 39 Massey St MMJ 0408 411 723 O/A$260,000 H12:00-12:45 Sat 76 Essex St Right Choice 4297 6444 $299,000 TWN12:15-12:45 Sat 15 London St Domain First Na 0412 717 444 $285,000 H
Berry 2535 1:00-1:30 Sat 99B Harley Hill Rd Bevans 0410 551 554 O/A$690,000 H
Blackbutt 2529 10:30-11:00 Sat 89 Chillawong Cct McPhail 0410 868 632 $390,000 H2:10-2:40 Sat 4 Dunnart Pl MMJ 0408 411 723 O/A$640,000 H
Bulli 2516 10:00-10:45 Sat 76 Park Rd Ray White 0411 969 656 $569,000 H10:00-10:30 Sat 23 Hutton Ave Bevans 0409 969 032 Auction H11:00-11:30 Sat 2A Alanson Ave O’Connor 0414 946 000 $585,000 H11:00-11:45 Sat 14 Cope Pl MMJ North 0412 424 071 O/A$560,000 H11:00-11:45 Sat 2/31 Park Rd MMJ North 0412 626 964 $495,950 TWN11:30-12:15 Sat 14 Alroy St Ray White 0422 050 392 Auction H12:00-12:30 Sat 54 Willcath St MMJ 0416283876 O/A $729,000 H12:00-12:45 Sat 1E Willcath St Ray White 0403 305 315 $990,000 H12:00-12:45 Sat 30 Aragan Cct Doug.Harcourts 0411 385 833 Auction H12:30-1:15 Sat 29 Beacon St Huxley 0414 428 401 O/A$590,000 H12:30-1:15 Sat 29 Beacon Ave Ray White 0433 175 681 $590,000 H1:00-1:30 Sat 41 George Ave Bevans 0410 551 554 $480,000 - $520,000 H2:00-2:30 Sat 43 Beacon Ave McPhail 0410 868 632 O/A$545,000 H9:15-9:45 Sat 2/308-310 Princes Hwy Bevans 0410 426 320 O/A$249,000 U
Coalcliff 2508 11:00-11:30 Sat 237 Lawrence Hargrave Dr Ray White 4294 7000 Auction H
Coniston 2500 10:15-10:45 Sat 1/58 Robertson St L J Hooker 0408 422 864 $225,000 U11:45-12:15 Sat 4/15 Myrtle St Clayton R/E 4226 1074 $295,000 U2:00-2:30 Sat 6/41-43 Robertson St MMJ 0418 421 074 O/A$349,000 TWN
Cordeaux Heights 2526 12:00-12:30 Sat 51 Taminga Cres O’Connor 0416 266 055 $799,000 H12:00-12:30 Sat 73 Derribong Dr Ray White 4271 4000 $399,000-$439,000 H
Corrimal 2518 10:00-11:00 Sat 17 Angel St O’Connor 0405 388 041 O/A$495,000 H11:00-12:00 Sat 1/273 Rothery St MMJ North 0412 421 214 $480,000 - $500,000 TWN11:00-11:30 Sat 7/406 Princes Hwy Raine & Horne 4229 9600 O/A$325,000 TWN11:30-12:00 Sat 39 Tarrawanna Rd Bevans 0488 877 355 O/A$385,000 H11:30-12:30 Sat 6 Cheryl Pl Huxley 0414 428 401 O/A$650,000 H12:30-1:00 Sat 17 Angel St O’Connor 0405 388 041 O/A$495,000 H12:30-1:00 Sat 8/23 Park Rd Bevans 0488 877 355 O/A$239,000 U
Corrimal East 2518 11:00-11:30 Sat 61 Dobbie Ave O’Connor 0416 266 055 $640,000 H2:00-2:30 Sat 3/24 Parker Rd Peter Taranto 0429 809 856 $255,000 U
Cringila 2502 12:30-1:00 Sat 174 Lake Ave Master 0410 418 680 $275,000 H1:15-1:45 Sat 41 Newcastle St Master 0410 418 680 $289,000 H2:00-2:30 Sat 9 McGovern St L J Hooker 0411 713 523 O/A$250,000+ H
Dapto 2530 10:00-10:45 Sat 81 Mount Brown Rd Ray White 0423 218 285 $383,000 H10:00-11:00 Sat 57 Lakelands Dr Bevans 0409 969 202 O/A$420,000 H10:00-10:20 Sat 10 Crighton Pl Harcourts 4261 3211 $395,000 H10:40-11:00 Sat 10 Cormack Ave Harcourts 4261 3211 $379,000 H11:00-11:30 Sat 64 Laver Rd Peter Taranto 0418 627 220 $329,000 H11:00-11:20 Sat 109 Lakelands Dr Harcourts 4261 3211 $305,000 H11:00-11:30 Sat 6 Laver Rd LJ Hooker 0468 944 961 $345,000 - $365,000 H11:20-11:40 Sat 22 Rosemount St Harcourts 4261 3211 $619,000 H11:40-12:00 Sat 5 Kapooka Ave Harcourts 4261 3211 $349,000 H12:00-12:20 Sat 81 Byamee St Harcourts 4261 3211 $285,000 - $305,000 H12:00-12:30 Sat 88 Parkside Dr PRDnationwide 4261 0333 $310,000 - $330,000 H12:00-12:30 Sat 100 Laver Rd LJ Hooker 0405 373 916 $295,000 - $305,000 H12:00-12:30 Sat 31 Eleebana Cres MMJ 0409 612 000 $329,900 H12:20-12:40 Sat 19 Kundle St Harcourts 4261 3211 $279,000 H1:00-1:20 Sat 11 Kundle St Harcourts 4261 3211 $309,000 H1:30-2:00 Sat 7 Duley St Raine & Horne 4229 9600 O/A$350,000 H
East Corrimal 2518 10:00-10:30 Sat 116 Pioneer Rd Ray White 0419 211 331 $460,000 H11:00-11:45 Sat 37 Murray Rd AM Rutty 4229 6311 $489,500 H11:00-11:30 Sat 7/44 Thalassa Ave Park Trent 4229 1655 $259,000 U12:00-12:30 Sat 5/16 Railway St Bevans 0402 083 446 O/A $254,000 U1:00-1:30 Sat 2/82 Murray Rd Domain First Na 0412 717 444 $239,000 U
Fairy Meadow 2519 11:00-11:30 Sat 8 Mount Ousley Rd McPhail 0412 422 294 $379,000 H11:00-11:30 Sat 5/24 Cowper St McPhail 0418 420 090 $409,000 TWN11:30-12:00 Sat 17 Bassett St Bevans 0409 969 032 Auction H3:00-3:30 Sat 21 Norman St Peter Taranto 0429 809 856 $495,000 H
Farmborough Heights 2526 10:00-10:30 Sat 26 Stanley Ave Ray White 4271 4000 $350,000 - $390,000 H11:00-11:20 Sat 129 Iola Ave Harcourts 4261 3211 O/A $379,000 H11:00-11:30 Sat 77 Panorama Dr Master 0434 970 439 $409,000 H1:00-1:20 Sat 129 Iola Ave Harcourts 4261 3211 O/A$379,000 H1:00-1:30 Sat 2 Stanley Ave O’Connor 0416 266 055 $389,000 H1:00-1:30 Sat 26 Stanley Ave Ray White 4271 4000 $350,000 - $390,000 H
Figtree 2525 11:00-11:30 Sat 159 Jacaranda Ave Raine & Horne 0411 800 801 Auction H11:00-11:30 Sat 33 Uralba St Southern Estate 0416 089 884 Auction H11:00-11:30 Sat 16 Darragh Dr Ray White 4271 4000 $595,000 - $645,000 H11:00-11:45 Sat 42 Gibsons Rd Ray White 0419 211 331 Auction H11:00-11:30 Sat 89 Bellevue Rd Ray White 0419 211 331 $449,000 H11:00-11:30 Sat 38 Langson Ave Bevans 0410 551 554 O/A$479,000 H
![Page 34: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/34.jpg)
Thursday 9 to Wednesday 15 May
Fees, charges and lending criteria apply. Terms and conditions available on request. Different rates apply to other loan products and fixed rate periods. These rates are current as at 11 February 2013 and are available to new and existing customers who meet RAMS’ eligibility criteria. RAMS will apply the fixed rate that is available at the loan settlement date or the date the fixed rate period commences, unless the customer locks a fixed rate in on the loan using our rate lock feature. The rate lock fee is 0.15% of the fixed loan amount. Existing applicants who have locked in rates prior to 11 February 2013 will receive the rate at which they locked in. At the end of the fixed rate period, the interest rate will convert to the variable interest rate applicable on the day. For new customers on the Fixed Rate Home Loan, this will be the Standard Variable Rate. *This comparison rate is based on a $150,000 RAMS Fixed Rate Home Loan over a term of 25 years. WARNING: This comparison rate is true only for the examples given and may not include all fees and charges. Different terms, fees or other loan amounts might result in a different comparison rate. RAMS Home Loans Wollongong is owned and operated by Wollongong Financial Services Pty Ltd ABN 82 108 210 804. Credit provider: Westpac Banking Corporation ABN 33 007 457 141 AFSL and Australian credit licence 233714
Busy? No problem we’ll come to you. So call RAMS today! Call 13 RAMS or jump online.RAMS Home Loans Wollongong: Wollongong – 4229 5455 Dapto – 4261 3200RAMS.com.au
6.49% p.a.Comparison Rate*
4.99% p.a.RAMS Fixed Rate Home Loan – 1 year rate
RAMS can fix your rate!
11:30-12:00 Sat 6 Gellatly Ave Ray White 0431 821 949 $435,000 H12:00-12:30 Sat 29a. Lamerton Dr MMJ North 0412 425 801 O/A$600,000 H12:00-12:30 Sat 196 O’Briens Rd O’Connor 0414 449 631 O/A$680,000 H12:15-1:00 Sat 29 Gellatly Ave Ray White 0431 821 949 $359,000 H12:30-1:30 Sat 107 O’Donnell St Right Choice 4297 6444 $548,000 H2:00-2:30 Sat 159 Jacaranda Ave Raine & Horne 0411 800 801 Auction H2:00-3:00 Sat 4 Herne St LJ Hooker 0404 497 521 Auction H2:00-2:30 Sat 89 Bellevue Rd Ray White 0419 211 331 $449,000 H2:00-2:30 Sat 16 Darragh Dr Ray White 4271 4000 $595,000 - $645,000 H
Flinders 2529 1:00-1:45 Sat 30 Berringer Way Right Choice 4297 6444 $429,000 H
Gerroa 2534 12:00-12:30 Sat 145 Headland Dr Harcourts 0412 271 091 Auction H
Gwynneville 2500 10:00-10:30 Sat Unit 2/19 John St MMJ 0418 421 074 $259,999 U10:30-11:00 Sat 4/3 Catherine St Ray White 0433 175 681 O/A$399,000 H1:00-2:00 Sat 3 John St Huxley 0409 299 407 $939,000 H2:00-2:30 Sat 31 Lucinda St Living Property 0417 244 855 $725,000 H
Haywards Bay 2530 1:00-1:30 Sat 16 Bayview Ave PRDnationwide 0418 244 601 $655,000 - $685,000 H2:30-3:00 Sat 152 Haywards Bay Dr Coastside First 0413 747 322 $485,000 H
Helensburgh 2508 10:00-10:30 Sat 59 Walker St Bevans 4294 3699 $479,000 H10:00-10:30 Sat 1/15 Stuart St Ray White 0410 148 397 Auction U10:15-10:45 Sat 12/11 Stuart St Ray White 4294 7000 Auction U10:30-11:00 Sat 3 Frances St Ray White 0410 148 397 $575,000+ H11:00-11:30 Sat 68 Walker St Ray White 0410 148 397 Auction H11:00-11:30 Sat 19 McLerie St Ray White 4294 7000 $725,000+ H11:00-11:30 Sat 9a Parkes St Bevans 4294 3699 O/A$510,000 H12:00-12:30 Sat 32 Halls Rd Ray White 4294 7000 Auction H12:00-12:30 Sat 32 Laurina Ave Ray White 4294 7000 Auction H2:00-2:30 Sat 1b Laurina Ave Ray White 4294 7000 O/A$450,000+ D
Horsley 2530 10:30-11:30 Sat 10 Riverpark Way Scholtens 0418 689 609 $399,000 H11:00-11:30 Sat 11 Horsley Dr PRDnationwide 0418 244 601 $325,000 - $355,000 H11:00-11:30 Sat 14 Riverpark Way PRDnationwide 0418 244 601 $435,000 - $465,000 H12:00-12:30 Sat 51 Sunnybank Cres PRDnationwide 0418 244 601 $475,000 - $495,000 H12:40-1:00 Sat 10 Highland Park Dr Harcourts 4261 3211 $479,000 H1:00-1:30 Sat 8 Armitage Ave MMJ 0409 612 000 $539,900 H2:00-2:30 Sat 2 Appleby Cl MMJ 0400 002 255 $459,900 H2:00-2:30 Sat 8 Spears Pl MMJ 0438 613 822 $479,900 H
Kanahooka 2530 10:30-11:00 Sat 167 Kanahooka Rd LJ Hooker 0402 844 636 $330,000 H11:00-11:30 Sat 21 Thirroul Rd MMJ 0400 002 255 $339,900 H1:00-1:30 Sat 245 Kanahooka Rd Bevans 0412 424 226 $330,000 - $380,000 H1:20-1:40 Sat 208 Kanahooka Rd Harcourts 4261 3211 $529,000 H
Keiraville 2500 11:00-11:45 Sat 16 Cassian St AM Rutty 0408 424 155 $659,000 H11:30-12:30 Sat 61 Murphys Ave Huxley 0409 299 407 $499,000 H
Kiama 2533 10:00-10:30 Sat 2/70 Minnamurra St Harcourts 0412 271 091 $320,000 U11:00-11:30 Sat 11 Hartwell Cres Harcourts 0412 271 091 Auction H1:00-1:30 Sat 14/130 Shoalhaven St Harcourts 0412 271 091 $365,000 V1:00-2:00 Sat 1 Spring Creek Dr Bevans 0409 969 202 Exp of interest H1:00-2:00 Sun 1 Spring Creek Dr Bevans 0409 969 202 Exp of interest H
Koonawarra 2530 10:00-10:30 Sat 127 Wyndarra Way LJ Hooker 0405 373 916 $350,000 - $370,000 H10:00-10:30 Sat 17 Wallabah Way PRDnationwide 0418 244 601 $310,000 - $330,000 H10:00-10:30 Sat 16 Allambie Ave Park Trent 4229 1655 $299,000 H12:30-1:00 Sat 51 Weemala Cres LJ Hooker 0402 844 636 $339,000 H
Lake Heights 2502 12:45-1:15 Sat 89 Northcliffe Dr Bevans 0410 426 320 O/A $549,000 H
Lake Illawarra 2528 11:00-11:30 Sat 10/46-48 Peterborough Ave Bevans 0412 424 226 O/A$209,000 U1:00-1:30 Sat 140 Pur Pur Ave Ray White 4271 4000 $559,000 H
Mangerton 2500 10:45-11:30 Sat 42 McAndrew Cres Peter Taranto 0429 809 856 $598,500 H11:00-11:30 Sat 117 Heaslip St Professionals 0411 315 450 $695,000 H12:00-12:30 Sat 22 McArthur Pde Professionals 0411 315 450 $689,000 H12:00-12:30 Sat 27/17 Payne St Peter Taranto 0418 627 220 $279,0000 U12:00-12:30 Sat 8 Toorak Ave Bevans 0423 901 094 Auction H1:00-1:30 Sat 3/3 Powell St O’Connor 0416 266 055 $369,000 U10:45-11:30 Sun 42 McAndrew Cres Peter Taranto 0429 809 856 $598,500 H
Mount Keira 2500 11:00-11:30 Sat 1 Medway Dr Raine & Horne 0419 991 500 Auction H11:00-11:30 Sat 129 Koloona Ave ARRE 0422 183 341 $510,000-$539,000 H12:30-1:30 Sat 218 Mount Keira Rd Southern Estate 0418 421 281 Auction H12:45-1:30 Sat 6 Parkman Pl Peter Taranto 0429 809 856 $680,000 H1:00-1:30 Sat 1 Medway Dr Raine & Horne 0419 991 500 Auction H
Mount Kembla 2526 11:00-12:00 Sat Lot 1 Kirkwood Pl Southern Estate 0418 421 281 Auction L11:00-12:00 Sat Lot 2 Kirkwood Pl Southern Estate 0418 421 281 Auction L11:00-12:00 Sat Lot 3 Kirkwood Pl Southern Estate 0418 421 281 Auction L11:00-12:00 Sat Lot 4 Kirkwood Pl Southern Estate 0418 421 281 Auction L11:00-12:00 Sat LOTS 1-4 Kirkwood Pl Southern Estate 0418 421 281 Auction L2:00-2:30 Sat 10 Bradley Ave O’Connor 0416 266 055 $379,990 H
Mount Ousley 2519 11:00-11:30 Sat 88 Dumfries Ave Ray White 0438 488697 Auction H2:00-2:30 Sat 88 Dumfries Ave Ray White 0438 488697 Auction H
Mount Pleasant 2519 2:00-3:00 Sat 13 Hebron Ave Scholtens 0412 423 223 $579,000 H
Mount Saint Thomas 2500 11:00-11:30 Sat 53 Taronga Ave Peter Taranto 0411 754 884 $339,000 H11:45-12:15 Sat 13 Waldron St Peter Taranto 0411 754 884 $349,000 H12:00-12:30 Sat 96 The Ave Raine & Horne 4229 9600 $375,000-$395,000 H2:00-2:30 Sat 96 The Ave Raine & Horne 4229 9600 $375,000-$395,000 H
Mount Warrigal 2528 11:00-11:30 Sat 60 Morgan Ave MMJ 0412 426 495 $359,000 H
North Wollongong 2500 12:00-12:45 Sat 46/7-9 Corrimal St AM Rutty 0408 424 155 $225,000 U12:30-1:30 Sat 18/60 Bourke St Scholtens 0418 689 609 $389,000 U9:30-10:15 Sat 4/36 Pleasant Ave Huxley 0414 428 401 $469,000 TWN
Oak Flats 2529 11:00-11:30 Sat 5 Gordon Ave MMJ 0422 744 097 $339,000 H12:00-12:30 Sat 126 Wentworth St MMJ 0422 744 097 $369,000 H3:00-3:20 Sat 127 Barton St MMJ 0408 411 723 O/A$330,000 H
Penrose 2530 10:30-11:15 Sat 4 Long Pl Doug.Harcourts 0423 043 302 $369,000 H1:00-1:30 Sat 10 Long Pl MMJ 0418 333 149 $329,900 H2:00-2:30 Sat 40 Goolagong St MMJ 0418 333 149 $429,900 H
Port Kembla 2505 10:00-10:45 Sat 54 Bland St Park Trent 0415 112 702 $339,000 H12:00-12:30 Sat 62 Odonnell St Bevans 0412 424 226 O/A$299,000 H12:45-1:15 Sat 2/173 Wentworth St Coastside First 0413 747 322 $175,000 U1:00-1:30 Sat 48 Keira St L J Hooker 0411 713 523 Auction H1:30-2:00 Sat 20 Jubilee Rd Coastside First 0413 747 322 $322,000 H2:00-2:30 Sat 21 Bland St Master 0434 970 439 $465,000 H
Primbee 2502 12:30-1:00 Sat 8/57-59 Illowra Cres McPhail 0410 868 632 $319,000 V
![Page 35: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/35.jpg)
Wollongong 2500 10:00-10:30 Sat 11/27 Church St Raine & Horne 4229 9600 $295,000-$335,000 U10:00-10:30 Sat 17/26-28 Market St Raine & Horne 4229 9600 $359,900 U10:00-4:00 Sat 18/22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U10:00-4:00 Sat 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U10:00-4:00 Sat 8/22-32 Gladstone Ave Clayton R/E 0414 271 444 $440,000 U10:00-10:30 Sat 4/7 Corrimal St Ray White 0423 218 285 $189,000 U10:00-10:30 Sat 6 Colleen Gr Harcourts 4261 3211 Auction H10:00-10:30 Sat 1/18 Rowland Ave MMJ 0400 002 255 $359,900 U10:00-10:30 Sat 4 Parkinson St Professionals 0411 315 450 $499,000 H10:00-10:30 Sat 54/71-83 Smith St Professionals 0411 315 450 $420,000 U10:00-10:30 Sat 3/26-28 Market St O’Connor 0416 266 055 $389,000 U10:00-10:30 Sat 8/26-28 Market St O’Connor 0416 266 055 $389,000 U10:00-10:30 Sat 2/64 Kenny St Ray White 0419 211 331 $529,000 V10:00-10:30 Sat 7/26 Market St Peter Taranto 4228 1622 $389,000 U10:30-11:00 Sat 7/19 Beatson St Ray White 0422 050 392 $285,000 U10:30-11:00 Sat 6/90 Rowland Ave Ray White 0431 821 949 $290,000 - $320,000 U11:00-11:30 Sat 18/143-149 Corrimal St Clayton R/E 4226 1074 $489,000 U11:00-11:30 Sat 60/60-62 Harbour St Peter Taranto 4228 1622 O/A$669,000 U11:00-11:30 Sat 4/55 Bligh St MMJ 0418 421 074 O/A$299,999 U11:00-11:30 Sat 10 South St Harcourts 0408 422 644 $347,000 H11:00-11:30 Sat 2/11a Macquarie St MMJ 0423 825 072 $259,990 U11:00-11:30 Sat 1/14-16 Mangerton Rd L J Hooker 0408 422 864 $459,900 V11:00-12:00 Sat 1-24/5-7 Stewart St Clayton R/E 0414 271 444 From $430,000 U11:15-11:45 Sat 3/24 Fisher St Ray White 0433 175 681 $525,000 T11:45-12:15 Sat 23/20-22 Kembla St Peter Taranto 0429 809 856 $539,000 U12:00-12:30 Sat Unit 21/4 Bank St MMJ 0423 825 072 $579,990 U12:00-12:30 Sat 5 Robinson St Peter Taranto 0403 618 988 O/A$465,000 H12:00-12:30 Sat 14/19 Market St Harcourts 4229 8255 O/A$449,000 U12:00-12:30 Sat 4/46 Corrimal St McPhail 0412 422 294 O/A$495,000 U12:00-12:30 Sat 5/47 Gipps St MMJ 0418 421 074 O/A $329,000 TWN12:00-12:45 Sat 30 Mercury St AM Rutty 4229 6311 $520,000 H12:30-1:00 Sat 14/27 Church St Ray White 0423 218 285 $359,000 U12:30-1:00 Sat 25 Hilltop Ave One Agency 0415 424 257 AUCTION H1:00-1:45 Sat 74 New Dapto Rd AM Rutty 0418 603 447 O/A$420,000 H1:00-1:30 Sat 26 Jutland Ave Peter Taranto 0418 627 220 $489,000 H1:00-1:30 Sat 5/78-82 Campbell St MMJ 0418 421 074 O/A$449,999 U1:00-1:45 Sat 7/53 Corrimal St AM Rutty 0408 424 155 $259,000 U1:00-1:30 Sat 33 Edward St MMJ 0416283876 $1,290,000 H1:15-1:45 Sat 3/23 Osborne St Raine & Horne 4229 9600 O/A $260,000 U1:30-2:00 Sat 3/4-6 Sperry St Ray White 0431 821 949 $379,000 U2:00-2:30 Sat 6 Colleen Gr Harcourts 4261 3211 Auction H2:00-2:30 Sat 3/24 Fisher St Ray White 0433 175 681 $525,000 T2:30-3:00 Sat 2/64 Kenny St Ray White 0419 211 331 $529,000 V2:30-3:00 Sat 1a/46 Smith St Ray White 0431 821 949 $969,000 H9:30-10:15 Sat 5/82 New Dapto Rd McPhail 0418 420 090 $349,900 U10:00-5:00 Fri 8/22-32 Gladstone Ave Clayton R/E 0414 271 444 $440,000 U10:00-5:00 Fri 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U10:00-5:00 Fri 18/22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U10:00-5:00 Thu 18/22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U10:00-5:00 Thu 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U10:00-5:00 Thu 8/22-32 Gladstone Ave Clayton R/E 0414 271 444 $440,000 U10:00-5:00 Wed 8/22-32 Gladstone Ave Clayton R/E 0414 271 444 $440,000 U10:00-5:00 Wed 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U10:00-5:00 Wed 18/22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U10:00-5:00 Tue 18/22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U10:00-5:00 Tue 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U10:00-5:00 Tue 8/22-32 Gladstone Ave Clayton R/E 0414 271 444 $440,000 U10:00-12:00 Mon 8/22-32 Gladstone Ave Clayton R/E 0414 271 444 $440,000 U10:00-12:00 Mon 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U10:00-12:00 Mon 18/22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U10:00-4:00 Sun 18/22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U10:00-4:00 Sun 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $365,000 U10:00-4:00 Sun 8/22-32 Gladstone Ave Clayton R/E 0414 271 444 $440,000 U11:45-12:15 Sun 23/20-22 Kembla St Peter Taranto 0429 809 856 $539,000 U
Thursday 9 to Wednesday 15 May
Russell Vale 2517 11:00-11:30 Sat 2/650-652 Princes Hwy Bevans 0402 083 446 O/A$339,000 TWN11:00-11:30 Sat 68 Collaery Rd Doug.Harcourts 0411 385 833 $460,000 H
Sandon Point 2516 1:00-1:30 Sat 21 Sandon Dr Wiseberry 0414 539 699 O/A$950,000 H
Shell Cove 2529 12:00-12:30 Sat 3 Green Cres Coastside First 0411 306 323 $644,500 H12:00-12:30 Sat 10 La Perouse Ave Ray White 4271 4000 $619,000 H
Stanwell Park 2508 12:00-12:30 Sat 5a The Dr Bevans 4294 3699 O/A $530,000 D12:00-12:30 Sat 28 Chellowdene Ave Ray White 4294 7000 Auction H12:45-1:15 Sat 50 The Dr Ray White 4294 7000 Auction H1:00-1:30 Sat 13 Sheridan Cres Bevans 4294 3699 $740,000 H
Tarrawanna 2518 12:00-12:30 Sat 14 Corrimal St O’Connor 0416 266 055 $729,000 H
Thirroul 2515 10:30-11:15 Sat 42 Kanangra Dr Huxley 0414 428 401 $699,000 H10:30-11:15 Sat 42 Kanangra Dr Ray White 0433 175 681 $699,000 H10:30-11:00 Sat 26 Pass Ave Ray White 0433 175 681 $575,000 H11:00-11:30 Sat 2 Parkwood Gr 4267 3344 Over $890,000 H11:00-11:30 Sat 2/17 Henley Rd Bevans 0417 330 229 O/A $365,000 U11:30-12:00 Sat 44a Fords Rd Ray White 0433 175 681 $749,000 H12:00-1:00 Sat 25/40 McCauley St Ray White 4268 5577 $590,000-$640,000 U12:00-12:30 Sat 27/40 McCauley St Raine & Horne 4229 9600 O/A$699,000 U1:45-2:15 Sat 58 Redman Ave Ray White 4294 7000 Auction H9:00-9:30 Sat 106 Princes Hwy Bevans 0409 969 032 Auction H
Towradgi 2518 11:00-11:30 Sat 14 John St MMJ 0416283876 O/A $495,000 H11:30-12:00 Sat 102 Balmoral Towers Carters Lane MMJ 0418 423 782 O/A$449,000 U
Unanderra 2526 10:00-10:30 Sat 4/96 Central Rd Park Trent 4229 1655 O/A $280,000 TWN10:10-10:30 Sat 156 Princes Hwy MMJ 0408 411 723 O/A$290,000 H11:30-12:00 Sat 43 Jenkins St Ray White 0409669863 $325,000 H1:00-1:30 Sat 13 Thornbury Ave Domain First Na 0412 717 444 $295,000 H1:00-1:30 Sat 24A Maynes Pde Professionals 0411 315 450 $259,000 H1:00-1:30 Sat 24 Maynes Pde Professionals 0411 315 450 $279,000 H1:40-2:00 Sat 27 Thornbury Ave Harcourts 4261 3211 $360,000 H2:00-2:30 Sat 10 Beverley Ave Wiseberry 4267 3542 Auction H
Warilla 2528 11:00-11:30 Sat 24/1 Sparta Ave Peter Taranto 0417 124 313 O/A$290,000 V12:00-12:45 Sat 45 Oldfield St Right Choice 4297 6444 $335,000 H
Warrawong 2502 10:00-10:30 Sat 107 Flagstaff Rd L J Hooker 0411 713 523 $239,000 H11:00-11:30 Sat 35 Second Ave L J Hooker 0411 713 523 O/A$440,000 H11:30-12:00 Sat 3/314 Cowper St Domain First Na 0412 717 444 O/A$300,000 H1:00-1:30 Sat 15 First Avenue (north) Ray White 0419 211 331 $259,000 H
West Wollongong 2500 11:00-11:30 Sat 3/7 England St Ray White 0458 721 196 $249,000 U12:00-12:30 Sat 5/16 Dempster St Ray White 0419 211 331 $429,000 TWN12:30-1:30 Sat 13 Reserve St ARRE 0422 183 341 $445,000 H1:00-1:30 Sat 3/7 England St Ray White 0458 721 196 $249,000 U1:30-2:00 Sat 1/12 England St Laing + Simmons 0421 307 664 O/A$395,000 TWN2:30-3:00 Sat 9 Immarna Ave Laing + Simmons 0421 307 664 O/A$395,000 H
Windang 2528 11:30-12:00 Sat 2 Boundary Rd McPhail 0410 868 632 $485,000 H12:00-12:30 Sat 76 Ocean St L J Hooker 0411 713 523 Auction H
![Page 36: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/36.jpg)
Published by WEBSTAR PRINTING1/83 Derby Street, Silverwater NSW 2128
Advertising enquiries to 1300 137 161The Publisher does not accept any responsibilitiyfor the information provided in this magazine.2A/175 James Ruse Drive Rosehill NSW 2142
This well looked after recently renovated four bedroom, two level cement rendered family home is in a great location.Features include formal dining/lounge, meals room, large timber kitchen, second bathroom downstairs, rumpus/games room or huge family room with bar and ducted air-conditioning, large in-ground salt water pool, double garage and landscaped gardens.Only minutes to school and shops, this property represents a rare opportunity.
Rare Opportunity!!!
WHERE: INSPECT: 30 Stanbrook Avenue, Mount Ousley Saturday May 11, 1.00 – 1.30pm
AGENT: PRICE: CONTACT:Elders Wollongong - 4228 7878 Offers over $595,000 Danny Peterson - 0421 764 496
MOUNT OUSLEY
Perfectly located at the foot of the historic Balgownie Village you will enjoy living with shopping, restaurants, club all within walking distance, or jump on a bus at the front door and explore Wollongong CBD shopping or Wollongong Historic Blue Mile and Ocean Front.Belise is a collection of 10 architecturally designed Townhouses and one Villa.The development incorporates 7 x 3 Bedroom Townhouses, 2 x 2 bedroom Townhouses and 1 x 3 bedroom Villa.Townhouses: 1-5, 8 & 10 - 3 bed 2 bath 2 car garage from $475,000Townhouses: 6 -7 - 2 bed 2 bath 1 car garage and single open parking from $445,000Villa: 3 bed 2 bath 2 car garage $485,000Belise is adjoining Judy Masters Oval which is a large sporting park ideal for watching sport or exercising.It will set a new benchmark in quality, lifestyle and design.All include double lock up garage with the 2 bedroom townhouses having a single lock up garage and open parking space. First home buyers qualify for stamp duty exemption and $15,000 Government Grant .
Welcome to Belise - Due for completion August 2013
WHERE: PRICE: 1- 10/8 Sproule Crescent, Balgownie From $445,000 AGENT: CONTACT:Clayton Real Estate - 4226 1074 Rob Corneteg - 0414 271 444 - [email protected]
BALGOWNIE
FEATUREPROPERTIES
Thursday 2 to Wednesday 8 May
Thursday 9 to Wednesday 15 May
Purchasing or Refinancing?Not all lenders are the same and it can be very confusing.
Let my 25 years lending experience help you find the right home loan
4296 8888
Wollongong North 2500 10:00-10:30 Sat 11/11-15 Church St Peter Taranto 0411 754 884 $729,000 U
11:00-11:30 Sat Unit 5/35 Virginia St O’Connor 0416 266 055 $280,000 U
12:00-12:30 Sat 4/33-35 Church St Peter Taranto 0411 754 884 $689,000 U
1:00-1:30 Sat 7/3-5 Corrimal St Peter Taranto 0411 754 884 $1,590,000 U
2:00-2:30 Sat 18/16-20 Keira St Peter Taranto 0429 809 856 $475,000 U
Wollongong West 2500 11:00-11:45 Sat 1 Phillips Ave MMJ North 0412 425 801 O/A$590,000 H
11:00-11:30 Sat 18 Booyong St MMJ 0418 421 468 O/A $449,000 H
12:00-12:30 Sat 1/11 Reserve St O’Connor 0414 946 000 $279,000 U
Woonona 2517 10:00-10:30 Sat 1/50 Russell St Doug.Harcourts 0411 385 833 O/A $390,000 TWN
10:00-10:45 Sat 10/68-70 Russell St Ray White 0403 305 315 $269,000 U
10:00-10:30 Sat 167 Campbell St Bevans 0402 083 446 O/A$549,000 H
10:30-11:15 Sat 5/19 Nicholson Rd Huxley 0414 428 401 O/A $349,000TWN
10:45-11:15 Sat 23/133a Campbell St
Bevans 0402 083 446 O/A$227,000 U
11:00-11:30 Sat 2/98-100 Campbell St Doug.Harcourts 0411 385 833 O/A $360,000 V
11:00-11:45 Sat 7 Corrie Rd Ray White 0411 969 656 $535,000 H
11:00-12:00 Sat 87 Thompson St Ray White 0411 969 656 Auction H
11:30-12:00 Sat 15/133a Campbell St Ray White 0423 218 285 $255,000 U
11:30-12:15 Sat 31 Campbell St Doug.Harcourts 0423 008 248 $880,000 - $900,000H
12:00-12:30 Sat 8 Pat Geraghty Pl Professionals 0411 315 450 $749,000 H
12:15-1:00 Sat 1/105-107 Campbell St
MMJ North 0412 425 801 $395,000 - $535,000V
1:00-1:45 Sat 3 Carole Ave Ray White 0411 969 656 $645,000 H
1:00-1:45 Sat 37 Dorrigo Ave Ray White 0411 969 656 Auction DeferredH
1:30-2:00 Sat 24 Hopetoun St Doug.Harcourts 0411 385 833 O/A $475,000 H
Yallah 2530 10:45-11:30 Sat 1 Larkins Lane Peter Taranto 0414 977 711 $1,260,000 H
11:30-12:00 Sat 11 Larkins Lane LJ Hooker 0402 844 636 $1,195,000 H
![Page 37: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/37.jpg)
AUCTION ACTION AUCTION UPDATEA brief outline of upcoming auctions
RESIDENTIAL
Bevans Thirroul106 Princes Highway, Thirroul - 11/5/2013 - 10.30am (on site)271-273 Lawrence Hargrave Drive, Thirroul (Commercial & Residential land) 1/6/2013 - 10.30 am (in office)23 Hutton Avenue, Bulli - 25/5/2013 - 11am (on site)
Harcourts Dapto6 Colleen Grove, Mangerton - 11/5/2013 - 2.30pm (on site)
Harcourts Northern Beaches30 Aragan Circuit, Bulli - 11/5/2013 - 12.50pm (on site)
Harcourts Wollongong16 Colleen Grove, Mangerton - 11/5/2013 - 2.30pm (on site)
LJ Hooker Albion Park Rail4 Herne Street Figtree - 25/5/2013 - 3pm (on site)
LJ Hooker Warrawong48 Keira Street, Port Kembla - 18/5/2013 - 1.30pm (on site)76 Ocean Street, Windang - 1/6/2013 - 12.30pm (on site)
McGrath85a Stephen Drive, Woonona - 18/5/2013 - 1.30pm (on site)
One Agency Sally Absalom25 Hilltop Avenue, Wollongong - 25/5/2013 - 12noon (on site)
One Agency Denison-Pender & Moore60 Lawrence Hargrave Drive, Austinmer - 25/5/2013 - 11am (on site)
PRD Nationwide Dapto226 Princes Highway and 81 Marshall Street, Dapto - 3/5/2013 - 6pm (1/66 Princes Highway Dapto)96 Farrell Road, Bulli - 3/5/2013 - 6pm (1/66 Princes Highway Dapto)73 Byamee Street, Dapto - 3/5/2013 - 6pm (1/66 Princes Highway Dapto)
Raine & Horne Kiama1 Kinross Place, Jamberoo - 23/5/2013 - 7pm (Kiama Showground Pavilion)11 Brown Street, Kiama - 23/5/2013 - 7pm (Kiama Showground Pavilion)65b Tingira Crescent - 23/5/2013 - 7pm (Kiama Showground Pavilion)
Raine & Horne WollongongCroome Road, Albion Park Rail - 1/6/2013 - 12.30pm (on site)
Ray White Helensburgh237 Lawrence Hargrave Drive, Coalcliff - 18/5/2013 - 11.30am (on site)28 Chellowdene Avenue, Stanwell Park - 25/5/13 - 12.30 pm (on site)
Ray White North Beach Wollongong 14 Alroy Street, Bulli - 26/5/2013 - 11am (on site)
Ray White Unanderra88 Dumfries Avenue, Mount Ousley - 29/5/2013 - 6pm (Illawarra Leagues Club)
Ray White Wollongong42 Gibsons Road, Figtree - 25/5/2013 - 12pm (on site)
Ray White Woonona87 Thompson Road, Woonona - 11/5/2013 - 12pm (on site)
Southern Estates33 Uralba Street, Figtree - 11/5/2013 - 11.30am (on site)Lots 1-4 Kirkwood Place, Mount Kembla - 12/5/2013 (Sunday) 11am (on site)218 Mount Keira Road, Mount Keira - 25/5/2013 - 1.30pm (on site)
Wiseberry Seacliff22 Owen Street, Bulli - 18/5/2013 - 12.30pm (on site)10 Beverley Avenue, Unanderra - 11/5/2013 - 2.30pm (on site)
Gianni Moretti, Personal Mortgage AdviserPhone 0404 033 664 • www.smartline.com.au/gmoretti
Award winning mortgage advice from Australia’s top mortgage broking group. It makes sense to get your own personal mortgage adviser. Your home loan can make the difference between a good and a great property investment. Make sure it’s working for you. Talk to Gianni at Smartline today.
• Compare loans from over 25 top lenders.• Help to choose the right loan tailored to your needs.• We’ll come to you at a time that suits you.
Australian Credit Licence Number 385325
Award winning mortgage advice
NEWSAUCTIONS SLOW - MIXED RESULTS
Auctions held during the last week in the Illawarra indicated a possible slowing in the clearance rates.Only one sold under the hammer on the day, while several sold either pre or post auction.A property offered by Sally Absalom at One Agency, Fairy Meadow was the only one we were aware of at the time of going to press, to sell under the hammer.Sally said a good crowd of around 30 people attended the auction for 5 Hudson Avenue, Balgownie.She said it was an exciting auction with “very active” bidding, with the property selling for $955,000.This was a great result as the price guide was over $890,000.
A great deal of interest was created with 46 groups attending Open houses during the course of the campaign, said Sally.
Marnie Oppenauer from LJ Hooker Wollongong said genuine interest was generated in 100 Lakeview Parade, Primbee. This waterfront property, with an impressive marketing campaign, included quarter page ads in the Real Estate World Magazine. After receiving unprecedented telephone enquiries from both the local and the Sydney market, over 20 groups inspected the property. In the end two parties engaged in private negotiations prior to the auction. Contracts were exchanged prior to auction to a Wollongong couple for an undisclosed sum. “
MMJ North’s 3 Lassiter Avenue, Woonona sold two weeks prior to the scheduled auction date.
Ben Baaner from Ray White Wollongong said there was plenty of interest in his property, 19 Bassett Street, Fairy Meadow. While it didn’t sell on the day there were still 51 viewings at open for inspections, five registered bidders and a large crowd of around 60 people at the auction.It was passed in and is on the market for $449,00 and now under contract.
Bevans Wollongong had their two properties, 41 George Avenue, Bulli and 25 Branch Avenue, Figtree passed in and they have returned to the market. George Avenue is for sale for offers between $480,000 and $520,000, while Branch is Offers above $385,000
A relatively modern property at 145 Headland Parade, Gerroa (Harcourts Kiama) was passed in despite a good crowd and four registered bidders. Andy Wharton from that office said the property presented well and there were good numbers to the Open houses and while bidding didn’t reach great heights, the vendor is now in negotiation with the highest bidder.
15 MINUTE CLEANOUT!
Now that the kids are back at school, take fifteen minutes to make a dramatic change in one small area of your house by clearing some clutter.
First, pick one drawer or shelf in your house to clean out – don’t try to do more than this now.
Next, grab five boxes and label them as follows, so that you have somewhere to put each item you find.
1. Give Away. 2. Sell. 3. Store. 4. Throw away. 5. Keep
Make decisions quickly – remember you only have 15 minutes to do this. Once the drawer or shelf is empty, wipe it down and replace the ‘Keep’ items. Put the ‘Throw-aways’ in the bin and the ‘Store’ items away in their box. Have the ‘Give Away’ and ‘Sell’ items ready to take with you in the car next time you go out, so they don’t hang around the house.
5 Hudson Avenue, Balgownie - SOLD UNDER THE HAMMER FOR $955,000 by One Agency Sally Absalom.
![Page 38: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/38.jpg)
www.harcourts.com.au
Harcourts Dapto4261 3211
dapto.harcourts.com.au
OPEN HOME
For Sale $395,000View dapto.harcourts.com.au/NDP5543Open Saturday 11 May 10.00am - 10.20am
Mitchell James
E [email protected] Harcourts DaptoP 4261 3211
3 1 2
Impeccable Family Home• Beautiful family home is perfectly located in a very quiet cul-de-sac• 2 large living areas, 3 good size rooms and 2 separate dining areas• Perfect galley style kitchen in the central part of the home• Single drive through garage with massive carport set privately in your yard• Perfect yard with nothing to do with a private entertaining space• Seriously neat home perfect for a first home or a family home
Dapto 10 Crighton Place
OPEN HOME
For Sale Offers Above $379,000View dapto.harcourts.com.au/NDP5622Open Saturday 11 May 11.00am - 11.20am and 1.00pm - 1.20pm
Nathan Haynes
E [email protected] Harcourts DaptoP 02 4261 3211
3 1 2
Impeccable Presentation• 3 large bedrooms all with mirrored built in robes and new carpet• Open plan living room with floor to ceiling windows capturing distant water views• Near new kitchen proudly installed by Paiano Custom Kitchens Corrimal• Rumpus room at rear of home overlooking landscaped gardens & entertaining area• Renovated bathroom and Laundry, nothing to do in this home• Agent Interest Disclosed
Farmborough Hts 129 Iola Avenue
OPEN HOME
Auction Onsite Saturday 11 May at 2.30pm, Registration from 2.00pmView dapto.harcourts.com.au/NDP5559Open Wednesday 8 May 5.00pm - 5.30pm
Saturday 11 May 10.00am - 10.30am and 2.00pm - 2.30pmNathan Haynes
E [email protected] Harcourts DaptoP 4261 3211
4 2 2
Picture-Perfect Family Home• Open plan living area connecting to outdoor entertaining, Spotted Gum timber floors
throughout, contemporary gas kitchen with breakfast bar & stone bench tops• Master bedroom with ensuite & Walk in Robe, 4 additional queen-sized bedrooms with BIRs• Undercover entertaining area with external sink and bathroom facilities• 2 car remote garaging, large workshop-great for cellar, private gated access to rear yard
providing security & privacy plus security alarm, surround sound and speakers in all rooms
Wollongong/Mangerton 6 Colleen Gr
Ben James
P 02 4261 3211 E [email protected] Dapto
For Sale $360,000 View dapto.harcourts.com.au/NDP5626 Open Saturday 11 May 1.40pm - 2.00pm
OPEN HOME
3 1 1• 3 great sized bedrooms, with built in robes in all rooms, bathroom recently renovated within 12 months• Air conditioned lounge room sporting polished floors and northerly views, kitchen with electric appliances and
loads of bench space• Fenced front yard secure for the kids to play, and a tiered landscaped backyard with an expansive shade cloth
Unanderra 27 Thornbury Avenue
Mitchell James
P 02 4261 3211 E [email protected] Dapto
For Sale $379,000 View dapto.harcourts.com.au/NDP5592 Open Saturday 11 May 10.40am - 11.00am
OPEN HOME
3 1 2• Great 3 bedroom house, all on one level, with a choice of 2 separate living areas plus dining with reverse cycle a/c• Each bedroom has built in wardrobes and the master has access to the stunning 3 y/o modern 2 way bathroom • Perfect pergola with built in BBQ, plenty of space and drive through garage access plus pet and child friendly yard• Gas cooktop and electric oven plus dishwasher, solar panels, rainwater tank and alarm system
Dapto 10 Cormack Avenue
![Page 39: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/39.jpg)
www.harcourts.com.au
Harcourts Dapto4261 3211
dapto.harcourts.com.au
Ben James
P 02 4261 3211 E [email protected] Dapto
For Sale $309,000 View dapto.harcourts.com.au/NDP5583 Open Saturday 11 May 1.00pm - 1.20pm
OPEN HOME
3 1 3• 3 freshly painted bedrooms with 9ft ceilings & security shutter on the main• Tandem Carport PLUS a Double Garage for all the toys• Lovely original kitchen with loads of cupboard space & electric appliances• Spacious living area with Reverse Cycle Air-Con, 9ft ceiling, motorised security shutter & southern aspect
Dapto 11 Kundle Street
Mitchell James
P 02 4261 3211 E [email protected] Dapto
For Sale $479,000 View dapto.harcourts.com.au/NDP5596 Open Saturday 11 May 12.40pm - 1.00pm
OPEN HOME
5 2 2• Brand new carpet through all bedrooms, Master with walk in robe and ensuite, bedrooms 2,3 and 4 have BIWs• 2 large living areas , 1 air conditioned, plus meals area, gas cooking in the kitchen plus dishwasher• Fully fenced yard with solar salt water in ground swimming pool• Over size double garage, 8.4m long with remote access and one side drive through to the back yard
Horsley 10 Highland Park Drive
Nathan Haynes
P 02 4261 3211 E [email protected] Dapto
For Sale Offers Above $490,000 View dapto.harcourts.com.au/NDP5579 Open By Appointment
4 2 2• Clever open plan sitting and familyroom with Formal Living, casual meals connecting to kitchen and garden• King size master bedroom with ensuite and built in robe, 3 additional bedrooms, all with BIWs• Manicured lawn, undercover entertaining BBQ recreation area, fully fenced yard and vehicle access • Idyllic cul-de-sac location, walk to schools, parks and shops
Farmborough Heights • 3 bedrooms, double sized shower in the bathroom• Good sized kitchen with electric appliances, carpeted living
area combined with dining• External laundry with a bonus toilet plus high ceiling garage
with DRIVE-THRU ACCESS• Huge backyard, fully fenced and ideal for any family
For Sale $279,000View dapto.harcourts.com.au/NDP5565Open Saturday 11 May 12.20pm - 12.40pm Ben James P 02 4261 3211 E [email protected]
Dapto 19 Kundle Street
OPEN HOME
• Main bedroom with ensuite with corner spa, dual vanity, a BIW and a WIR, 2 other large bedrooms with BIWs
• Front living area with front balcony access • Open plan living, dining and kitchen area with a/c, spotted
gum timber floors, modern kitchen with s/s appliancesplus large 5.5m x 4m workshop, more room than you need
For Sale $619,000View dapto.harcourts.com.au/NDP5577Open Saturday 11 May 11.20am - 11.40am Mitchell James P 02 4261 3211 E [email protected]
Dapto 22 Rosemount Street
OPEN HOME
Proposed Plan
• Private paradise block of land in culdesac & on private driveway, One of last remaining blocks in River Oak Estate
• Approx. 3600 sqm of tranquillity, approx. 550sqm building envelope
• DA approved 4 bedroom Hotondo, home plans and reports available
• Walking distance to Cedars Christian College & Parks
For Sale $249,000View dapto.harcourts.com.au/NDP5586Nathan Haynes P 02 4261 3211 E [email protected]
Farmborough Heights 36 Sandalwood Road
LAND SALE
• 3 great sized bedrooms, all with high ceilings• Renovated bathroom, fully tiled with shower over bath and
toilet• Front living area with northern aspect opening onto the tiled
dining area and modern kitchen with electric stove • At the back, there is a fully fenced, yard plus single garage
For Sale $285,000 - $305,000View dapto.harcourts.com.au/NDP5443Open Saturday 11 May 12.00pm - 12.20pm Mitchell James P 02 4261 3211 E [email protected]
Dapto 81 Byamee Street
OPEN HOME
• Huge main bedroom with WIR and fully tiled ensuite • 3 other great bedrooms, all with BIWs and plush carpet• Modern and oversized kitchen with gas cooktop,
dishwasher, fridge space and large breakfast bar• Formal lounge & dining upstairs with mountain views plus
an extra 3 tiled rumpus rooms or storage areas downstairs
For Sale $529,000View dapto.harcourts.com.au/NDP5475Open Saturday 11 May 1.20pm - 1.40pm Mitchell James P 02 4261 3211 E [email protected]
Kanahooka 208 Kanahooka Road
OPEN HOME
• 3 bedrooms, all carpeted, shower and bath combined• Great quality kitchen with loads of bench space & electric
appliances• Sizable ´Open Plan´ living area combined with dining• Common yard at the rear, private parking spot
For Sale $259,000View dapto.harcourts.com.au/NDP5563Open Saturday 11 May 10.00am - 10.20am Ben James P 02 4261 3211 E [email protected]
Albion Park Rail 5/12 Wooroo Street
OPEN HOME
• Three bedrooms, master and second with built in robes and all carpeted
• Front living area with fireplace and original carpet, plus a nice sunny outlook
• Dining and kitchen area combined with lino flooring, above bench oven and cooktop, plus access to the back deck
For Sale $305,000View dapto.harcourts.com.au/NDP5494Open Saturday 11 May 11.00am - 11.20am Ben James P 02 4261 3211 E [email protected]
Dapto 109 Lakelands Drive
OPEN HOME
• Bedrooms with timber floors, main and 2nd with BIWs• Renovated kitchen with stainless steel gas stove and loads
of benchspace• Large carpeted living area with reverse cycle air
conditioning plus spacious dining area with timber floors• Ideal entertaining deck in the rear yard with garage access
For Sale $349,000View dapto.harcourts.com.au/NDP5387Open Saturday 11 May 11.40am - 12.00pm Ben James P 02 4261 3211 E [email protected]
Dapto 5 Kapooka Avenue
OPEN HOME
• Clarendon built home with 4 bedrooms and study, ensuite and retreat to main bedroom, BIW’s to all others
• Sun drenched kitchen wrapped around large bay window• Formal living area, rumpus room and upstairs TV area• Double remote garage, manicured gardens, 3 sheds and
sheer quietness
For Sale $540,000 - $560,000View dapto.harcourts.com.au/NDP5557Open By Appointment Nathan Haynes P 02 4261 3211 E [email protected]
Horsley • 3 large bedrooms all with BIWs and master with ensuite• Great modern kitchen featuring granite bench tops and
quality appliances• Great open plan living flowing from front to back• Fully air conditioned and brand new carpet to the lounge
area
For Sale $399,000View dapto.harcourts.com.au/NDP5448Open By Appointment Mitchell James P 02 4261 3211 E [email protected]
Kanahooka
![Page 40: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/40.jpg)
www.harcourts.com.au
Harcourts Wollongong4229 8255
wollongong.harcourts.com.au
For Sale Offers Above $449,000
View wollongong.harcourts.com.au/NWG4872
Open Saturday 11th May, 12-12.30pm
Adrian D’Amico
M 0402 224 559
Harcourts Wollongong
P 4229 8255
2 1 1
Sun Filled Furnished Apartment In Ultra-Convenient LocationThis 7th floor apartment offers ocean views & is conveniently placed moments to shops, cafes, restaurants, bus/train transport & beaches. Features open plan design with combined living/dining area, two bedrooms & lounge room opening onto private alfresco setting with ocean views, & modern granite & stainless steel kitchen. Good sized bedrooms with built-ins, bathroom finished with quality fittings, internal laundry & security under building parking. Could be leased @ $500 to $550 per week. Access to Austar, pool, sauna, spa & gymnasium.
Wollongong 14/19 Market Street
For Sale Starting at $245,000
Open By appointment
View wollongong.harcourts.com.au/
NWG4622
Adrian D´Amico
P 02 4229 8255 M 0402 224 559
4229 8255
Cosgrove GardensA not to be missed opportunity,
arguably the most inexspecnsive
blocks on the market in this area.
Someone once told me, real estate is
exspensive today & cheap tomorrow
and this is no acception! Take
advantage of the New Home Owners
Grant offers $15,000 to eligible buyers
building their own home.
Keiraville Lot 1 & 2 Cosgrove Avenue
For Sale $347,000
Open Saturday 11th May,
11-11.30am
View wollongong.harcourts.com.au/
NWG4697
Greg Chadwick
P 02 4229 8255 M 0408 422 644
4229 8255
Pure Coniston, Sought After LocationOlder style 2 bedroom home on near
level block. Corner location with 2
street access. Total area 467 square
metres. Ideal redevelopment site for
new villa style retirement home on one
level. LOCATION ark close by, bus at
door, easy walk to rail and shops.
Wollongong 10 South Street
www.harcourts.com.au
Harcourts Northern Beaches4284 8833
northernbeaches.harcourts.com.au
For Sale $285,000
View northernbeaches.harcourts.com.au /NWN5273
Open By Appointment
Rod Finlay
M 0411 385 833
Harcourts Northern Beaches
P 4284 8833
When Location Really MattersLocated within 100m of the beach what better location could you pick to own and operate the only beach side restaurant in Woonona . One on Park has earn´t the reputation of being the place to be when catching up with friends for a coffee or lingering over lunch. This business is an outstanding opportunity just waiting to satisfy the wants of our many tourists that find their way to the Illawarra in search of leisure and lifestyle.
Woonona 1 Park Road
JUST LISTED
For Sale $369,000
View northernbeaches.harcourts.com.au /NWN5522
Open Saturday 11/05/2013
10:30am - 11:15am
Alysha Roberts
M 0423 043 302
Harcourts Northern Beaches
P 4284 8833
3 1 1
Renovate Family HomeSet in a sought after quiet cul se sac, this home will suit the young growing family, backing on to reserve/park.The home has been tastefully renovated new kitchen and bathroom, offering 3 bedrooms, two with BIW´s. Generous living and dining areas, floating floors throughout. Lots of natural light. Reverse cycle air con as well as gas heating. Modern kitchen with electric cooking and dishwasher, bathroom with separate shower, bath and separate toilet. Undercover outdoor entertainment area, great level back yard all on a block size over 650sqm.
Penrose 4 Long Place
40 9 May 2013
![Page 41: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/41.jpg)
www.harcourts.com.au
Harcourts Northern Beaches4284 8833
northernbeaches.harcourts.com.au
Auction Saturday 11th May 2013Onsite 12:50pm
View northernbeaches.harcourts.com.au/NWN5458Open Saturday 11/05/2013
12:00pm - 12:45pm
5 3 1 2 1
With sweeping coastline views from the formal lounge and outdoor patio this property will certainly impress your guests. On this level is a large well equipped kitchen with Caesar stone bench tops and easy care polyurethane cupboards. There are four bedrooms, master bedroom has both ensuite and walk in robe and there are built ins in the other rooms plus two more bathrooms. There is a second living area on the ground floor that opens onto both a covered dining area and in ground pool. There is also a study, theatre room and double garage.
The Complete Package
Bulli 30 Aragan Circuit - Auction This Saturday
Rod Finlay
P 02 4284 8833 M 0411 385 833E [email protected] Northern Beaches
AUCTION
JUST LISTED
For Sale Price By Negotiation $475,000View northernbeaches.harcourts.com.au /NWN5494Open Saturday 11/05/2013
1:30pm - 2:00pmRod Finlay
M 0411 385 833 E [email protected] Harcourts Northern BeachesP 4284 8833
2 2 1
Opportunity KnocksLocated on over 600 sq meter block, brick and tile home featuring formal lounge and separate dining, spacious eat in kitchen , 2 good sized bedrooms with robes, a bathroom with shower over the bath and toilet, 2nd shower and toilet at rear of home off the laundry,sun drenched north facing rear yard and a level walk to shops and transport.
Woonona 24 Hopetoun Street
Rod Finlay
P 02 4284 8833 M 0411 385 833 E [email protected] Northern Beaches
For Sale $460,000 View northernbeaches.harcourts.com.au /NWN5484 Open Saturday 11/05/2013 11:00am - 11:30am
OPEN HOME
3 1 1Located on a level 590 sq mtr block, this 3 bedroom clad home with tile roof is a great starting off point for anyone looking to get out of their unit into the housing market, with it’s formal lounge, open plan kitchen dining area, renovated bathroom, a large enclosed entertaining area, that looks out onto the north facing sundrenched yard and in ground pool. It also has a carport at the front of the property and is close to schools and transport.
Woonona 68 Collaery Road
Rod Finlay
P 02 4284 8833 M 0411 385 833 E [email protected] Northern Beaches
For Sale Offers Over $390,000 View northernbeaches.harcourts.com.au /NWN5476 Open Saturday 11/05/2013 10:00am - 10:30am
OPEN HOME
3 2 2Located only two blocks level walk from the Woonona shopping centre, this 3 bedroom two storey townhouse features an open plan formal lounge/dining area, a modern timber kitchen with natural gas cooking. Master bedroom has both built ins and ensuite,other two rooms also have built ins and there is a bathroom with both shower and bath. The property has a double garage plus a north east facing courtyard.
Woonona 1/50 Russell Street
![Page 42: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/42.jpg)
www.harcourts.com.au
Harcourts Kiama4232 1322
kiama.harcourts.com.au
OPEN HOME
For Sale
View kiama.harcourts.com.au/NKM4566Open Saturday 11 May 2013 at 12.00-12.30pm
Andy Wharton
M 0412 638 708 E [email protected] Harcourts Kiama
4 2 2
An Epicentre Of Lifestyle And Water Pursuits Situated between the mountains and the sea, the north facing position on Headland Drive, Gerroa allows you to watch whales, dolphins, sea eagles, surfers and fishermen from your own living room.The house is eight years old, has an abundance of open plan living, four bedrooms, main with ensuite and walk in robe and family rumpus room. Ideal as a permanent home or join many other Gerroa ´weekenders´ and spend your holidays in paradise.
Gerroa 145 Headland Drive
OPEN HOME
Auction Saturday 1 June 2013 at 11.00amOnsite (if not sold prior)
View kiama.harcourts.com.au/NKM4586Open Saturday 11 May at 11.00-11.30am
Andy Wharton & Susan Spence
M 0412 638 708 M 0412 271 091E [email protected] E [email protected] Kiama
4 2 3
Live BeautifullyDestined to impress, this high quality home makes an undeniable statement of luxury and style in a highly desirable location.Enjoyed by the one owner since completion, this bespoke renovation is beautifully customised for low maintenance family life and entertaining.
Kiama 11 Hartwell Crescent
Andy Wharton
M 0412 638 708 E [email protected]
For Sale $365,000 View kiama.harcourts.com.au/NKM4533 Open Saturday 11 May 2013 1.00-1.30pm
OPEN HOME
2 1 11Just minutes walking distance to Surf beach and Kiama’s cafe society, this contemporary single level villa is in an established complex.• Spacious living area
Kiama 14/130 Shoalhaven Street
Andy Wharton
M 0412 638 708 E [email protected]
For Sale $650,000 View kiama.harcourts.com.au/NKM4535 Open By Appointment
3 2 1This north facing torrens title duplex, within walking distance to East´s beach is spacious and private. Well appointed from the courtyard at the entry through to an open plan living, kitchen, balcony to the ocean & hill views.• Spacious open plan living and dining area• Balcony for alfresco dining and entertaining
Kiama Heights 73 Attunga Avenue
Andy Wharton
M 0412 638 708 E [email protected]
For Sale $935,000 View kiama.harcourts.com.au/NKM4562 Open By Appointment
5 2 2A brick and tile home backing onto reserve just a few steps away from fishing, coastal walking trails and beautiful Jones beach. Finished to a very high standard, there is nothing to do but sit back and enjoy living in one of Kiama’s most prestigious water reserve locations.• Open plan kitchen with formal dining
Kiama Downs 82 Johnson Street
Andy Wharton
M 0412 638 708 E [email protected]
For Sale $320,000 View kiama.harcourts.com.au/NKM4583 Open Saturday 11 May 2013 at 10.00-10.30am
OPEN HOME
2 1 1With a north facing frontage, entry close to Minnamurra Street with a garden in front, and offering privacy in a well maintained small complex, this well positioned unit is a superb entry level property in central Kiama ideal for market newcomers or investors.
Kiama 2/70 Minnamurra Street
![Page 43: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/43.jpg)
www.harcourts.com.au
Harcourts Shellharbour City / Albion Park 4256 3122
shellharbourcity.harcourts.com.au
OPEN HOME
For Sale $479,900View www.shellharbourcity.harcourts.com.au/Open Saturday 11th May 11.00 - 11.30 am
Daniel McConnell
M 0405 454 624 E [email protected] Harcourts Shellharbour City / Albion Park P 4256 3122
3 2 2
Chic Living... Boutique Lifestyle!!Set in the prestigious Tullimbar estate, this spectacular property is simply not to be missed offering a rare lifestyle of boutique living. Impressive with 3 "double sized" B/R’s + open study, ensuite & WIR. Large sunken family & dining room with lovely high ceilings + sep formal lounge flowing onto sundrenched front veranda, pristine kitchen with walk-in pantry, 2 ultra modern bathrooms + powder room, ducted air & double garage. Outdoors picture perfect with covered pergola overlooking sparkling in-ground plunge pool, small tidy grassed yard + reserve at rear.
Albion Park 34 Broughton Avenue
Absolutely spectacular 5 yr young tri-level family home, 5 big B/R’s + study, WIR & ensuite. Multiple living quarters with full ducted air. Ground level ideally set for in-law accommodation, light filled kitchen, 3 bathrooms & double garage. Must see outdoors with stunning high pitched pergola, sparkling I/G pool & tidy grassed yard all capturing a surreal backdrop.
For Sale $629,000View www.shellharbourcity.harcourts.com.auOpen Saturday 11th May 11.00 - 11.30 am Daniel McConnell P 02 4256 3122 M 0405 454 624 Harcourts Shellharbour City / Albion Park
Albion Park 7 Ashton Close
JUST LISTED
Don´t be deceived... Big 3 B/R family home feat A/C formal lounge + sep meals & family room, lovely Tassie Oak kitchen & well appointed bathroom. Offering loads of O/S parking with big detached lock-up garage + carport, pergola area, level grassed yard, above ground pool & fully fenced front & rear yard. Quality tenants currently paying $370 p/w.
For Sale $355,000View www.shellharbourcity.harcourts.com.auDaniel McConnell P 02 4256 3122 M 0405 454 624 E [email protected] Shellharbour City/ Albion Park
Mt Warrigal
Great investment opportunity.. renovated cottage offering low maintenance lifestyle with direct access to shops, schools, buses, trains & airport. Fresh with modern decor feat 3 B/R’s, formal lounge + open family room, renovated kitchen & tidy bathroom, garage, courtyard. Huge rental potential $350 p/w.
For Sale $289,900View www.shellharbourcity.harcourts.com.auOpen Saturday 11th May 12.00 - 12.30 pm Daniel McConnell P 02 4256 3122 M 0405 454 624 E [email protected] Shellharbour City / Albion Park
Albion Park Rail 1/212 Princes Highway
OPEN HOME
Hope you like surprises as you’ll be amazed inside & out with features galore incl 4 oversized B/R’s all with BIW’s + the ideal teenage retreat or detached 5th bedroom. Endless living quarters, quality kitchen, 3 bathrooms & oversized tandem garage with workshop. The ultimate entertainer with spectacular I/G salt water pool + huge covered pergola area.
For Sale $479,900View www.shellharbourcity.harcourts.com.auDaniel McConnell P 02 4256 3122 M 0405 454 624 E [email protected] Shellharbour City / Albion Park
Albion Park Rail
![Page 44: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/44.jpg)
Enjoying fabulous escarpment views and drenched in natural light, you couldn´t ask for more in terms of living space, convenient location and abundance of storage space.With a great layout and single level living, this solid double brick home has polished timber flooring throughout. Step down from your sun drenched balcony and you enter into a man´s world, with useable level yard and separate ground floor accommodation.This home would suit a tradesman, with numerous storage rooms, workshops and another bathroom on the ground level. There is plenty of space to store your tools and machinery, or have a home office to run your business from.
Auction 11 May 2:30
AGENT:
• Sand, surf and rock pool of popular Austinmer beach is literally footsteps away from your front door• Large family home with great entertaining areas and scenic views• Suitable for two families, or live on one level and rent the other as holiday letting accommodation • Close to school, transport, cafes, restaurants and Thirroul shopping centre
Come and view this large family home in the popular Sandon Point estate. A unique design allows for single level living, if desired, with additional levels for guests or extended family.• 4 bedrooms, huge rumpus room on separate level• Upstairs 2nd living room or supersized mezzanine style 4th bedroom with balcony overlooking the
ocean• Swimming pool in the rear private garden and outdoor entertaining/BBQ area
Opportunities like this don´t come along often. Ideally located approximately 100 metres to the beach and the surf, this single level living townhouse is a rare find.• Single level living townhouse at the back of the complex, very spacious and sunny• Very private with only one neighbour and no common walls, 3 separate decks• Ideal holiday home, an investment (will rent for $600pw) or a home to retire to
First time offered for sale, this comfortable yet quirky family home has been lovingly maintained and enjoyed by its´ proud owners for decades. High set to take advantage of some glorious ocean and escarpment views, you can relax on a sun drenched verandah to take them in and enjoy the lifestyle. Easy stroll to the beach and level walk to the train station make this home one of the best offerings currently on the market at an affordable price.
AGENT:
• Two beautiful blocks of land side by side, approx 500sqm each
• Beautiful sandstone features and many established botanical specimens to be retained
• Concept plans and models of homes to complement the sites available, all services connected
AGENT:
Perched high and spanning two spacious levels, this solid double brick home has potential to accommodate two families comfortably. Easily split into 2 separate houses with great rental income potential. Awesome views!
Ideally located minutes walk from Thirroul shops, restaurants and train station with express train to Sydney CBD, this home is a timeless classic with a modern feel. 4 car garaging will appeal to tradesmen looking for storage space, or to car enthusiasts and collectors.The 823sqm completely level and sunny block offers potential for dual occupancy (STCA), or further options of adding an in-ground pool, a garden/orchard or a granny flat.
![Page 45: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/45.jpg)
Located in one of the Illawarra’s best beachside suburbs. This magnificent 4 bedroom family home is simply stunning! Enjoy the breathtaking ocean views all year round from this absolute ocean front oasis. Featuring large open plan living areas, huge family room, lovely kitchen, ensuite, ducted air conditioning, private courtyard, 965m2 block and double car garage. Only a short walk to beach, shops, cafes and restaurants.
Inspect: By AppointmentAdele Harb M: 0415 429 664Sales ManagerEmail: [email protected]
Shellharbour 16b Wollongong Street $1.75 Million - $1.95 Million BEACHSIDE BEAUTY!
NEW
LIST
ING
Fully renovated 3 bedroom villas featuring large open plan living areas, modern kitchens with stainless steel appliances, timber floors, air conditioning, private courtyards and single car garages with internal access.Located in a quiet street only minutes to schools, shops and transport.Unit 1 is Tenanted at $380 p/w. Unit 2 is Tenanted at $410 p/w. Single level living at its best.Perfect for 1st home buyers, investors or retirees.
Inspect: Call Adam or Hamish on 0409 810 800Adele Harb M: 0415 429 664Sales ManagerEmail: [email protected]
Dapto 78 & 78A Yalunga Street $369,000 Per UnitDAPTO DUPLEX!
NEW
LIST
ING
• Totally renovated 3b/r home• Ultra modern kitchen & appliances• Two spacious living areas• Modern bathroom plus 2nd w/c• Downstairs features rumpus room• Undercover outdoor entertaining areaInspect: Saturday 11th May 2013 11:00am - 11:30amRob Franceschini 0434 970 439
Farmborough Heights 77 Panorama Drive $409,000The Entertainer
NEW P
RICE
OPEN H
OUSE
• Enjoy the best lifestyle all year round.• 3 bedrooms- 2 with B.I.W, plus a study.• Sun drenched kitchen, with adjacent laundry and cosy lounge.• Huge rear yard with side entry plus easy parking via a carport.• Idea first home, holiday home or even an investment.
Inspect: Saturday 11th May 2013 10:00am - 10:30am William Milenkovski 0410 418 680
Barrack Heights 3/ 275 Shellharbour Road $279,000The Lifestyle You Deserve
NEW LIS
TING
OPEN H
OUSE
• Fully renovated 3 bedroom home• Featuring large living areas, new kitchen, high ceilings, study and
beautiful timber floors• Huge yard ideal for the kids, plus a separate garage• Located mins to schools & shops• Currently leased at 370p/w.Inspect: Saturday 11th May 2013 10:45am - 11:15amBill Milenkovski 0410 418 680
Barrack Heights 2 Bligh Place $365,000Ideal Family Home
INSP
ECT
TODAY
• Near new 3 bedroom family home• Featuring large living areas, gourmet kitchen with breakfast bar, ensuite
& 1.5 car garage• Beautiful timber decking providing a great place to relax • Located in a quiet cul-de-sac mins to schools, shops & medical centre• Currently leased at $400p/w Inspect: Saturday 11th May 2013 11:30am - 12:00pmBill Milenkovski 0410 418 680
Barrack Heights 2a Bligh Place $379,000Relax Living
OPEN
HOUSE
This home features large living, 2 large bedrooms plus study, great size eat in kitchen plus separate dining, high ceilings, tiles and timber flooring throughout and single lock up garage.This home is located in prime position being only 10 minutes drive to Wollongong CBD, close to Warrawong shopping, beaches and freeways.
Inspect: Saturday 11th May 2013 12:30pm - 1:00pmWilliam Milenkovski 0410 418 680
Cringila 174 Lake Avenue $275,000Potential Potential Potential
OPEN
HOUSE
• Relax and unwind with only moments to the beach.• 4 bedrooms, all with BIW and main bedroom has a walk- through robe
plus an ensuite• Two separate living areas, a modern eat-in kitchen, plus formal dining,
large double garage.• Impressive outdoor entertaining area with low maintenance gardens. Inspect: By AppointmentRob Franceschini 0434 970 439
Woonona 28 Charlotte Harrison Drive $769,000Just Add Your Family
NEW
LIST
ING
• Ultra modern 3BR unit in the heart of Windang• Features large living and dining areas• Modern kitchen with quality appliances• Beautiful bathroom and ensuite• Two large bedrooms both with BIW• Two balconiesInspect: By AppointmentRob Franceschini 0434 970 439
Windang 7/235 Windang Road $279,000A 5 minute walk to the Beach
LAKE
VIEW
S
• 801m2 Block of land sloping to the street• Highly sought after area, surrounded by quality homes• 20m Frontage• Proposed duplex site STCA• Glorious lake & escarpment views• Well below cost, owner says sellInspect: By AppointmentRob Franceschini 0434 970 439
Berkeley 3 Osprey Drive $220,000Potential Plus
NEW
LIST
ING
![Page 46: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/46.jpg)
wollongong
3500 007yourrealestatename.com.au64 Flinders Street, Wollongong 4226 6772www.teamsold.com.au
Address: View Online: Contact:
Open: Address: View Online: Contact:
OPEN HOUSE
Open: Address: View Online: Contact:
OPEN HOUSE
Open: Address: View Online: Contact:
OPEN HOUSE
Address: View Online: Contact:
Address: View Online: Contact:
Address: View Online: Contact:
Open: Address: View Online: Contact:
OPEN HOUSE
Robb Grubbm:e:
Open: Address: View Online: Wollongong Office:
1
2
2
OPEN HOUSERobb Grubbm:e:
Address: View Online: Wollongong Office:
1
4
1
Robb Grubbm:e:
Open: Address: View Online: Wollongong Office:
25 2
OPEN HOUSE
![Page 47: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/47.jpg)
353 Crown Street Wollongong 4228 7878 Lou Niceski 0414 287 093, Danny Peterson 0421 764 496
elderswollongong.com
••••••
•••
•••
•••
••
••
••
••••••
••••
••••••
••••••
••••
•••••
•••
••
•••
•
•••••
•••••
••••
![Page 48: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/48.jpg)
Woonona 10/68 Russell Street centrally located, ground floor 2 A 1 B 1 C
Ray White Woonona
A level stroll to shops & transport, well presented 2 bedroom unit currently tenanted @ $280pw. Security intercom, 2 large bedrooms + BIW’s, sep. toilet, balcony, large laundry + extra storage + large single lock-up garage. Ideal investment, first home or retirement.
Sale $269,000
View @ 10.00-10.45amSaturday 11 May
Rick Taylor 0403 305 315
Bulli 76 Park Road Come & be surprised! 4 A 2 B 1 D
Ray White Woonona
Surprisingly large tri-level home, located in the heart of Bulli. Beautifully integrating old world with new; this light filled family home is a real find. Offering spacious bedrooms, stylish kitchen, fireplaces, open-plan living and sep rear studio. Be quick to inspect!
Sale $569,000
View @ 10.00-10.45amSaturday 11 May
Troy Johnson 0411 969 656
[email protected] | 4284 8888
Woonona 7 Corrie Road Ideal Sought After Location! 3 A 1 B 2 C
Ray White Woonona
This lovely family home has 3 bedrooms, large modern bathroom, polished timber flooring, split-cycle air con, gourmet kitchen, dining room, rear decking with bistro blinds for all year round use, 2nd WC in laundry. Dble LUG, fenced yard perfect for children & pets. Priced ideally to sell - ready to move in!
Sale $535,000
View @ 11.00-11.45pmSaturday 11 May
Troy Johnson 0411 969 656
Woonona 87 Thompson Street East Woonona - rare offering! 4 A 2 B 1 C
Ray White Woonona
Superb large land parcel in East Woonona totalling approx 1,100m2! Further development of the land including subdivision is certainly a possibility, subject to WCC approval. Stroll to Woonona beach, local shops, schools, transport, parkland and located in a cul-de-sac street. A rare offering with many possible options!
Auction 11 May 2013On site @ 12 noon
View @ 11.00-12.00 noonSaturday 11 May
Troy Johnson 0411 969 656
Bulli 1E Willcath Street Dream home in dream location! 5 A 3 B 2 C 1 D
Ray White Woonona
In a quiet cul-de-sac. Stroll to beach, cycleway, parks & schools. This magnificent home features expansive living areas, 5 huge b/rms, parents retreat, study (5th b/rm), gourmet kitchen with stone benchtops & quality applicances, internal access to dble garage, ducted air-con, outdoor entertaining area + spa!
Sale $990,000
View @ 12.00-12.45pmSaturday 11 May
Rick Taylor 0403 305 315
[email protected] | 4284 8888
Woonona 3 Carole Avenue Opportunities! 4 A 1 B 2 C
Ray White Woonona
Who would have thought you could have a great home in a whisper quiet cul-de-sac on a 5,357M2 land parcel with ocean views. Beautiful family home with open-plan living, modern kitchen, sep dining, stylish bathroom, Air-con, utility room or 4th bed, plus DBL garage & parking for your van or boat.
Sale $645,000
View @ 1.00-1.45pmSaturday 11 May
Troy Johnson 0411 969 656
[email protected] | 4284 8888
Woonona 37 Dorrigo Avenue Metres to sand & surf! 4 A 2 B 2 C 1 E
Ray White Woonona
Surprisingly large & a mere stroll to Beach, cycleway, pools, schools, transport, shops & cafe’s. Offering 4 dbl b/rm’s + BIW’s, raked ceilings, sep. dining or 5th b/r, stylish gourmet kitchen, master bathroom with spa, A/C, Int. laundry with 2nd shower & sep. WC, large rumpus room I/G pool & extra large L/U garage.
Auction Forthcoming
View @ 1.00-1.45pmSaturday 4 May
Troy Johnson 0411 969 656
Bulli 87-89 Farrell Road "Corro-Lynne" 6 A 3 B
Ray White Woonona
Under Instructions from the Roads Maritime Services. 1739m2 block, 3.6m pressed metal & timber ceilings, open fireplaces, stained glass windows, french doors, slate tile roof, alfresco courtyard, trapdoor access to wine cellar, large timber kitchen with walk-in pantry, huge yard.
Sale $799,000
View by appointment
Rick Taylor 0403 305 315
![Page 49: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/49.jpg)
Ray White Helensburgh
Stanwell Park 28 Chellowdene Avenue
Park like Private Paradise
This home boasts enough space for the entire
family with 3 separate living areas, 5 bedrooms,
ensuite, 3 modern bathrooms plus study. The
expansive and versatile property is spread
across 3 levels and allows the opportunity for an
additional rental income from a highly attractive
self-contained one b/r flat.
5 A 4 B 2 C
Auction
Saturday 25/5/13 at 12.30pm
View Saturday 12.00-12.30pm
Simon Beaufils 0417 001 [email protected]
Dirk ten Cate 0413 785 073raywhitehelensburgh.com.au
4294 7000
Bulli 29 Beacon Street This funky A frame chalet style home is full of character and ambience. Consisting of 4 spacious bedrooms, two separate living areas, 2nd toilet and shower. A level garden allotment with pergola and sparkling in ground pool.
Sale $590,000View Saturday 11th May 12.30pm - 1.15pmTony Dribbus 0433 175 681
Ray White Thirroul
Gwynneville 4/3 Catherine Street Tucked away at the rear of a boutique block of 5 this sun-filled town house features high ceilings, bamboo flooring, light & airy modern kitchen, two massive bedrooms with BIW and WIR, all combined to make this elegant apartment ready for you to move into.
Sale Offers above $399,000View Saturday 11th May 10.30am - 11.00amKaren Egan 0447 271 118
Ray White Thirroul
West Wollongong 3/24 Fisher Street An exceptional modern and sleek terraced styled townhouse in a boutique complex convenient to all the city’s amenities.Flawless presentation throughout, accommodation includes 3 bedrooms, 2 bathrooms, granite kitchen, and loft/storage area.
Sale $525,000View Saturday 11th May 11.15am - 11.45am & 2.00pm - 2.30pmTony Dribbus 0433 175 681
Ray White Thirroul
Thirroul 44 Fords Road Set in a peaceful location with leafy surrounds, this modern 5 year old contemporary family residence is tastefully appointed with quality finishes. Large outdoor entertaining balcony, versatile roof loft, timber decking, natural bush rock and low maintenance gardens.
Sale $749,000View Saturday 11th May 11.30am - 12.00pmTony Dribbus 0433 175 681
Ray White Thirroul
Austinmer 4/43 Mountain Road Centrally located, spacious 2 bedroom villa (one level) home well cared for in a small complex of 6. Rear courtyard, single lock up garage and within walking distance to beach and train station. Villa’s are highly sought after and hard to find.
Sale $485,000View By AppointmentTony Dribbus 0433 175 681
Ray White Thirroul
Thirroul 26 Pass Avenue Tucked away from the hustle and bustle on a private 631 m2 near level allotment. This good feel clad cottage with 3 bedroom plus study, northerly aspect, timber floors, landscaped gardens and ocean glimpses. Cheapest house in Thirroul come see the value.
Sale $575,000View Saturday 11th May 10.30am - 11.00amTony Dribbus 0433 175 681
Ray White Thirroul
Thirroul 25/40 McCauley Street This apartment is the perfect place for entertaining, with the generous sized living/dining room flowing seamlessly onto your oversized and private balcony. Two double sized bedrooms, master with en-suite, stunning caesar stone and polyurethane kitchen and a secure under-ground garage.
Sale $590,000 - $640,000View Saturday 11th May 12.00pm - 1.00pmAlex Gardner 0435 623 362
Ray White Thirroul
Thirroul 2 Seaview Terrace This immaculately maintained family residence with three bedrooms, two bathrooms, two living areas, double garage, enclosed front and private rear garden. Set on a one way street with widespread un restricting views, just minutes from Thirroul’s town centre.
Sale $690,000View By AppointmentAlex Gardner 0435 623 362
Ray White Thirroul
Woonona 15/133a Campbell Street Ideally located this neatly renovated 2 bedroom apartment is suited to the first home buyer or astute investor. Features include modern kitchen & bathroom, BIW’S, internal laundry, l/u garage & balcony. Rental Estimate $290-$300pw
Sale $255,000View Saturday 11:30 -12:00Ben Baaner 0423 218 285www.raywhitewollongong.com | 4229 8600
Ray White Wollongong
Mangerton 3/17 Payne Street Features include 2 bedrooms with BIW’s, modern kitchen & bathroom, spacious living area opening out to the balcony, internal laundry & lock-up garage. Currently Rented at $280pw. Strata $400pq
Sale $239,000View By AppointmentBen Baaner 0423 218 285raywhitewollongong.com | 4229 8600
Ray White Wollongong
Just
List
ed
Wollongong West 3/7 England Street In a quiet cul-de-sac with only 6 units in the block this north facing unit has two bedrooms, built in robes, large living area opening onto balcony, has its own laundry plus under stair storage, & carport
Sale $249,000View Saturday 11am to 11.30am 1.00pm to 1.30pmAlex Edler 0458 721 196raywhitewollongong.com | 4229 8600
Ray White Wollongong
Figtree 42 Gibsons Road Neat & tidy brick and tile home. Offering 3 bedrooms,with built ins, combined kitchen and dining, separate lounge,single car garage, approx 671sqm north facing block. Close to all amenities
Auction Satuday 25th May 12pmOn-siteView Sat 11:00 - 11:45am Thur 4:15 - 5:00pmNick Vranesevic 0419 447 504raywhitewollongong.com | 4229 8600
Ray White Wollongong
9 May 2013 49
![Page 50: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/50.jpg)
Ray White Unanderra
Figtree 16 Darragh Drive
Executive Residence, Premier Address
Exquisitely presented, offers a myriad of living
spaces and flexibility to accommodate dual
accommodation.
* Gourmet kitchen with expansive bench space
* Polished Jarrah floors, ducted air conditioning
* Workshop and additional storage
* Solar power and water tank
5 A 3 B 2 C
Sale
$595,000 - $645,000
View Sat 11:00am - 11:30am & 2:00pm - 2:30pm
Michael Moate [email protected]
raywhiteunanderra.com.au/9507884271 4000
Farmborough Heights 26 Stanley Avenue High On The Hill 3 A 1 B 2 C
Ray White Unanderra
Proudly perched on the high side of Stanley Avenue is this fantastic family home.* Renovated bathroom and well presented kitchen* Leafy surrounds & peaceful outlook from the balcony* Double garage plus loads of under house storage
Sale $350,000 - $390,000
View Sat 10:00am - 10:30am & 1:00pm - 1:30pm
David Greenwood [email protected]/960488 | 4271 4000
Mount Ousley 88 Dumfries Avenue Popular Mt Ousley Address 3 A 1 B 2 C
Ray White Unanderra
Be impressed from the moment you enter this exceptional light filled home which has so much to offer the growing family.* Located near a choice of public & private schools* Air conditioned living areas, separate dining* Renovated bathroom, fully fenced north facing yard
Auction Wed 29th May from 6pmWests Illawarra League Club
View Sat 11:00am - 11:30am & 2:00pm - 2:30pm
Teresa Costa [email protected]/960436 | 4271 4000
50 9 May 2013
![Page 51: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/51.jpg)
Auction
R�H Austinmer4268 1399
213 Lawrence Hargrave Drive, ThirroulInvest by the Sea
Block of 3 units situated in a prime location level walk to Thirroul beach,pool,cafes, shops in the Thirroul township. Situated on approx 700sqm level block with future possible strata subdivision STCA. The main unit is of a penthouse style with plenty of light and sun a pleasant NE aspect, large balcony & escarpment views. Approx rental income $1200 pw.
ViewSaturday 10-10.30am 2-2.30pm, Wed 5-5.30pm
AuctionAuction On Site 25th May 10am
AgentJohn McGuiness0402 021 [email protected]
6 3 3 1
rh.com.au/Austinmer
New O
pen Satu
rday
Located in beautiful Blackbutt this lovely block of prime land is suitable for almost all designs of home. 825 square meters in area with panoramic mountain views across the escarpment certainly set a tranquil setting.
12 Cockatiel Ct
This magnificent unit is on the top floor and it offers beautiful views to the lake and ocean. Quietly located near all amenities this spacious unit has everything you would ever want. Big open living areas, huge dining room which is off the large well appointed kitchen. There are two bedrooms with robes, balcony, lock up garage and loads of potential. This property is ideal as an investment property or a first home.
Excep
tional
Value
3/14 Melinda Grove
* Opposite Warilla Beach* 531m2 block - 15.24 X 35.05* Build your DREAM HOME* Enjoy Holiday atmosphere all year round* Golden Opportunity to live at the BEACH
REDUCED
54 Little Lake Cres
Set in beautiful Lake Illawarra this master built apartment has a sunny northerly aspect with sensational views. Walk to the lake, beach, shops, schools and transport this incredible apartment has it all. Spacious living areas, gourmet kitchen, 3 bedrooms with robes with the main featuring a large ensuite, 2 balconies, security parking underneath with storage area, air conditioning and security intercom.
Make a
n
OFFER
4/78 Addison Ave
Magnificent family residence in popular beach side estate. Spacious formal and family living areas, 5 bedrooms, double drive through garage, well appointed kitchen, large covered pergola entertaining area, sparkling inground pool and much more. This idyllic home certainly sets a lifestyle change for the best being able to walk to the beach and lake entrance.
Excep
tional
20 Boundary Rd
Great opportunity to buy this superb commercial warehouse in Sunset Ave Warilla. Easy access to major roads, high roller door access and approximately 220 square meters of warehouse floor, mezzanine level and around 20 square meter office. You also have roller door access to rear yard, shower and storage area. Expose your business or add to your investment portfolio. Presently tenanted at $22,880 PA.
7.7%
Return
2/30 Sunset Ave
Bulli 14 Alroy St "Instruction from NSW Trustee & Guardian" 3 A 1 B 1 C
Ray White North Beach Wollongong
Set in one of Bulli’s exclusive cul-de-sac streets and within metres to the water’s edge is this character filled family home. Explore the outstanding potential of this original beauty or capitalise on its beach side location and build the home you’ve always wanted. Features high ceilings & a sunny low maintenance block.
Auction On-site Sunday 26th May at 11.00amRegistration from 10.30am
View Saturday 11.30-12.15pm
Fady Saad 0422 050 392
raywhite.com | 4226 9000
Just
List
ed
Wollongong 1a/46 Smith St "Showcased in Style" This outstanding home exudes quality & features:- Open plan, poly/ stone kitchen, 4 large bedrms, 3 bathrms incl. en-suite, parquetry flrs, media rm, office, studio, workshop, cov’d courtyard, 2 garages, security gates & entry.
Sale $969,000View Saturday 2.30pm-3.00pmRodney Stone 0431 821 949raywhite.com | 42 26 9000
Ray White North Beach Wollongong
Just
List
ed
Figtree 29 Gellatly Ave "Deceased Estate - Attention Renovators" Original 3 bedroom brick & tile home in quiet leafy street. Features:-Dual living areas, dining, timber floors, balcony, 2.5 garage + carport. Renovate, remodel or rent, but act now or hesitate & risk missing out!
Sale $459,000View Saturday 12.15-1.00pmRodney Stone 0431 821 949raywhite.com | 4226 9000
Ray White North Beach Wollongong
Just
List
ed
9 May 2013 51
![Page 52: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/52.jpg)
1
64 Central Avenue, Oak FlatsCommercial Investors Opportunity
R&H Wollongong 4229 9600
rhw.com.au
• Fantastic commercial opportunity with stacks of upside potential•Leased to 3 long established businesses - Chemist, Restaurant & Baker• Generating $71,500+gst rental income per year• High Pedestrian flow and active commercial hub assures continued long term property value growth• Prominent main street position
• Extensive public carpark at rear
By Appointment$799,000Lynda Burnside 0411 800 801
ViewPriceAgents
rhw.com.au
R&H Wollongong 4229 9600
rhw.com.au
66 Mayfield Crct, Albion ParkThe Perfect Family Home• Well presented, single level brick home• Separate dining & living, tiled throughout• Open plan kitchen/ family opening out to a large covered entertaining area• Drive through tandem garage & garden shed
4 4 2 2
Saturday 12.30 - 1.00pm$375,000 Joshua Kersten 0419 991 500Kayla Watchorn 0424 503 316
ViewPriceAgents
rhw.com.au
R&H Wollongong 4229 9600
27/40 McCauley Street, ThirroulUltra Modern Living• Ultra modern 3 bedroom apartment• Spacious open plan living• Stylish kitchen finished with s/s appls • Entertain on the terrace with mountain views• Relax and enjoy the low maintenance lifestyle
3 3 2 2
Saturday 12.00 - 12.30pmOffers above $699,000Kayla Watchorn 0424 503 316Joshua Kersten 0419 991 500
ViewPriceAgents
Saturday 12.- 12.30 & 2 - 2.30pm$375,000 - $395,000Kayla Watchorn 0424 503 316Joshua Kersten 0419 991 500
ViewPriceAgents
96 The Avenue, Mt St ThomasModern, Slick & Central
2 2 1
• A much loved & fully renovated home• Modern feel throughout with BIWs• Stylish kitchen, sep lounge & dining• Large backyard with outdoor entertaining• Garden shed, storage & securely gated
rhw.com.au
R&H Wollongong 4229 9600
R&H Wollongong 4229 9600
Saturday 10.00 - 10.30am$295,000 - $335,000Kayla Watchorn 0424 503 316Joshua Kersten 0419 991 500
ViewPriceAgents
11/27 Church Street, WollongongCosmopolitan Living
2 2 1 1
• A Modern & stylish city apartment with BIWs• Open plan living and large balcony• Streamline kitchen with views across the city• Only minutes to Wollongong’s best beaches• Perfect for anyone looking for city living
17/26-28 Market St, WollongongBeautiful Views• Large apartment with BIW CBD• Generous sized living & dining area• Modern kitchen with stainless steel appliances• 180 degree views from the outdoor entertaining• Minutes walk to Wollongong’s South Beach
1 1 1
10.00 - 10.30am$359,900Kayla Watchorn 0424 503 316Joshua Kersten 0419 991 500
ViewPriceAgents
rhw.com.au
R&H Wollongong 4229 9600
1 Medway Drive, Mount KeiraIdeally Positioned
4 2 2R&H Wollongong 4229 9600
AUCTION
rhw.com.au
• Featuring a flexible floor plan with ample living space• Neat kitchen, fitted with dishwasher and open plan dining• Large bedrooms with BIW’s• Self contained rumpus room/retreat with bathroom• Low maintenance yard with entertaining deck off the rear
159 Jacaranda Avenue, FigtreeAttention Entertainers & Gardeners
4 2 R&H Wollongong 4229 9600
AUCTION
• Modern & spacious family home on 1669m2 garden block• Free flowing living with bi-fold doors opening to large deck• 2 large living spaces designed for relaxation & entertaining• 2 bathrooms & BIWs throughout• A beautifully presented & superbly positioned private oasis
Saturday 11 - 11.30 & 1 - 1.30pm08/06/2013 On Site @ 10.30amJoshua Kersten 0419 991 500Kayla Watchorn 0424 503 316
ViewAuctionAgents
Saturday 11 - 11.30 & 2- 2.30pm08/06/2013 On Site @ 12.00pmLynda Burnside 0411 800 801 Joshua Kersten 0419 991 500
ViewAuctionAgents
Commercial
7 Duley Street, DaptoSuper Modern Showcase
3 3 2 1.5
ViewPriceAgents
• Fully renovated & re furbished 3 bed home • Brand new kitchen & bathrooms • Spacious lounge & dining area• Large 1.5 tandem garage • West facing entertaining terrace at the front
rhw.com.au
Saturday 1.30 - 2.00pmOffers above $350,000Joshua Kersten 0419 991 500Kayla Watchorn 0424 503 316
rhw.com.au
R&H Wollongong 4229 9600
![Page 53: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/53.jpg)
��������������������������
������������������������������������� ���� ��
��������
�����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������
���������������������������������������������������������������������������������������������������������������������������������������������������������������������������������
������ ��������������
�������� ���������������������
�������� ��������������������������
������� ���������������������������������� ���������������������������������������� �������������������������
�
����������������������
�
�������������������������������������
��������������������������� ���� ��
�������������������
����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������
��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������
�������� ������������������������� ��������
�������� �������������������
�������� ������������������������������������
������� ���������������������������������� ���������������������������������������� �������������������������
�
����������������������
�
![Page 54: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/54.jpg)
4261 0333www.prddapto.com.au Sell Smarter
Beautifully presented 3 bedroom villa in fabulous location close to lakeside and parkland. Property is in immaculate order and is ready to move in with nothing to do. Features large lounge with plenty of natural light, 3 bedrooms with enormous main which has access to the 3 way bathroom (acting as an ensuite). Single garage with internal access and a lovely paved courtyard area completes this desirable property. Very low body corporate fees.
Albion Park Rail, 3/17 Koona Street3 BED 1 BATH 1 CARLakeside Villa
VIEW Saturday 1 - 1:30pm PRICE $325,000 - $350,000 CONTACT Tracey McDonald 0404 033 533 [email protected] Geoff Birchall 0439 737 327 [email protected]
A truly epic home is right here for the taking. Include the extended family under one roof with the unique layout of this stunning home. Featuring open plan living areas on the lower level that extend out from the gourmet kitchen out to the alfresco dining. Sit and enjoy the inground pool or entertain friends with a BBQ on those hot summer nights. Travel upstairs and enjoy either 4 large bedrooms or two separate accommodations both with their own living area and bathrooms to die for. This home has to be seen to be fully appreciated and we welcome your inspection.
Haywards Bay, 16 Bayview Ave4 BED 4 BATH 2 CARLive The Life You Deserve
VIEW Saturday 1 - 1:30pm PRICE $655,000 - $685,000 CONTACT Jeremy Tillman 0418 244 601 [email protected]
Great starting off property with 3 bedrooms, 1 bathroom and a spacious family and entertaining room. This home is great for families looking for their first home, with proximity to Dapto public school an added convenience. Enjoy nice afternoons under the covered outdoor entertaining area with family and friends while soaking up the established gardens previous owners have cultivated. This property also offers a garden shed to boot with a remote garage and plenty of space for any hobby to grow in. Close to Horsley shopping centre, experience all your needs within an easy walk.
Horsley, 11 Horsley Drive 3 BED 1 BATH 1 CARMust Have Horsley
VIEW Saturday 11 - 11:30am PRICE $325,000 - $355,000 CONTACT Jeremy Tillman 0418 244 601 [email protected]
Beautifully presented 4 bedroom home in an extremely popular location, close to waterways and walking tracks. Set on a 592m2 block the property sits perfectly with a great street appeal. Property includes 4 large bedrooms, main with ensuite, large double garage with remote, separate rumpus room, large lounge/dining areas, ducted air conditioning, solar panels x 6, large 5,000 litre water tank & covered rear entertaining area. A quality property in pristine condition.
Horsley, 51 Sunnybank Ave4 BED 2 BATH 2 CARShow Home Perfection
VIEW Saturday 12 - 12:30pm PRICE $475,000 - $495,000 CONTACT Jeremy Tillman 0418 244 601 [email protected]
NEW LISTING
NEW LISTING
![Page 55: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/55.jpg)
72 Kanahooka Road Kanahooka
CALL 4261 3333 www.brooksterrace.com.au
NOW SELLING New BoutiqueLand EstateLakeside Living with a Slice of History
Boutique estate of just 81 elevated lots
Sizes ranging from 450m2 - 831m2
Uninterrupted views to Lake Illawarra
Perfectly positioned for fishing, kayaking, sailing, golf, cycling, walking and tennis
Walk to the nearby childcare centre, primary schools and high schools
Original heritage features with stone walls and brick arches
*Exclusive offer to purchasers at Brooks Terrace Land Development Kanahooka. Normal IMB lending criteria, terms and conditions apply. Limited time only. IMB Ltd. ABN 92 087 651 974. AFSL/ACL 237 391
Preferred Finance PartnerExclusive* finance package available
Call 133 462 for more informationPhone: 02 4261 3333 Mobile: 0408 424 474
Contact Greg Pollard
4261 0333www.prddapto.com.au Sell Smarter
Dapto, 88 Parkside DriveA unique home with high ceilings, 2 living areas, timber kitchen, modern colour scheme, covered deck & a carport that could be enclosed to make a garage. Dishwasher, fireplace, air-con, this home has it all. A1 tenant paying $340 pw who is happy to stay if an investor buys. Opportunity to increase the rent upto $370pw
Bigger Than It Looks
3 BED 1 BATH 1 CAR
VIEW Saturday 12 - 12:30pmPRICE $310,000 - $330,000CONTACT Tracey McDonald 0404 033 533 [email protected]
Horsley, 14 Riverpark WayAbsolutely immaculate home set in private location overlooking protected woodland reserve. Formal lounge & dining with vaulted ceilings ,4 bedrooms with BIW & main with WIR & ensuite, beautiful gardens with covered outdoor entertaining area, double garage with side access for caravan or boat.
Show Home Presentation
4 BED 2 BATH 2 CAR
VIEW Saturday 11 - 11:30amPRICE $435,000 - $465,000CONTACT Jeremy Tillman 0418 244 601 [email protected]
VIEW By Appointment PRICE $389,000
CONTACT Jeremy Tillman 0418 244 601 [email protected]
Dapto, 73 Byamee StreetOnly a short walk to Dapto CBD, Dapto Pool, Dapto mall & public transport is this fastidiously maintained and deeply loved 3 bedroom home. A large formal living area compliments the updated kitchen & bathroom. With an extra large family room for added living space this home would easily suit the growing family. Outside you have ample yard space with minimal maintenance & a large in ground pool for those hot summer days as well as a covered entertaining area or Carport. Wether you’re looking to enter the housing market or expand your property portfolio this home is sure to impress.
A Wonder To BeholdVIEW Saturday 11 - 11:30am PRICE $540,000 - $580,000
CONTACT Greg Pollard 0408 424 474 [email protected]
Albion Park Rail, 29 Shearwater Blvd There is absolutely nothing to do but move in & enjoy the features & comforts this stunning home has to offer. In the best of locations just meters to the lakes edge, walking tracks & parkland this home has been designed & built for the modern family needs. Flowing over 2 levels & featuring separate entrance foyer, sunny lounge room, dining, gourmet kitchen, 4 extra large bedrooms - main with ensuite, downstairs study, powder room, internal access to double garage and rumpus room that leads onto covered private outdoor entertainment area and sparkling inground pool. Inspect today - your new lifestyle awaits.
A Slice of Paradise 5 BED 2 BATH 2 CAR3 BED 1 BATH 0 CAR
VIEW Saturday 10 - 10:30am PRICE $310,000 - $330,000
CONTACT Jeremy Tillman 0418 244 601 [email protected]
Koonawarra, 17 Wallabah Way Fully renovated this great home offers the very best start, featuring 3 bedrooms, plus study, stunning open plan kitchen and new modern bathroom there really is nothing to do but move in. Only a short stroll to all that Lake Illawarra has to offer, you will be able to picnic, play and come home to something very special.
When Presentation Matters 3 BED 1 BATH 2 CAR
9 May 2013 55
![Page 56: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/56.jpg)
1-3/6 Napier Street, Balgownie From $605,000• Under Construction...Boutique complex of only three• Stylish contemporary open plan living & dining areas• Kitchen with polyurethane & stone plus European appli.• Sliding doors out to sunny entertaining area & garden• Convenient to schools, parks, transport & village shops
3 2 2
BY APPOINTMENT
4 Byrnes Place, Balgownie $699,000• Large brick family home set in quiet cul-de-sac• Multiple living/dining areas, plently of ample space• Homely timber kitchen over-looking level backyard• Main b/r with WIW & ensuite, bedrooms with BIW’s• Ambient escarpment views & only 10 mins drive to CBD
4 3 2
OPEN SAT 11.00-11.30AM
49 Emerson Road, Dapto $205,000• Block will be completely cleared before settlement• Possible duplex site (STCA) level block, no stairs• Over 600sqm to build your dream home• Great location, central to schools, transport & city centre• Your chance to create something special
BY APPOINTMENT
64 Laver Road, Dapto $329,000• Generous floor plan, polished boards throughout• Solid brick home, great investment/first home• Attractive rebate on solar power - currently No Bill• Huge backyard, u’cover area & cubby house, fully fenced• Break into the property market, affordable & great home
3 1 1
OPEN SAT 11.00-11.30AM
3/24 Parker Road, East Corrimal $255,000• 1st home or investment unit near great surf beach• Bathroom recently upgraded, sep. laundry, new paint• North facing, main bedroom with fan & BIW• Walk to East Corrimal Beach, parks, schools & transport• Handy location, a must to inspect...
2 1 1
OPEN SAT 2.00-2.30PM
51-59 Princes Highway, Fairy Meadow $419,000• Excellent opportunity for 1st home buyers or investors• Modern open plan living & dining areas with balcony• Good size bedrooms with BIW’s, internal laundry• S/steel appliances, linen, lift access, security parking• Short walk to shops, parks, restaurants and transport
2 1 1
BY APPOINTMENT
6 Walang Avenue, FIGTREE $455,000• This renovated home has had all the hard work done• Two large light & airy open living areas• Modern & stylish renovated kitchen & bathrooms• Large pergola with leafy outlook & double carport• Only a short stroll to shops, transport & schools
4 2 2
OPEN SAT 1.00-1.30PM
Lot 3 Goodbury Avenue, Figtree $785,000• Build your dream home with amazing panorama• North facing 4427sqm (approx.) slight sloping• Building envelope offering 1200sqm (approx.)• Driveway and services on site, close to schools• Amazing opportunity to design your own lifestyle
BY APPOINTMENT
53 Taronga Avenue, Mount St Thomas $339,000• Perched on the high side with rolling escarpment views• Charming fresh interiors, high ceilings & tandem garage• Versatile layout ideal for 1st home with timber floors • Kitchen area with adjoining dining opening to backyard • Ideally positioned mins to Westfield, City CBD & transport
2 1 2
OPEN SAT 11.00-11.30AM
13 Waldron Street, Mount St Thomas $349,000• Presenting a neat & tidy 1st home or investment• Separate living & dining, high ceilings & timber floors• Neat kitchen & bathroom, bedrooms with BIW’s• Family room flowing to sunny north-facing backyard• Walking distance to Westfield shops, parks & schools
2 1
OPEN SAT 11.45-12.15PM
27/17 Payne Street, Mangerton $279,000• Fully re-furbished & very impressive throughout• Flexible floor plan, 2 or 3 bedrooms - your choice• Enjoy the tranquillity & convenient location• Makes for a great first home or investment• This is a must to inspect for all...
2 1 1
OPEN SAT 12.00-12.30PM
11/11-15 Church Street, North Wollongong $729,000• Contemporary living with beach lifestyle & great location• Surround sound with open plan living & dining areas• Gourmet kitchen with European appliances & stone tops• Sunny balcony with strong north/eastern ocean views• Minutes walk to popular cafes, beaches & Stuart Park
3 2 2
OPEN SAT 10.00-10.30AM
1 Larkins Lane, Yallah $1,260,000• Master built spacious and light filled residence• Single level, formal lounge and dining, rumpus• Gourmet kitchen, walk in pantry, meals area• Heated inground pool, detached garage/shed• Impressive finish & position, superior lifestyle
6 4 3
OPEN SAT 10.45-11.30AM
60/60-62 Harbour Street, Wollongong Offers Above $669,000• Executive apartment in the Ocean View Apartments• Sun-drenched & North facing, large open plan design• Stylish & sleek kitchen & bathroom + double LUG• Large balcony with breathtaking ocean views• Short strol to shops, CBD, cafes & city beaches
3 2 2
OPEN SAT 11.00-11.30AM
4/33-35 Church Street, North Wollongong $689,000• Enjoy the lifestyle & location within The Aria Apartments• Stylish comtemporary open plan living & dining areas• Master bedroom with luxury ensuite & balcony vista• Spacious entertainers balcony with city & ocean views• Stroll to fabulous beaches, harbour & city centre shops
3 2 2
OPEN SAT 12.00-12.30PM
23/22 Kembla Street, Wollongong $539,000• Great views from open plan liv/din/kit, excellent condition• Generous master b/r with ensuite, BIW & 2nd balcony• Double lock up garage in security basement & lift access• Mountain & ocean views from entertainers balcony• Central & close to beach, cafes, uni, shops & transport
2 2 2
OPEN SAT & SUN 11.45-12.15PM
19/11-15 Church Street, North Wollongong $1,375,000• Enviable dual level penthouse, northern views• Light filled open living & dining, rumpus room• Superior kitchen, modern bathroom & ensuite• Ducted a/c, study area, 50sqm lock up garage• Spacious rooftop terrace with exceptional views
3 2 2
BY APPOINTMENT
26 Jutland Avenue, Wollongong $475,000• Near level corner block, endless possibilities• Convenience of the CBD, schools & transport• Peaceful location in quiet tree-lined street• Sunroom, sep. lounge plus rumpus/gamesroom• IG pool as well as plenty of yard for the kids
4 1 1
OPEN SAT 1.00-1.30PM
![Page 57: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/57.jpg)
R E A L E S T A T E
140 Keira Street, Wollongong www.taranto.com.au Ph: 4228 1622
![Page 58: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/58.jpg)
![Page 59: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/59.jpg)
• This neat and tidy 3 bedroom townhouse is located in central Unanderra
• Large living and dining areas• Good size kitchen with plenty of storage space• Vertical blinds throughout, internal laundry• Lock up garage with internal access• Just a stroll from shops, schools and public transport,
this townhouse is the perfect start for a new family• Currently rented at $300pw
Carla Veljanoski0431 086 264
NEW
UNANDERRA O/A $280,0003 1 1
• Modern kitchen with stainless steel appliances• Combined bathroom and laundry• New timber flooring• Lounge/dining area• Built in wardrobe in main• Off street parking• Ground floor position• Small complex at the rear of the property• Close to beach
Carla Veljanoski0431 086 264
NEW
CORRIMAL EAST $259,0002 1 1
• Built-in-wardrobes in all 3 bedrooms• Air-conditioning as well as ceiling fans• Modern kitchen with dishwasher• Modern bathroom with handy shower over bath design• Massive drive through carport and entertaining area• Large fully fenced backyard• Only a short walk to shops, schools, childcare centres,
sporting grounds and transport• Previously rented at $360.00 per week
Carla Veljanoski0431 086 264
NEW
PRICE
KOONAWARRA $299,0003 1 1
Positioned at the front of a well maintained complex, this villa boasts fresh contemporary interiors and a wonderful sense of natural light. • Just footsteps to Wollongong´s CBD, schools,
transport and popular cafes and the beach• Open plan kitchen/dining and a spacious separate
living area• Courtyard garden • Lovely atmosphere with a friendly sense of community
Carla Veljanoski0431 086 264
NEW
WOLLONGONG $525,000 3 2 2
![Page 60: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/60.jpg)
Huxley & Partnersr e a l e s t a t e
The Green Team
Ph. (02) 4286 5555 112A Railway Street, Corrimal View all these properties online at www.huxleyrealestate.com.au
Coniston $279,000 3/40 Bridge Street • Fully renovated large two b/r unit, open plan living• Nothing to spend, internal laundry, timber fl oors• City & ocean views, small complex, close to CBDTony Sloane 0409 299 407
2 1 1
Keiraville $629,000 53 Grey Street • Large family home with drive through double garage • High ceilings, polished timber fl oors, open plan lounge• Two large undercover outdoor entertainment areasTony Sloane 0409 299 407
5 2 2
Keiraville $499,000 61 Murphys Avenue • Single level living, open plan living, polished fl oors • High ceilings, low maintenance grounds, private c/yard• Second garage underhouse,close to University & shopsTony Sloane 0409 299 407
2 2 2
OPEN SAT11:30-12:30
Woonona34 Mitchell Road• Beautiful single story brick veneer home• Set on a large level garden block • Great investment or for fi rst home buyer
Charles Hegyi 0408 423 051
$479,000
• Polished fl oor boards throughout• Renovated kitchen and bathrooms• Ideally located to schools, shops, beaches and station
3 2Austinmer“Sandyfeet” 12 Boyce Avenue• Only a few steps from both Austinmer beaches• Impressive designed quality family home backing onto and overlooking the exclusive Glastonbury GardensCharles Hegyi 0408 423 051
Offers Above $1,150,000
• Landscaped gardens, jetty style boardwalk to a large spa • Three living areas with two found downstairs• Appropriately named you’ll be close to one of the most picturesque beaches on the east coast.
5 3 2
Fairy Meadow $310,000214-220 Princes Highway• Large open plan apartment with two big bedrooms • Int. laundry, big granite kitchen, security parking, lifts • On site building manager & close to all amenities Tony Quin 0414 428 401
2 2 1
Gwynneville $939,000 3 John Street • Designer built impressive home with four bedrooms • Four bathrooms, two kitchens, & huge rumpus room • Level block with bonus semi detached building at backTony Sloane 0409 299 407
4 4 4
OPEN SAT 1:00-2:00NEW
Keiraville $579,000 258 Gipps Road • Great potential - brick & tiled home w separate garage• Level block with two street frontages• Close to Botanical gardens,shops, University & free busTony Sloane 0409 299 407
5 2 2
Thirroul $699,00042 Kanangra Drive• Polished timber fl oors, superb kitchen, new bathrooms• Beautiful private inground pool, some ocean glimpses• Great pergola BBQ area, perfect for a party lifestyleTony Quin 0414 428 401
2 24
OPEN SAT 10:30-11:15
Corrimal6 Cheryl Place• Nicely renovated double storey brick veneer home • 4/5 bedrooms, ensuite + spa bath, rumpus room • Situated in a quiet cul-de-sacTony Quin 0414 428 401
Offers Above $650,000
• Very private location opposite corrimal foothills• Plenty of space, can be double living, lots of options• Ideal family home, inspect before you miss out!
5 2 2
OPEN SAT 11:30-12:30NEW
North Wollongong4/36 Pleasant Avenue• Ideal beach location townhouse in sought after street• Good size, two bedrooms with balcony & private c/yard• Enclosed large carspace with second toilet & WCTony Quin 0414 428 401
• Four in block with private access to stuart park• Only one minute to north beach, restaurants & Parks• A must see property!!
2 1 1
$469,000
OPEN SAT 9:30-10:15
Corrimal3/62 Park Road• Large 2 bed unit featuring polished boards throughout• Spacious living room, large kitchen with dining space • Ideal investment, currently leased at $250.00 per weekCharles Hegyi 0408 423 051
$229,000
• Internal laundry, covered carport parking space• Convenient location to shops, transport, schools and close to beach and bike track
2 1 1Woonona Offers to $349,0005/19 Nicholson Road• Nicely renovated good size two bedroom townhouse• Timber veneer fl ooring, superb as new kitchen, BIWS• Large balcony, enclosed carport, garden courtyardTony Quin 0414 428 401
1 12
OPEN SAT 10:30-11:15NEW
Woonona $699,0005 Victoria Lane• Absolute Dream home, luxury living, superb ent area’s• 5 bedtooms or 4 & study/offi ce, open plan living• Solar panels, water tank, aircon & natural gasTony Quin 0414 428 401
2 24
NEW
Bulli Offers to $590,00029 Beacon Avenue • Beautifully presented “A” frame style home• As new kitchen, open living, sunroom, inground pool• Covered ent./BBQ area, 700sqm block, walk to beachTony Quin 0414 428 401
4 2 2
OPEN SAT 12:30-1:15
![Page 61: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/61.jpg)
O’ConnorO’Connor
4226 60551/55 Kembla Street Wollongongwww.oconnors.com.au
![Page 62: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/62.jpg)
Coastside
coastsidefn.com.auShop 4/20-26 Addison St, Shellharbour
4295 5033
Peacefully situated in a quiet street, this opulently renovated dual level home with sweeping ocean views is an idyllic family retreat designed for everyday living. Conveniently located close to parkland, transport, shops and schools, there is absolutely nothing to do but move in and relax.
OPEN SAT 11.00-11.30AM
4 2 4
Contact Maria Field 0411 306 323
NEW
LISTIN
GO
PEN HO
USE
BARRACK HEIGHTS 81 Strata Ave $469,000
Room With A ViewEnjoy 180 degree panoramic views of both Lake Illawarra and Mount Kembla from this beautifully presented family home set in an address defined by its convenience to the heart of the Illawarra. Featuring a versatile floorplan split over two levels, this first time offered property presents an exciting opportunity to add a personal touch.
4 2 2
Contact Darren Mansell 0413 747 322
NEW
LISTIN
G
LAKE HEIGHTS 80 Hassan St $549,000-$580,000
Sitting on Top of The World
A fantastic opportunity exists to acquire this charming 3 bedroom original design brick and tile home Situated in a quiet street, this gem is within walking distance to shops and clubs, and only minutes drive to Port Kembla beach and pool. Sitting on a flat 671m2.
OPEN SAT 1.30-2.00PM3 1 1
Contact: Darren Mansell 0413 747 322
OPE
N
HOUSE
PORT KEMBLA20 Jubilee St $322,000
Ready for a New BeginningAt only 6 years young, this residence was designed to offer a relaxed family lifestyle. Large proportions with low maintenance interiors and a light, airy ambience, this property also offers four bedrooms, main with ensuite, two living areas plus separate study or computer room, modern kitchen and large entertaining area.
OPEN SAT 2.30-3.00PM4 2 2
Contact: Darren Mansell 0413 747 322
OPE
N
HOUSE
HAYWARDS BAY152 Haywards Bay Dr $485,000
Priced to sell quickly!This exceptional family residence emanates contemporary luxury and elegance. Providing a choice of formal and casual living areas that spill outdoors to the enclosed entertainment area and a large landscaped backyard, this residence is perfect for the family. Four large bedrooms, complete with built in wardrobes, magnificent master bedroom featuring large en-suite, walk in robe and separate sitting area, separate study area with internal garage access.
OPEN SAT 12.00-12.30PM
4 2 3
Contact Maria Field 0411 306 323
OPE
N
HOUSE
SHELL COVE 3 Green Cres $644,500
Designer Living
![Page 63: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/63.jpg)
Domain
112 Central RoadUnanderra
domainfirstnational.com.au 4271 7444
Simple 3 bedroom brick veneer home. Featuring carpet to the 3 bedrooms and mirrored BIW to main. L shaped living and dining area with air conditioning. Neat and tidy kitchen that overlooks the semi in ground pool with small undercover entertainment area. Double lock up garage. Great first home. Be quick or miss out.
INSPECT 10:30-11:00AM
3 1 2
Contact Ali Yagmur 0412 717 444Inspect Saturday, 11 May 10:30-11:00am
NEW
ALBION PAKR RAIL 13 Jarrah Way OFFERS ABOVE $300,000
Budget Price HomeBeautiful extra large 3 storey townhouse. Featuring a modern kitchen with huge open plan living area leading out to the terraced balcony capturing the distant ocean views. Mirrored BIWs to the 2 double sized bedrooms. Updated bathroom with shower, spa bath and separate w/c. Large double lock up garage with second shower, w/c and internal laundry with private courtyard. Located only a few minutes walk to Hospital, Westfield Warrawong, schools and transport.
INSPECT 11:30-12:00PM
2 2 2
Contact Ali Yagmur 0412 717 444Inspect Saturday, 11 May 11:30-12:00pm
NEW
WARRAWONG 3/314 Cowper Street OFFERS ABOVE $300,000
A Townhouse with the Lot Solid brick veneer requiring some TLC and kitchen. Featuring polished floorboards throughout with 3 double size bedrooms. Huge tiled bathroom with shower and bath. 2 living areas with one being extra large. Big backyard with paved entertainment area. Great mountain views from the front balcony. Located in a quiet street and close to shops, schools and Lake Illawarra
INSPECT 12:15-12:45PM
3 1
Contact Ali Yagmur 0412 717 444Inspect Saturday, 11 May 12:15-12:45pm
NEW
BERKELEY 15 London Street $285,000
The Renovator
Cosy 3 bedroom home with a sunny under cover patio. Featuring an open plan living area with polished floorboards throughout. Neat and tidy kitchen with 3 good size bedrooms. Internal laundry with single lock up garage and storage shed. Situated close to all amenities this neat and tidy home has potential.
INSPECT 1:00-1:30PM
3 1 1
Contact Ali Yagmur 0412 717 444Inspect Saturday, 11 May 1:00-1:30pm
NEW
UNANDERRA 13 Thornbury Avenue $295,000
Has Potential! Only a short stroll to East Corrimal Beach, railway, schools and shops is this neat and tidy ground floor 2 bedroom unit. This lovely unit features polished floorboards throughout with 2 good size bedrooms. A simple but nice kitchen combined with the dining area. Spacious living area with reverse cycle air conditioning, large bathroom with shower and bath. Allocated car spot and located close to all amenities. Great opportunity!!
INSPECT 1:00-1:30PM
2 1 1
Contact Ali Yagmur 0412 717 444Inspect Saturday, 11 May 1:00-1:30pm
NEW
EAST CORRIMAL 2/82 Murray Road $239,000
Beach Side Lifestyle Positioned in a great area of Dapto Heights is this near new home. Featuring BIW’s to 3 of the 4 spacious bedrooms with ensuite to main. Large open plan living area and dining area with a separate family room leading out to alfresco area all capturing the picturesque mountain views. Remote 2 car extra large garage with internal access. Why build when this home has it all and more. You won’t be disappointed. Currently leased to excellent tenants at $500 p/w
4 2 2
Contact Ali Yagmur 0412 717 444Inspect As advertised or by appointment
DAPTO 16A Carlyle Close OFFERS ABOVE $450,000
Beautiful Modern Home
9 May 2013 63
Mid North Coast - Clarence Valley Friday 20 July 2012
Details Page 2
02 6646 2202
LJ Hooker Yamba
yamba.ljhooker.com.au
Contact: Mark Porter 0410 571 105
Contact us now to arrange site visit and quote.
Ph: 6628 8430 | Fax: 6628 [email protected] Kays Lane, Alstonville 2477
Now also in Port Macquarie onPh: 6584 3644Fax: 6584 3655
Need to get power to your property or subdivision?
Do you want the bestexposure when selling
your property?We make sure your property is seen by thousands of
potential buyers through print & web at a fractionof the cost compared to other publications!
See your local real estate agent today...
Mid North Coast - Clarence Valley
02 6646 2202
LJ Hooker Yamba
Contact us now to arrange site visit and quote.
Contact us now to arrange site visit and quote.Now also in Port Macquarie onPh: 6584 3644
Need to get power to your property or subdivision?
Friday 20 July 2012Northern Rivers
Michael Shay - 0427 862 711 Luke Shay - 0416 275 607
LJ Hooker Ballina 02 6686 2711ljhooker.com
Open House Details Page 2 Details Page 3
Northern Rivers
Michael Shay - 0427 862 711 Luke Shay - 0416 275 607
Cover Details Page 3
Thursday 19 July 2012
84 PAGES OF PROPERTY | OPEN HOUSE LIFTOUT PAGES 41-44
Illawarra
![Page 64: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/64.jpg)
GET $10K TOWARDS YOUR DEPOSIT!• LIMITED TIME - An exclusive developer offer for the next 10 buyers to purchase a luxury apartment at The
Vantage Wollongong.. The developer will contribute $10,000 towards your deposit...• Added to the $15,000 First Home Buyers Grant and an approximate $15,000 exemption on Govt Stamp
Duty, that’s around a $40,000 saving to a first home buyer.*• If you are a non first home buyer, you are still eligible for a $5,000 govt grant as well as the exclusive
developer’s offer! That is a $15,000 saving on your purchase. OFFER MUST END JUNE 30• Each apartment delivers its own unique view - be it the city lights, mountain backdrop or glistening ocean
views, there is an apartment that can suit your needs.• The Vantage is perfectly located opposite to Wollongong train station. Estimated Completion by
December 2013 - Visit the website....www.thevantage.com.au or phone 4242 4141
22-32 GLADSTONE AVENUE
Stadia - City Living by The Sea
• Boutique complex offering 24 luxuriously appointed apartments with 4 per floor. Most apart-ments have stunning views of the Pacific.
• Perfectly placed in one of the most sought after and vibrant parts of Wollongong, Stadia is located within easy stroll to the city centre, as well as being ideally located within the entertain-ment district of town, Wollongong Golf Club, and pristine beaches virtually at your doorstep.
•All units come furnished and are in excellent condition.
1-24/5-7 STEWART STREET
Clever in Design
• Fully refurbished apartment that has many treats to offer. • Boasting a good size lounge leading out to a wonderful balcony space that offers not only
indoor/outdoor living but a nice view of ocean as well. Contemporary eat in kitchen, own internal laundry, exceptional bathroom and built in wardrobes in both bedrooms. As you wander outside you will be able to see your own car space and storage area as well as visitor parking.
• Positioned only seconds away from transport and just minutes from Wollongong CBD,TAFE and the Hospital.
• An opportunity is here also for the investor with a current return of $340 pw.
4/15 MYRTLE STREET
A little Balgownie bottler!
• The current and only owner has lived and loved this home for the past 52 years. • This 3 bedroom brick home has been extremely well looked after with many features to enjoy. • Such as separate lounge/dining with reverse cycle air conditioner, kitchen with dishwasher, an
additional family/sunroom at rear, BIW’s, a wonderful fully fenced level yard and a garage. • Set in a fantastic part of Balgownie only minutes walk from Balgownie Village, transport and a
easy drive to beaches and CBD. • This home is great for the first home buyer wanting to add your own touch or investor looking to
seek a good return on your investment. Enquire today!
4 CHALMERS STREET
Desire a sea change?
• Only metres from the beach and Wollongong CBD and directly adjacent from the Golf Course this 3 bedroom apartment (or 2 bedroom plus large study) would be either a great investment returning a rent of $500 pw or great opportunity for a lifestyle change.
• Apartment features include large living, kitchen has caesarstone benches/gas cook top and dish-washer, 2 bathrooms including ensuite.
• Own laundry, air conditioning, wrap around balcony and security parking for 1. • Currently tenanted until 23rd of January 2014.
18/143-149 CORRIMAL STREET
![Page 65: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/65.jpg)
58 Tongarra Road, Albion Park
Immaculate Corporate Fitout
201/53-61 Crown Street, Wollongong
FOR SALE
For Lease $175,000 net per annum + GSTwww.colliers.com.au/5722521
Accelerating success.
101 Keira Street, Wollongong / 02 4222 7222 / www.colliers.com.au
A Site Of Substance and Multitudinous OpportunitiesA Site Of Substance and Multitudinous Opportunities
RECIEV
ERS
& MANAGER
S
APPOINTE
D
F6 Freeway Princes Highway
Illawarra Regional Airport
Illawarra Highway
Tong
arra
Roa
d
Outlines are indicative only
This key development site is strategically located adjacent to Illawarra Regional Airport. It boasts a total land area of 74.12Ha (45ha zoned light industrial) and an approval for a multi stage development. The approved concept plan for the Illawarra Regional Business Park comprises a 60 lot subdivision with associated infrastructure and earthworks.
Easily accessed via the The Princess Highway and the F6 Freeway, it is strategically located 20 minutes south of both Port Kembla and Wollongong and is approximately 100km south of Sydney.
Auction 10:30am 30 May 2013, SMH Auction Rooms, 123 Pitt St, Sydneywww.colliers.com.au/500713411
Simon Kersten0419 333 53302 4222 7222
Viktor Desovski0419 487 09102 4222 7222
Matthew Meynell0413 988 87802 9257 0342
• Rare industrial land holding of this scale• Adjacent to Illawarra Regional Airport - 19km from Port Kembla and Wollongong CBD• Strategic location - direct access to F6 Freeway and main arterial roads• Total land area approx. 74 hectares (45ha zoned IN2 Light Industrial balance E2 and SP2)• Concept plan approved for 60 lot subdivision• Lots range in size from 1,750m² up to 12,430m² (approx)
Under instruction from Receivers and Managers Neil Cussen and Vaughan Strawbridge
Proposed Plan
• 501m² of A-Grade commercial office space with basement car parking available• Office fitout will remain at request including all IT and Communication infrastructure• Featuring boardrooms, open plan offices and full kitchen/breakout area • Lift and approved stair access from ground floor available• Wollongong CBD location near all major amenities • Close proximity to Wollongong Mall & entertainment precinct
Marcelo Ramirez0402 114 60402 4222 7277
Jarrod Hulse0414 253 76302 4222 7216
FOR LEASE
AUCTION
This suite is located in the Wollongong CBD in close proximity to the Wollongong Mall, Crown and Corrimal Street restaurant precincts, Corporate Square, Wollongong Council building, IPAC Theatre and the WIN Entertainment Centre. The property features an excellent fitout which presents beautifully for corporates or legal firms requiring a quality finish.
![Page 66: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/66.jpg)
DGBlawyers
Lorrelle Longbottom
Looking forward to assisting youwith all of your property needs
66 9 May 2013
Project Marketing ☎ 02 4284 3036Tom Wetherall - Mobile: 0417 273 044
66 9 May 2013
Stocking an eclectic range of giftware, furniture, imported pieces, clothing, music...all carefully sourced, making for an unusual and exciting shopping experience. Loads of space (upstairs) to work on new ideas.Online opportunities will inspire the new owners to expand and evolve this great business into new markets.
The business has financial records with daily takings going back years. On sale here is a great going concern with good lease terms to be negotiated with the new owners.Ekho has a great position on the northern side of the Thirroul shopping precinct. This is a great chance to combine lifestyle with income in a growing “destination” shopping suburb.
Contact: Will Soeterboek 0415 898 109 [e] [email protected]
This is an opportunity to leverage and grow a loved brand, stocking the best of Australian design and easy day wear. Featuring a loyal customer base and consistent trade over many years. You get to develop the online capability (and the staffing roster). So there is a massive upside to grow an already successful business.BABES has been established in Wollongong for over 20 years and has evolved and
succeeded well in the changing retail market. Well known Mall position and a reputation for service.Good lease, 2 car parking spaces, storage and a fresh, stylish fit out. Full support for the successful purchaser.
Contact: Will Soeterboek 0415 898 109 [e] [email protected]
BUSINESSES FOR SALEBUSINESSES FOR SALEBUSINESSES FOR SALEBUSINESSES FOR SALEBUSINESSES FOR SALEbevans
A WONDERFUL, EXCITING OPPORTUNITY...
BABES IN THE CITY
bevansthirroul [t] 4267 3444[e] [email protected]
![Page 67: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/67.jpg)
MY HOUSE MY HOME
FLOORING
For Advertising Enquiries, please call 1300 137 161
SKYLIGHT
STAIRS
LOCKSMITH
BUILDING INSPECTION
AIR CONDITIONING
BUILDING INSPECTIONBUILDING INSPECTION
AIR CONDITIONINGAIR CONDITIONING
STAIRSSTAIRS
LOCKSMITHLOCKSMITHSKYLIGHTSKYLIGHT
FLOORINGFLOORING
T T
Complete Locksmithing Service
Wollongong 32 Flinders St – 4226 6644
All types of Locks sold & fitted Sales & Service agents for
CMI Safes & Assa Abloy Security Master Lic. 410183663
To advertise your business here,
Call us on
1300 137 161
• Supply and fit timber stairs • balustrading and handrails using timber, metal, stainless steel & glass.
We can also “supply only” somematerials upon request and availability.
Visit our ShowroomOpen 1pm - 4pm Mon - Fri or by appointment
80 Towradgi Rd, Towradgi
www.southernstairs.com.au
Ph: 4283 1522 | Fax: 4283 1488
®
4285 9923www.suttleshades.com
Your Local Luxaflex Dealer since 1997
®
WINDOW COVERINGS
Reduce your Power Bill & pay less Carbon Tax!
Don’t be kept in the dark!
Phone your local distributor today for a free quote
THE ULTIMATE CONCRETETILE SKYLIGHT
PHONE 1800 475 954
CleartileSkylights
Matching the shape of your roofing
ANTENNAS
BEN AIR
• Airconditioningservices•Sales,serviceandinstallation
ofsplitand ducted systems•Specialisinginducted
installation•AllJapanesebrands
Call us now on
0410 655 648
Pty Ltd
conditioning services
LOCAL, RELIABLE, INDEPENDENT
Pre-purchase building +pest inspections
Sales assist inspectionsBuilding defect and
dilapidation inspections
Call or email Paul now!
0418 159 [email protected]
www.veritasbuildingconsultants.com.au
Quick As AQuick As AGUNN ANTENNA
SERVICEProfessional & Reliable•FreeQuotes•FullyGuarantee•24YearsExperience•ExtraPoints•Repairs•InsuranceWorkAllAreas•New&UpgradeAntennaSystems•SeniorsDiscounts•House&StrataUnitsInsulation
Same Day Service
available
4257 8452 Shellharbour
4284 6587 Wollongong
Looking for
Timber Floors?
We’ve got it all!
Floating Floors
Solid pre finished timber floors
Direct Stick-on-concrete
4257 9838
Licenced floor installer & Owner operator66 Princes Hwy, Yallah
![Page 68: realestateworld.com.au - Illawarra Real Estate Publication, Issue 9 May 2013](https://reader035.fdocuments.in/reader035/viewer/2022081419/568c38b31a28ab02359fcabb/html5/thumbnails/68.jpg)