Grand Strand 0412

Grand Strand EditionGrandStrandHealthyLiving.com April 2012

FREE

Special Edition

Green LivingForest Bathing

Walk in the Woods

Bike and Build Cross Country Homebuilding

Blueberries and Jam

Blue Pearl Farm Music Jam

H E A L T H Y L I V I N G H E A L T H Y P L A N E T

feel good • live simply • laugh more

2 Grand Strand Edition

Personalized Service since 1993.

Welcome to North Myrtle Beach’s vitamin &herbal resource center. Here, you'll findeverything you need to get started on thepath to living a healthier life. We offer

gluten free, raw foods, bulk grains, snacks,aromatherapy items, essential oils,

health & beauty products and much more!

Stop by our healthy deli for made to orderorganic salads, sandwiches, soups, freshvegetable juices and organic fruit smoothies!

Our friendly staff is always ready to help youwith any questions you may have.

556 Highway. 17 North, North Myrtle Beach, SC 29582 (Gator Hole Shopping Plaza) 843-272-4436

11BAY1428NewLifeAd:Layout 1 3/5/12 2:11 PM Page 1

3April 2012GrandStrandHealthyLiving.com

how to advertise To advertise with Natural Awakenings or request a media kit, please contact us at 843-497-0390 or email [email protected]. Deadline for ads: the 10th of the month.

editorial submissionsEmail articles, news items and ideas to [email protected]. Deadline for editorial: the 10th of the month.

calendar submissionsEmail Calendar Events to [email protected] or fax to 803-753-8096. Deadline for calendar: the 10th of the month.

regional marketsAdvertise your products or services in multiple markets! Natural Awakenings Publishing Corp. is a growing franchised family of locally owned magazines serving communities since 1994. To place your ad in other markets, call 843-497-0390. For franchising opportunities, call 239-530-1377 or visit NaturalAwakeningsMag.com.

advertising & submissions

www.grandstrandhealthyliving.com

contents

11

5 newsbriefs

11 healthbriefs

13 globalbriefs

15 fitbody

22 consciouseating

26 wisewords

32 calendar

35 classifieds

37 resourceguide

13

natural awakenings is your guide to a healthier, more balanced life. In each issue, readers find cutting-edge information on natural health, nutrition, fitness, personal growth, green living, creative expression and the products and services that support a healthy lifestyle.

15

15 Forest bathing The Healing Power of a Walk in the Woods by Maggie Spilner

18 green home checklist Room-by-Room Steps We Can Take, Starting Right Now by Crissy Trask

22 waste not, want not 10 Ways to Reduce Costly Food Waste by Amber Lanier Nagle

24 bike and build by Judi Burton

26 eco-mind: creating the world we want A Conversation with Frances Moore Lappé by Linda Sechrist

28 a mouth Full oF blueberries an Ear Full of Jam

by Judi Burton

30 solar storm season by Dan Evans

18

28

30

22


© 2012 by Natural Awakenings. All rights reserved. Although some parts of this publication may be reproduced and reprinted, we require that prior permission be obtained in writing.

Natural Awakenings is a free publication distributed locally and is supported by our advertisers. It is available in selected stores, health and education centers, healing centers, public libraries and wher-ever free publications are generally seen. Please call to find a location near you or if you would like copies placed at your business.

We do not necessarily endorse the views expressed in the articles and advertisements, nor are we re-sponsible for the products and services advertised. We welcome your ideas, articles and feedback.

SUBSCRIPTIONSSubscriptions are available by sending $24

(for 12 issues) to the above address.

Natural Awakenings is printed on recycled newsprint with soy- based ink.

PublisherKeith Waller

Assistant EditorSara Gurgen

Design & ProductionKristina Parella

Stephen Gray-Blancett

Advertising SalesJudi Burton

To contact Natural AwakeningsGrand Strand Edition:

404 64th Ave. N.Myrtle Beach, SC 29572Phone: 843-497-0390

Fax: 803-753-8096

GSPublisher@naturalawakeningsmag.comwww.GrandStrandHealthyLiving.com

contact us

letterfrompublisherHappy Earth Day, and thank

God for spring!

All of us tree huggers, granola crunchers, yoga people, old hippies, natural wellness followers, hikers, and artists look forward to spring-time and Earth Day as children anticipate Christmas. It’s when we can forget about the news, politics, economy and jobs for a little while and revel in the beauty of the fresh new season. Even though we don’t suffer through terrible winters in South

Carolina, spring still seems to evoke that same power of renewal here that it does in the frozen North. This time of rebirth and revitalization is indeed a pre-scription for the health of mind, body and spirit; a time for getting outside to join in the celebration of life. Thereareazillionclinicalstudiesthatverifythehealthbenefitsthisseasonhas to offer—except for those with terrible-achooo-allergies—including the ef-fects of increased sunlight, exercise, social interaction, viewing wildlife, and the healthy support from spring and summer raw foods, herbs and aromatherapeutic scents. Here on the Coast, even a swim supports health; the Lowcountry swamp water tannins were historically known to heal skin problems, and we all know a little salt water and sun at the beach seem to bring out smiles and a healthy glow. Over the years in Natural Awakenings, we’ve published articles on so many of nature’s healing effects, and in this issue, our Fitbody department features a piece on Forest Bathing. It’s not skinny dipping or anything shocking; just regular walksinthewoodsthatreducestress,provideexerciseandfightdepression.Immunityisboosted,andthereareevencancer-fightingeffects.Carryaback-pack, and the spine-compressing exercise boosts testosterone, another anti-aging therapy. Sunshine boosts vitamin D, and we’re just now learning how important to health that has become. Avoid the need for sunscreen by keeping your sunbath-ing brief and mostly during morning or late afternoon hours. Dark-colored fruits helppreventsunburn,andmiraculouslyripenjustwhenwecanbenefitfromthem most. Lots of concerts, festivals and Earth Day celebrations are bursting forth this April, and they’re perfect for knocking off the winter cobwebs and renew-ing those connections with friends and nature. Personally, for my own renewal of spirit and health, I love being in the yard planting organic herbs and edible plants, as well as getting out on the water and walking through the woods with the dogs. Take your cues from us: Get outside and soak in nature’s energy, right now. Absorb the love and healing power of the Earth, and this Earth Day return that love with plans to take steps to protect Mother Nature.


newsbriefsMermade Opens in Murrells Inlet

Agustina Vidal has opened her new store, Mermade, at 4650 Hwy 17 Byp in Murrells Inlet next to Salt Water

Creek Cafe. Her store adheres to three main principles: all products are locally made, are crafted by hand with the utmost care, and are all affordable. Mermade, which is open from 10 am to 6 pm Tuesday through Saturday, offers jewelry, purses, toys, pet acces-sories, pottery, art and clothing—and everything is priced under $50. “Times are hard, and you want to buy things from people in the community, but they need to be a fair price that most people can pay,” says Vidal. Vidal is a human rights activist from Argentina, and her heart has always been with the community. While jobs in that profession aren’t common here on the Strand, her idea for the store makes that connection for her. Vidal will be hosting an arts and crafts festival April 6, from noon until 5 pm, in front of her shop, in conjunction with Fran’s Cloth-ing, Hannah B’s and How Bazaar Art Gallery. For more info, find Mermade at Facebook.com/Hand-madeByTheSea or call 843-957-2859. See ad, page 7.

The Great Cloth DiaperChange 2012 With Holistic Parent and Bella Baby

International Cloth Diaper Awareness Week, with the catchy title “Real Simple. Real Diapers,” starts April 16,

and serves as an opportunity for advocacy and education about the values of natural cloth diapers. In 2011, a Guinness World Record was set for the most cloth diapers changed simultaneously. There were 5,026 participantsat127locationsinfivecountries,andthepub-licity brought $5,167 in donations to the Real Diaper As-sociation. Holistic Parent and Bella Baby hope to participate in breaking that record in 2012 at the end of the special week. The mission of the Real Diaper Association is to devel-op an infrastructure and organization to support moms who prefer natural cloth diapers. Research has shown that cloth diapering has a substantial following around the world. Holistic Parent and Bella Baby invite you and your child to join them Saturday, April 21, at noon at Bella Baby, 7269 Hwy 707, Myrtle Beach, for the Guinness World Record Challenge. Participants will receive a gift. If you don’t have cloth diapers, there will be plenty for you to use. For more info and to RSVP, go to Facebook: Great Cloth Diaper Change Myrtle Beach.

Kids Yoga Camp

Looking for something different and interesting for your grade school kids to be doing this summer? Lyndsay Bahn

Trimble and Karley Lott of Secret Lotus Yoga & Healing Arts will be hosting a weeklong kids afternoon yoga camp for children ages 7-10 at Secret Lotus Yoga on 79th Ave N in Myrtle Beach. From June 18-22, from 1-4 pm, campers will learnfunyogaposturesforstrength,balance,poiseandflex-ibility. Taking a break from yoga, the kids will also participate in classes on the process of growing a tomato plant, arts and crafts, and nutrition. Preregistration is required and space is very limited. Cost is $125 per child. For more info and to register, contact Lyndsay Bahn Trimble at 843-333-2656 or [email protected].

Food Not Bombs Needs Land for an Edible Garden

Almost 900 people experienced homelessness last year in Horry County. Food Not Bombs is a grassroots move-

ment that believes instead of wars and killing, we should be focusing on feeding the hungry and eliminating homeless-ness. The Myrtle Beach group, an offshoot of the Occupy movement, started meeting in October 2011. In addition to boosting awareness of those who have been excluded from the economy, members wanted to do more for the com-munity. One of the protesters was feeding the hungry in her neighborhood and suggested they expand a program to feed more people. Since then, they have been using a private strip of land across the street from the Whither Swash Park near the Family Kingdom amusement park every Sunday to feed anyone who is hungry. Agustina Vidal, human rights activist and owner of Mermade in Murrells Inlet, is one of the members. She and herfriendsareworkingonfindingapieceoflandwherethey can grow food with the homeless, and help give them more of a role in producing the food they eat. “We want to provide a place where they can feel a sense of accomplish-ment, and be fed at the same time,” says Vidal. Street Reach, an emergency overnight shelter, offered the plot next to its location on 1005 Osceola St, near Mr. Joe White Avenue, but its charter as an overnight shelter cannot allow anyone to be on the property during the daytime, making it impossible for the homeless to tend the garden during the day. Food Not Bombs is asking Natural Awakenings readers if they have or know of a piece of ac-cessible land where the group, along with the homeless, can grow food without restrictions. “What we need is a big plot of land where people can just grow food, harvest it and


newsbriefseat without being harassed,” says Glen Duke, a member of Food Not Bombs. The sky is the limit as far as we are con-cerned.” To find out more about Food Not Bombs and the peti-tion to repeal city ordinance 2009-20 against feeding the homeless, visit ThePetitionSite.com/1/allow-food-not-bombs-myrtle-beach-to-feed-people. To offer a parcel of land for a community garden or to donate food, call Agustina Vidal at 843-957-2859 or Glen Duke at 843-839-5081.

New Farmers Market at the Market Common

The Market Common and Waccamaw Market Coopera-tive (WMC) will host the Deville Street Farmers Market

every Saturday from 8 am to 12 pm beginning May 12. Deville Street, in Market Common, is known as the location of the movie theater and Yoga in Common. The street will be closed off to cars and transformed into an open-air market with locally grown farmers, artisans and freshly caught seafood by 7 Seas Seafood in Murrells Inlet. The market is expected to expand as it continues into summer. Hatton Gravely, marketing manager for the Market Common, said: “We are very excited to bring a quality farmers’ market to the Market Common for our residents and shoppers. We have formed a great partnership with the WMC, and they will ensure all of the produce is locally grown.” Through the direct support of the Clemson Cooperative Extension Service, WMC has created a regional network of markets in Conway, Loris and North Myrtle Beach. The Dev-ille Street Farmers Market will be the fourth market in the network. The resulting structured market network ensures thatvirtuallyallcommunitiesinHorryCountybenefitfromaccess to fresh fruits and vegetables that farmers’ markets offer. For more info and farmers’ markets dates and times, visit WaccamawMarkets.org. See ad, page 20.

Earth Day Music Festival

On April 21, from 11 am to 6 pm, in the Grand Park at the Market Common, the Wellness Council of South

Carolina is holding its fourth annual Earth Day Music Festival.Whileinitsfifthyear,lastyear’soutdooreventwascancelled due to dangerous storms. The festival will have live music all day from great lo-cal bands, including Bullfrog, Finnegan Bell, Sai Collins, Soulful~I, Treehouse, Sideways Derby, and the Strike-O-Ma-tics. There will be a kids’ zone, many artisans, natural health professionals, charities, conservationists, and all-around Earth-loving people celebrating this beautiful planet that we

live on. For more info, contact Kristi Falk at 843-995-3199 or visit WellnesscouncilCSC.org. See ad, page 29.

Organic Fertilizers and All-Natural Pest Control for Your Lawn

Southlantic Water Systems of Myrtle Beach has a new Earth-friendly product in stock for your lawn this sum-

mer. For those of you who have kids and pets who enjoy the lawn quite a bit, Natureshield is a pest control and fertil-izer system that is organic based and 100 percent natural. It hooks up to your sprinkler system and broadcasts a blend of garlic, cinnamon, cedar and castor oils that synergize to make a safe, effective pest barrier. Natureshield effec-tively controls mosquitoes, roaches, ants, aphids, white flies,gnats,slugsandotherlandscapepests.Userscanmixorganic-based fertilizer in with the all-natural pest control and let the sprinklers do the work by feeding your lawn and garden essential nutrients, helping them grow strong and beautiful without using harsh chemicals that can pollute our precious groundwater. Southlantic Water Systems introduced this product last year; the product sold out immediately. This year, there is a much larger supply, so more homeowners and landscapers who want to stay natural and nontoxic in their gardening will be able to do so. For more info, contact Southlantic Water Systems, 908 Seaboard St, Myrtle Beach, at 843-626-9856. Visit SouthLan-tic.com and see ad, page 23.

Soaring Beyond Limitationswith Unity and David Hiller

Breakthroughtheartificialboundariesyouplaceonyourownsuccess.UnityChristChurchofferstwoprograms

that teach you how to change the paradigms that trap you in limiting patterns, preventing you from achieving and having what you’ve always dreamed. On Sunday, April 15, like-minded individuals, who can see that the way we think is a part of creating our life experiences and world events, will gather. Rev. David Hiller will be guest speaker at the lively 11 am Sunday service and will facilitate a “Shiftshop” from 1:30 to 4:30 pm. The topic of both the service and workshop is simply, Change Your Thinking and Change Your Life. The suggested donation is between$22and$33,butnoonewhocanbenefitwillbeturned away. Hiller’s powerful subliminal/auditory CDs will be available for sale. On Saturday, May 12, the Go For It! Ropes Course Chal-lenge takes place in Conway. Participants will take part in a physical and emotional test that will challenge their fears


and their preconceptions about what they are capable of achieving. The course, using balance, climbing and fear-testing feats that employ team support has a low elevation and high elevation route in the course and is operated by skilled staff. Hiller has a master’s degree in counseling and serves as an interfaith minister, spiritual counselor, Psych-K consultant, and healer. He has conducted healing and fear-release seminars for many years in churches, hospitals, colleges and mental health agencies, and has witnessed thousands of miracles. Hiller and his wife, Margaret, co-authored the popular New Thought book Dare to Dream – Healing Fears, Creating Miracles & Living Your Dreams.Unityislocatedat1270Surfside Industrial Pk Dr, Surfside Beach. For more info, contact Rev. David Hiller at 843-333-8260 or email [email protected] and visit DavidHillerMinistry.com. Contact Unity at 843-238-8516 and visit UnityMyrtleBeach.org. See ad, page 11.

Carolina Power Yoga’s Beach Yoga Is Back

Lovely spring weather is here, and Carolina Power Yoga’s Beach Yoga has started up again for the season in North Myrtle Beach. It is amazing to do Vinyasa

yoga on our beautiful beach, where our “ocean sounding” breath and the tran-quil sounds of the ocean are harmonized. CPY’s Beach Yoga is a community class. Please bring beach towel, water, sunglasses and donation, and be ready for an amazing experience doing what you love in nature and sharing it with others. Call CPY at 843-877-5839 for de-tails and beach location to meet. Find schedule, pictures and inspiration at Facebook.com/CarolinaPowerYoga. Visit the website at CarolinaPowerYoga.com.

Waccamaw Arts & Crafts Guild’sArt in the Park

On the weekend of April 14-15, Art in the Park will be at Chapin Park, 1400 N Kings Hwy, Myrtle Beach. On the Weekend of April 21-22, it will be at

Valor Park in Market Common, 1120 Farrow Pkwy, Myrtle Beach. There will be more than 60 artists from the East Coast and as far away as Tennessee, with about 20 of those artists from our local area. Typical art will include paintings, wood-working, photography, jewelry, fabric, glass, metal, pottery and stone. Admission is free, and the event is child friendly. For more info, contact JoAnne Utterback at 843-446-7471 or visit ArtsyP-arksy.com. See ad, page 10.

Spring Season at Springbank Eco Retreat

As Earth renews itself with the blossoming of spring, staff members at Spring-bank Retreat are looking to their celebration of 50 years of providing spiritual

renewal, creative arts, and a healing environment. The public is invited to come out to the center near Kingstree on Sunday, May 6, for a 50th anniversary party. From 1 to 5 pm, visitors can enjoy live music, song, great food, poetry, painting and an exhibit by local artists and other crafts persons. There is no charge. April programs at Springbank Retreat combine spiritual practices with artistic creativity. In the workshop Icon Painting as Prayer, participants will experience the deep prayer time of Lent through the writing of an icon of St. Michael the

archangel. They will learn basic tech-niques of iconography and spirituality of the icon. Art instructor Christopher Marie Wagner will help each person complete an icon using acrylics and gold leaf. No experience is necessary. The materials fee is $40, and the class is limited to 10 participants. Wagner restores stained-glass windows and is dedicated to the study of iconography in the Russian style. The Christian season of Easter will be observed in Easter Triduum: Easter Hope in a Time of Ecological Decline. The workshop will be led by the Rev. JimProfit,theexecutivedirectorofthe Ignatius Jesuit Centre in Ontario, Canada. The experience of Easter gives hope in a time of ecological decline. The workshop leader will ask the question, “Can we hear the cry of Jesus on the cross in the cry of Earth and experience the resurrection in the regenerative power of Earth?” This retreat includes Holy Thursday, Seder/Eucharistic liturgy, Good Friday, Way of the Cross, Holy Saturday, Great Easter


newsbriefs

Myrtle Beach (843)213-1393 www.BeachBabys.org

Beach Baby’s Doula and Wholistic Childbirth Services Inc.

Now offering comprehensive birth program in collaboration with March of Dimes, free to all families who qualify. Enroll before 20 weeks to receive services package.

All Professional Staff RN’s, Certified Doulas, Childbirth Educators, IBCLC and CLC Lactation Professionals and Trained Nannies

coverartist

namaste claudia tremblay

Radiating gentleness and tranquility, the watercolors of artist Claudia Tremblay are rendered in a subtle palette of soft hues andoftenreflectherfascinationwithwomen and children around the world. Tremblay left her home in Quebec, Canada, to work with a non-governmen-tal organization in Guatemala, where she planted medicinal gardens alongside the nativewomenthathadfledtheircountryduring its civil war and were returning home to start new communities. With no formal training in art, Tremblay was inspired to portray the strength and spirituality of these hard-working women of the Maya high-lands. “I had studied horticulture, and was sent to make gardens with these beautiful women in a hostile land,” she recalls. “In my free time, I tried day after day to capture the magic and melancholic depth of the Mayan people and their land.” After 13 years, Tremblay returned to Montreal, where she continues to create “artwork for the soul.” Her recent series of richly shaded yoga watercolors compellingly evokes a focused, sacred energy. “Love and sensibility are always what I wish to transmit through my paintings,” advises Tremblay. “Let’s all dream a little more!”

View the artist’s portfolio at ClaudiaTremblay.com.

Fire/Vigil, early Easter Sunday liturgy. Cerantha Corley will lead Awakening the Spirit Within: Learning to Play the Flute.ParticipantswilllearnhowplayingtheNativeAmerican-styleflutecanexpresstheirinnersong.Theywilllettheirsoulsspeakthroughflute-playingandexpressive painting. Corley is a writer and painter in addition to playing the Na-tiveAmericanflute. Planting Seeds of Hope: Growing Your Own Veggies will explore the current food system and look at ways to become more conscious of Earth’s sustainabil-ity through food choices we make. Rita Wienken will show participants how to build a 5- by 8-foot raised bed for growing their own food. Louise McCormick and Cindy Barkei will lead Healing Remedies: Self-Care. They will teach participants how to care for themselves through herbal medicine, aromatherapy, healing touch, nutrition, mindfulness techniques, and guided imagery. Participants will learn how to create herbal tinctures and aromatherapy combinations. McCormick is the cofounder and president of McCormick Green CenterforHolisticTherapiesandiscertifiedinherbalandaromatherapies.Barkeiisacertifiedhealingtouchpractitionerandwholisticnurse.Sheintegratescomplementary/alternative healing into her nursing practice. In Creative Beading, artist Melinda Crowe will show participants how to workwithnaturalstonebeadsandmetalstocreateafinishedneckpiecethatwillbecomeauniquetreasure.AgraduateoftheUniversityofGeorgiainfinearts, Crowe has worked in fabric design, weaving, metalworking, and jewelry design.Herartworkfeaturesnaturalfibers,stone,andbeadworkwithanorganicflair.


Enrich Your MIND Body and Soul at Enota Mountain Retreat, located on sixty wooded acres in the North Georgia Mountains and

surrounded by 750,000 acres of the Chattahoochee National Forest. All the delicate beauty of nature has been preserved with four breathtaking waterfalls, five bubbling streams, and two trout ponds. Enota’s entire property is certified organic

with a ten acre bio-dynamic garden and animal farm.

Full Service Meeting and Retreat FacilitiesHealthy Nourishing Meal Options • Cabins, Premium RV & Tent Sites

Open All Year • Offering Work Exchange Programs

Enota.com • 706-896-9966 • 800-990-88691000 Highway 180, Hiawassee, GA 30546

Family therapist Christie Derrick-Guess will lead “Like Changing Clothes”: Vitality in Aging. She paraphrases the Dalai Lama who says, “Aging is like changing clothes.” In this workshop, Derrick-Guess will help participants explore their resources for resilience and vitality as they age.In May, a 12-step workshop for men will blend the 12 steps of recovery with Native spirituality. Dates for the event can be found in Natural Awaken-ings’ Calendar section. Program fees include lodging and meals. For more info, contact Springbank Retreat for Eco-Spirituality and the Arts, 1345 Springbank Rd, Kingstree, or 843-382-9777 or SpringbankRetreat.org. See ad, page 27.

Art & Soul Gallery Expanded

Rita Siegal Levine, owner of Art & Soul, an artisan gallery in Myrtle Beach, announced the expansion of her art gal-

lery and gift boutique. The new art center, located at 5001 N Kings Hwy in the Rainbow Harbor Shopping Center, has doubled in size and has recently started offering art classes and will soon have a cafe. Art & Soul provides a venue where artists can gather to cultivate and grow their crafts. Classes will be offered in every medium, including oils, acrylics, glass painting, pastels, jewelry, watercolor, and even computer-generated

Photoshop art. Promoting local artisans is the center’s primary goal, and the classes, which started in March, are being taught by wonderfully talented artists. Art & Soul opened for business in November 2010, and sells a variety of original artwork, including handmade jewelry, paintings, glassware, and all kinds of “one-of-a-kind” items. For more info, call 843-839-2727 or visit ArtAndSoul-MyrtleBeach.com.

Green Drinks Grand Strand

Nearly four years ago, on Aug. 8, 2008, Natural Awak-enings brought the international Green Drinks party

to the Grand Strand and hosted gatherings of occasionally morethan60people,firstatTommyBahama’sintheMyrtleBeach Market Common and then at Renaissance Bistro in Myrtle Beach, where we settled into a core group to chat, enjoy wine and healthy snacks after work. We met many wonderful and interesting people, and added a program run by Bob Checkaneck from SCORE to offer business coach-ing with expert support. In 2009, Natural Awakenings also resurrected the original Green Drinks group in Columbia and partnered with the Sierra Club and Keep the Midlands Beautiful to keep the green happy hour going strong in the

newsbriefs


newsbriefs

INLET YOGA

breathe. empower. transform.

NOW OPEN!

www.inletyogastudio.com

637D Bellamy Ave. Murrells Inlet (843)655.6272

Art in the Park 2012Myrtle Beach, SC

Chapin Park1400 N. Kings Hwy.

April 14 & 15June 9 & 10

October 6 & 7November 3 & 4

Valor Park1120 Farrow Pkwy.

Market CommonApril 21 & 22

November 10 & 11

Our 40thYear

10 - 4Sat. & Sun.

Contact: JoAnne Utterback: 843-446-7471Downloadable Application available at www.artsyparksy.com

capital city.After so many years, Green Drinks Grand Strand is now on hiatus and looking for a fresh sponsor to carry on the role as host and planner. Are you into green and sustain-able living, conservation and nature? Do you enjoy time with friends and look for a chance to swap stories and conversationwithothersinyourfield?Areyoutheultimatesocialbutterflywholooksforanopportunitytogetpeopletogether to have fun? We are ready for a new start with a new crew. Natural Awakenings will provide advertising, the original logo art, sign and links to the Green Drinks Interna-tional organization, and any support you need to hold your firstevent. For more info email Keith Waller at [email protected].

Inlet Nutrition’sHealthy Breakfast Plan

Can wellness be delicious? Can a healthy breakfast include chocolate? Breakfast is the most important meal

of the day, and as such, Inlet Nutrition has developed a new good-breakfast program, which helps solve many problems caused by a poor breakfast diet, such as a high-carb break-fast or skipped breakfast.. Is your breakfast simply toast with jam and coffee with sugar? A bagel? Just coffee? Simple carbs are digested immediately and turn into sugar. Your body woke up and asked for vital nutrients and water, but you just gave it sugar. This raises the blood sugar level and forces your pan-creas to overproduce insulin. Insulin removes extra sugar from the blood and turns it into fat. As a result, blood sugar level drops, and now you are feeling hungry and weak as your brain lacks sugar. It’s a reason behind the unhealthy junk food cravings. To introduce this program, Inlet Nutrition offers a free breakfast to get your morning going and to introduce you

to the nutrition options that help cleanse the intestines, improve absorption of nutrients and maintain water balance during the day. For more info, contact Linda Sachetti at 843-424-9586 or email [email protected] to schedule a Grand Strand area meeting time and place for you. See ad page 25.

Carolina Power Yoga’sRYT 200-Hour Yoga Teacher Training

Foster your love of yoga to become a professional and passionate yoga instructor, or perhaps simply deepen

your practice and attain a strong yoga education. Whatever your intent, immerse yourself in this once-in-a-lifetime experience. At Carolina Power Yoga’s teacher training, you’ll receive expert instruction, encouraging support and motiva-tional inspiration. You’ll be challenged, grow, transform, and upon graduation, be empowered with a solid foundation of knowledge,skillsandconfidencetoenthusiasticallyteachyoga safely and mindfully. Carolina Power Yoga’s comprehensive Yoga Teacher Training is designed in accordance with the 200-hour requirementsforregistrationwithYogaAlliance.Uponsuc-cessfulcompletionofourprogram,youwillbeaCertifiedYoga Instructor and eligible to register with Yoga Alliance as aRYT.Attheendofthetraining,youwillbefullyqualifiedto teach Power Vinyasa yoga, as well as various levels of Hatha yoga, and interdisciplinary classes, including Slow Vinyasa, Yoga Fusion and Gentle yoga. You will learn the skills and tools to infuse technical knowledge into your teaching in a way that is simple yet profound. You’ll be en-couraged to strive toward your full potential through asana, meditation, practice teaching, and a solid foundational education of the history, philosophy and evolution of yoga. For more info and to register, visit CarolinaPowerYoga.com.


healthbriefs

Are Cell Phones Safe?Questions about how cell phones

might impact our health have sparkedsignificantcontroversy.TheWorld Health Organization International Agency for Research on Cancer (IARC) hasnowclassifiedradiofrequencyelec-tromagneticfieldsaspossiblycarcino-genic to humans, based on an increased risk for glioma, a malignant type of brain cancer associated with wireless phone use.

Caution was also urged in an article about cell phone safety published this past October in the journal Electromagnetic Biology and Medicine. It reported that cell phones that are switched on and carried in shirt or pants pockets can exceedUSFederalCommunicationsCommissionexposureguidelines,andalsothat adults and children absorb high levels of microwave radiation from the phones. According to the paper, children are at greater risk than adults, absorb-ing up to triple the amount of microwave radiation in their brain’s hypothalamus (which links the nervous and endocrine systems) and hippocampus (vital for memory and spatial navigation) compared to adults. Absorption into their eyes was also greater, and as much as 10 times higher in their bone marrow than adults’. TheIARCconcludesthatthesefindingscallforcellphonecertificationconsistent with the “as low as reasonably achievable” approach taken in setting standards for using radiological devices. “It is important that additional research be conducted into the long-term, heavy use of mobile phones,” says IARC Direc-tor Christopher Wild. “Pending the availability of such information, it is important to take pragmatic measures to reduce exposure [directly to the head], such as hands-free devices or texting.”

Additional resource: Epidemiologist Devra Davis, PhD, reports on this topic in Disconnect: The Truth About Cell Phone Radiation.

GREEN VEGGIES BOOST IMMUNITYResearchers reporting in the jour-

nal Cell have found another good reasontofillourplateswithplentyofgreen vegetables like bok choy and broccoli: Tiny chemical compounds found in these healthful greens interact with the immune cells of the gut, known as intraepithelial lymphocytes (IEL), by effectively protecting them and boosting their numbers. IELs, white blood cells that inhabit the lining of many body cavities and structures, are concentrated in the gas-trointestinal tract, where their primary purpose is to destroy target cells that are infected by pathogens. Because pathogens frequently enter the body via the gastrointestinal tract, a high IEL countbenefitsoverallhealth.

Source: Babraham Institute, Cambridge, UK.


Sweet Stuff Combats InfectionsHoney’s use as a medicine was described on Sumerian clay tablets dating back

4,000 years, and ancient Egyptians made ointments of the sticky substance to treat wounds. Now, contemporary scientists have shown that manuka honey, whichcomesfromNewZealand,couldbeanefficientwaytoclearchronicallyinfected wounds and help reverse bacterial resistance to antibiotics. ProfessorRoseCooper,oftheUniversityofWalesInstitute,Cardiff,intheUK,hasinvestigatedhowmanukahoneyinteractswithbacteriasuchasPseudomonas aeruginosa, Group A Streptococcus and methicillin-resistant Staphylococcus aureus. She discovered that the honey interfered with their growth,blockingtheformationofbiofilmsthatcanwalloffsuchbacteriafrom antibiotic remedies.

DIABETES LINKED TO DIRTY AIRHealth wise, the air we breathe is just

as important as the foods we eat, according to a recent report published in the journal Diabetes Care. The report isbasedononeofthefirstlarge-scale,population-based studies linking dia-betes prevalence with air pollution. Ac-cording to researchers from Children’s Hospital Boston, a strong, consistent correlation exists between adult diabetes and particulate air pollution, an associa-tion that persists after adjustment for other risk factors such as obesity and ethnicity. The relationship was seen even atexposurelevelsbelowthecurrentUSEnvironmental Protection Agency safety limit.


globalbriefsNews and resources to inspire concerned citizens to work together in building

a healthier, stronger society that benefits all.

Bug MuscleBiomimicry Presents a Solution for DroughtWith global temperatures continuing to rise and droughts expected to become

more severe, Australian Ed-ward Linacre has designed a beetle-inspired device called Airdrop that is capable of extracting water from even the driest desert air. His invention recently won the prestigious global James Dyson award. “Biomimicry is a powerful weapon in an engineer’s armory,” com-ments Dyson. Linacre, a graduate ofSwinburneUniversityofTechnology, in Melbourne,

wantedtosolvethedroughtproblemafflictingpartsofhiscountry.Thelackofrain has brought dry, damaged soil, dead crops and mounting debt for farmers. Rather than using complex, energy-intensive methods such as desalination or tapping into underground water sources, Airdrop’s source of water, the air, can be used anywhere in the world. The device delivers water to the roots of crops in dry areas by pushing air through a network of underground pipes and cooling it to the degree at which moisture condenses; then the water is pumped to the roots. Linacre was inspired by the Namib beetle, which survives in areas that receive just half an inch of rain per year by consuming the dew it collects on the hydrophilic skin of its back.

Find more info at Tinyurl.com/6ts34y5.

Whale WatchingOne Small Step for Man, One Giant Leap for WhalesGreenpeace Executive Director Philip Radford reports that the dis-credited practice of vote buying at the International Whaling Commis-sion has been ended. “Countries like Japan can no longer bribe poorer countries to support their pro-whal-ing stance. This means that whale conservationfinallyhasafightingchance.” TheUSdelegationsupporteda measure intended to increase transparency in membership fees after hearing from millions of whale lovers.InitiatedbytheUnitedKing-dom and backed by a number of countries, the proposal passed via a rare consensus among the 89 partici-pating countries. It is believed that payment of membership dues in cash allowed wealthy countries to purchase the votes of other nations. Dues for the commission must now be paid via bank transfer from government ac-counts.


globalbriefs

Global GardensNew Global Warming Planting MapThe color-coded map of planting zones on the back of seed packets is being updated by the USDepartmentofAgriculturetoreflectclimatechanges brought on by global warming. The newguide,lastupdatedin1990,reflects,forinstance, that the coldest day of the year isn’t as frigid as it used to be, so some plants and trees can now survive farther north. Nearly entire states, such as Ohio, Nebraska and Texas, are nowclassifiedinwarmerzones. The new guide uses better weather data and offers more interactive technology. Gardeners using the online version can enter theirZIPcodeandgettheexactaveragecoldesttemperature.Forthefirsttime,calculations include more detailed factors, such as prevailing winds, the presence of nearby bodies of water and other local topography. BostonUniversityBiologyProfessorRichardPrimackobserves,“Therearealot of things you can grow now that you couldn’t grow before. People don’t think offigsasacropyoucangrowintheBostonarea.Youcandoitnow.”Thechangescome too late to make this year’s seed packets, but they will be on next year’s, says George Ball, chairman and CEO of the W. Atlee Burpee seed company.

View the planting zones map at Tinyurl.com/7r5u267.

Better ThreadsRug Industry Tackles Child Labor InjusticeThenonprofitGoodWeaveorganizationworks to end child labor in the rug industry and provides educational opportunities for kids in weaving communities worldwide. The GoodWeave label is given solely to rug companies that only hire employees of legal working age. GoodWeave, offering the world’s only independent child labor-freecertificationforrugs,makesunan-nounced inspections of looms overseas to ensure that standards are upheld. Programs funded by GoodWeave-certifiedrugsaleshavehelpednearly10,000childreninNepalandIndiatoattend school instead of working on looms. An estimated 250,000 children are

still weaving today. “It’s widely documented that children are exploited to make all sorts of products in our global economy,” says Nina Smith,GoodWeaveUSAexecutivedirector.“But in the case of carpets, consumers can do something to put a stop to these inhumane practices.Bybuyingacertifiedrug,youcanchange a child’s life.”

Find participating local retailers by ZIP code at GoodWeave.org.

Find OutHallmarks of a Smart Green DevelopmentAnyone who has ever wondered whether a new com-munity de-velopment is environmen-tally friendly and should be supported will appre-ciate the hands-on introduction in A Citizen’s Guide to LEED for Neighbor-hood Development, published by the National Resources Defense Council. NRDC experts developed the guide to help promote more widespread adop-tion of sustainable practices and create more inclusive, healthy and environ-mentally sound places.

Download the guide at Tinyurl.com/4xuuxsz.

Pocket CalculatorNew Gadget Measures a Family’s Eco-FootprintsA brand-new online environ-mental tool from Low Impact Living, the Impact Calcula-tor, measures the many footprints of a household’s lifestyle. With it, families can assess theirspecificcar-bon, energy, water, trash, wastewater and stormwater-runoff amounts. Then, by entering the ZIP code and home size, it encapsulates in one number the overall environmen-tal footprint compared with a typical home in the region, suggests green home and lifestyle projects and saves aprofile,alongwithprojectnotes,forfuture reference.

To use the calculator, visit Tinyurl.com/59ksp3.


FOREST BATHINGThe Healing Power of a Walk in the Woods

by maggie spilner

fitbody

“Nature doesn’t bang any drums when she bursts forthintoflowers,nor

play any dirges when the trees let go of their leaves in the fall. But when we approach her in the right spirit, she has many secrets to share. If you haven’t heard nature whispering to you lately, now is a good time to give her the opportunity.”~ Osho, in Osho Zen Taro: the Transcendental Game of Zen

As we all innately know, spend-ing time in nature is good for our body, mind and spirit. It’s why we’re attractedtogreenplaces,flowers,lakes, fresh air and sunshine. Taking a nature walk—affording plenty of fresh air and exercise in a quiet setting—has traditionally been prescribed for good health. That raises a question: How muchnaturalhealingarewesacrific-ing when we spend most of our days indoors? In Japan, a group of medical researchersandgovernment-affiliated

forest organizations support the creation of forest therapy centers, where people enjoy the trails and guided walks and also receive free medical checkups under the trees. Since 1984, they have beenstudyingthehealthbenefitsofwalking in the woods, termed shinrin-yoku, or forest bathing. There are now morethan30suchofficiallydesignatedsites. In related studies, scientists from Japan’s Nippon Medical School and ChibaUniversitytrackedpositivephysiological changes in individuals walking in the woods compared with city walkers. Early results were pub-lished in the International Journal of Immunopathology and Pharmacology, European Journal of Applied Physiol-ogy and Journal of Biological Regula-tors and Homeostatic Agents. Forest walkers showed:

n Lower concentrations of salivary cor-tisol, known as the stress hormone

n Lower blood pressure and heart rate n Reduction of adrenaline and

noradrenalin, also stress-related hormones

Make the ConnectionJoin the online Natural Awakenings national directory, filled with natural-living business listings from around the country.

REGISTER for your FREE business listing. It’s easy.

SEARCH for hundreds of green and healthy-living companies with products and services good for people and the planet.

FIND local Natural Awakenings magazines publishing in communities across America.

Follow your path to well-being…Visit NaturalAwakeningsMag.com/directory to sign up for your FREE listing and to find the resources you need for a truly good life.


n Increase in immunity-boosting natu-ral killer (NK) cell activity, and the numbers of NK cells and anti-cancer proteins known to combat cancer

Newest FindingsThe researchers theorized that or-ganic compounds called phytoncides, produced by trees and other plants as a protection from disease, insects and fungus,werealsoproducingbeneficialnatural killer cells in people in the for-ests. In a study that exposed participants to phytoncides via aromatic oils fed throughahumidifierinahotelroom,the researchers found similar increases in NK levels. A 2011 study by Nippon Medical School’s department of hygiene and public health showed that the resulting increase in NK cells lasted for 30 days. They concluded that a monthly walk in the woods could help people maintain a higher level of protective NK activity and perhaps even have a preventive ef-fect on cancer generation and progres-sion. Qing Li, PhD, the assistant profes-sor leading several of these studies, suggests that dense forest areas are more effective at boosting immunity than city parks and gardens. He also reports that phytoncide concentrations increase during summer growing sea-sons and decrease during the winter, although they are still present in tree trunks even when the trees are decidu-ous.

Li further suggests that walks in the woods should be conducted at a leisurely pace. For stress reduction, he suggests four hours of walking, covering a generous 3 miles, or 2 hours walking about 1.5 miles. For cancer-protecting effects, he suggests regularly spending three days and two nights in a forested area. “Carry water and drink when you’re thirsty,” says Li. “Find a place that pleases you and sit and enjoy the scenery.” He adds that relaxing in a hot tub or spa counts as a perfect end to a day of forest bathing. Li foresees a future in which patients diagnosed with high blood pressure or hypertension may receive a forest bathing prescription, but counsels that shinrin-yoku is consid-ered preventive, rather than thera-peutic, medicine.

Enhancing Nature’s PowerEcopsychologist Michael Cohen, PhD, executive director of Project NatureConnect, adds, “If you want to increase the healing effect of being in nature, it helps to change the way you think and feel about connect-ing with it.” He has students repeat the word “unity” as they encounter natural attractions—be it a tree, bird, brook or breeze—until they feel that they are part of nature, not separate… part of the healing wisdom of the planet. More, he states, “Sharing helps solidify the experience and opens you to greater personal healing.”

Maggie Spilner, author of Prevention’s Complete Book of Walking and Walk Your Way Through Menopause, leads walking vacations for her company, Walk For All Seasons.

For more information about advertising and how you can participate, call 843-497-0390

The Latest Great Tips and Technologies for Aging Beautifully

Experience Life at its Best

WOMEN’S WELLNESSComing in May

Birds are indicators of

the environment. If they

are in trouble, we know

we’ll soon be in trouble.

~Roger Tory Peterson


For information about how to publish Natural Awakenings in your community, call

239-530-1377NaturalAwakeningsMag.com

• Low Investment

• Work from Home

• Great Support Team

• Marketing Tools

• Meaningful New Career

• Birmingham,AL• Huntsville,AL• Mobile/Baldwin,AL• LittleRock/ HotSprings,AR• Phoenix,AZ• Tucson,AZ• EastBayArea,CA• LosAngeles,CA• SanDiego,CA*• SantaBarbara/ Ventura,CA• Denver/Boulder,CO• Hartford,CT• FairfieldCounty,CT• NewHaven/ Middlesex,CT• Daytona/Volusia/ Flagler,FL• NWFLEmeraldCoast• Ft.Lauderdale,FL• Jacksonville/ St.Augustine,FL• Melbourne/ VeroBeach,FL• Miami&FloridaKeys• Naples/Ft.Myers,FL• NorthCentralFL*• Orlando,FL• PalmBeach,FL• PeaceRiver,FL• Sarasota,FL• Tallahassee,FL• Tampa/ St.Petersburg,FL• Florida’sTreasure Coast• Atlanta,GA• WesternNC/ NorthernGA• ChicagoNorth Shore,IL• Indianapolis,IN• Louisville-Metro,KY• Lafayette,LA• NewOrleans,LA• MiddlesexCo.,MA• AnnArbor,MI• GrandRapids,MI• EastMichigan• Lansing,MI• WayneCounty,MI

• Asheville,NC*• Charlotte,NC• Raleigh/Durham/ ChapelHill,NC• Monmouth/ Ocean,NJ• NorthNJ• NorthCentralNJ• Somerset/Middlesex Counties,NJ• SouthNJ• SantaFe/ Albuquerque,NM*• LasVegas,NV• LongIsland,NY• Manhattan,NY• Rockland/ OrangeCounties,NY• Westchester/ PutnamCo’s.,NY• Cincinnati,OH*• OklahomaCity,OK• Portland,OR• Bucks/Montgomery

Counties,PA*• Harrisburg,PA• LehighValley,PA• NortheasternPA*• RhodeIsland• Charleston,SC• Columbia,SC*• GrandStrand,SC• Greenville,SC• Chattanooga,TN• Knoxville,TN• Memphis,TN• Nashville,TN• Austin,TX• Dallas,TX• Houston,TX• NorthTexas• SanAntonio,TX• Tyler/Longview,TX• Richmond,VA• SouthwesternVA*• Seattle,WA• Madison,WI• Milwaukee,WI• PuertoRico

*Existingmagazinesforsale

Phenomenal Monthly Circulation Growth Since 1994. Now with 3.6 Million Monthly Readers in:

turn your passion into a business...

own a Natural Awakenings magazine!as a Natural Awakenings publisher, you can enjoy learning about healthy and joyous living while working from your home and earn a good income doing something you love!

Your magazine will help thousands of readers to make positive changes in their lives, while promoting local practitioners and providers of natural, earth-friendly lifestyles. You will be creating a healthier community while building your own financial security.

no publishing experience is necessary. You’ll work for yourself but not by yourself. we offer a complete training and support system that allows you to successfully publish your own magazine.

be part of a dynamic franchised publishing network that is helping to transform the

way we live and care for ourselves. now available in spanish as well.

to determine if owning a Natural Awakenings is right

for you and your target community, call us for a

free consultation at 239-530-1377.


GREEN HOME CHECKLISTRoom-by-Room Steps We Can Take, Starting Right Now

by crissy trask

Green living is being embraced by more folks than ever, in ways both large and small,

giving the Earth some much-needed kindness. If you’re interested in some good ideas that fall between a total home solar installation and basic recycling—with many delivering big impacts—check out Natural Awaken-ings’ room-by-room green checklist. You’llfindinspired,practicalchangesthat are doable starting right now.

KitchenThe kitchen can be a hot spot for waste. Eileen Green, with EcoEvalu-ator.com, says that reducing waste,

conserving water and increas-ingenergyefficiencyareallimportant considerations within an environmentally

friendly kitchen.

4 Eat up food. Each year, a typical household discards an estimated 474 pounds of food waste, according to UniversityofArizonaresearch—atlarge economic and environmental cost. Buying more fresh food than we can eat before the expiration date is up and allowing leftovers to expire in the fridge are culprits. “Drawing up menus and avoiding buying on impulse can help,” advises Green. Compost food scraps at home or sign up for curbside composting, if it’s offered locally. Disposing of food ingarbagedisposalsorlandfillsisnotenvironmentally sound.

4 Dispense with disposables. Replace disposable paper and plastic products with durable, lasting alternatives: cloth

napkins instead of paper; dishwasher-safe serving

ware instead of single-use paper or plastic; glass or recycled food storage containers in place of throwaway plas-ticbagsandwrap;andnaturalfiberdishcloths to replace paper towels and plastic sponges.

4 Clean naturally. Chemical pow-erhouses have become the norm in household cleaning products, but they are not essential. Non-toxic cleaners are up to the task, from cleaning a sink to an oven.

4 Shop for the Energy Star logo. Appliances bearing the Energy Star logo are up to 50 percent more energy efficientthanstandardones.Thistrans-latestosignificantsavingsinannualoperating costs.

4 Filter water with less waste. Bottled water is expensive and waste-ful.Instead,purchaseahome-filteringsystem that uses recycled or reusable filters.Ontheroad,carrytastyfilteredwater in a reusable glass bottle.

4 Conserve water. Run dishwashers onlywhenfullyloadedandfillthesinkwith water, rather than running it down thedrain,whenwashingbyhand.Usewater only to wet and rinse; otherwise turn it off.

4 Phase out non-stick skillets.Tefloncoatings can leach toxins when dam-aged or overheated. Play it safe and begin assembling a set of cookware that includes properly seasoned cast iron, which is naturally non-stick.

4 Avoid cheap reusable shopping bags. Flimsy reusable bags end up as trash within a few months under nor-mal use. Buy a set of high-quality reus-able bags that will give years of use.

Bedrooms“Most people spend more time in the

bedroom than in any other room of the house,” remarks Huffington


Post Eco Etiquette columnist Jennifer Grayson. “So it’s important to focus on making bedrooms as green and healthy as possible.” She advocates paying special attention to sleepwear, bedding and furniture people sleep on.

4 Start with a good foundation. Box springs can be constructed of ply-wood or particleboard, which com-monly contain formaldehyde, classi-fiedasaprobablehumancarcinogenbytheUSEnvironmentalProtectionAgency (EPA) and a toxic air contami-nant by the state of California. Choose thosethathavebeencertifiedasformaldehyde-free or with low emis-sions. A platform bed made of Forest StewardshipCouncil-certifiedwood,sourced from sustainably managed forests, is a healthy alternative.

4 Don’t sleep on a cloud of chemicals. “If your face is pressed up against a conventional mattress for seven hours a night, then you’re going to be breath-ing in whatever chemicals are off-gas-sing from that mattress for seven hours a night,” warns Grayson. Mattresses are commonly treated withfire-retardantchemicalstocom-plywithUSConsumerProductSafetyCommission rules. To avoid toxic chemicals like the hydrocarbon tolu-ene, emitted from mattresses stuffed with polyurethane foam, instead look for untreated, wool-covered mattresses (woolisanaturalfireretardant)filledwith natural latex or containing a spring system wrapped with organic cotton batting. Non-organic cotton production relies on lots of hazardous synthetic chemicals in its production. Organic cotton, linen and wool bedding are saferbets,especiallywhencertifiedtomeet strict environmental standards.

4 Block the afternoon sun. During the day, shut off air-conditioning vents inside bedrooms and block the after-noon sun with interior or exterior solar shades. By day’s end, even in warm

climates, bedrooms should be cool enough for sleeping with the addition of a slight breeze from an open win-doworaslow-runningfloororceilingfan.

4 Go wireless. It’s impossible to com-pletely avoid electromagnetic radiation from today’s technologies, so lower exposure in the bedroom by removing electronic devices and placing electri-calitemsatleastfivefeetawayfromthebed.

4 Forget fabric softeners. Most fabric softeners contain highly toxic chemicals that latch onto sheets and can be inhaled or absorbed directly into the bloodstream through skin. Instead, add a quarter-cup of bak-ing soda to the wash cycle to soften sheets and other laundry.

4 Leave the lights off. Motion-detect-ing nightlights save energy while al-lowing safe passage in the wee hours.

Laundry RoomInatypicalUShome,thewashingmachine accounts for 21 percent of home water use and combined, the washer and dryer comprise 5 to 8 percent of home energy demands. Diane MacEachern, founder of Big-GreenPurse.com and author of Big Green Purse: Use Your Spending Power to Create a Cleaner, Greener World, explains that a good way to conserve key resources is to use these appliances less—reducing the number of loads and drying items on outdoor clotheslines or indoor racks. MacEachern says, “You can prob-ably wash things like sweatshirts and blue jeans less frequently without

much consequence, and a clothesline requires no energy other than the sun.” Also, make sure that whatever goes into the washer or dryer with clothes is non-toxic, or else you’ll be wearing toxic chemical residues next to your skin all day, cautions MacEachern.

4 Select cold water. On average, only 10 percent of the energy used by a clothes washer runs the machine; the other 90 percent goes to heat the water. The typical American household does about 400 loads of laundry each year, resulting in much energy squan-dered on hot water. With the exception of laundering greasy spots or stubborn stains, routinely wash in cold water, using a cold-water eco-detergent.

4 Install a clothesline. Running a dryer for just 40 minutes can use the energy equivalentofa15-watt,compactfluo-rescent bulb lit for a week. Stretch out a line and hang clothes outside to dry in the fresh air to save about $100 a year on electric bills. The sun imparts a disinfectantbenefitasabonus.

4 Replace an old machine. A washer or dryer that is older than 10 years has hidden costs. EnergyStar.gov notes that an older machine uses more energy and can cost from 10 to 75 percent more tooperatethananew,high-efficiencyappliance.

4 Choose eco-friendly laundry products. Conventional laundry soaps contain chemicals that can be prob-lematic for us and wreak havoc on marine ecosystems. Look for cold-water brands that are fragrance- and phosphate-free.

4 Switch to concentrates. Concentrated detergents translate to less energy used in shipping, less waste and more value.

4 Stop static cling without dryer sheets. Never over-dry clothes and al-waysdrynaturalfibersseparatelyfromsynthetics to prevent static cling.

Find more big ideas in Natural Awakenings’ article,

“Spring Green Rehab,” at Tinyurl.com/3nhan6s.


BathroomThe smallest room in the house is a disproportionately large contributor to household environmental impacts. In an average non-conservation-minded American home, 38,000 gallons of water annually go down the drains and toilet. “Along with that water,” says MacEachern, “You’ll be washing lots of personal care and cleaning products down the drain, as well, where they could get into local natural water sup-pliesandmakelifedifficultforbirds,frogsandfish.” Sara Snow, television host and author of Sara Snow’s Fresh Living: The Essential Room-by-Room Guide to a Greener, Healthier Family and Home, cautions against personal skin care products with questionable chemical ingredients. “A good percentage of them are being absorbed right into our bloodstream, so focus on ingredients that do no harm; ones that help our bodies instead, such as nourishing and healing botanicals.”

4 Slow the flow. Ultra-efficientshow-erheads use as little as 1 gallon per minute (gpm); aerated types that mix air into the water stream to enhance pressure provide a good soak and rinse using less than half the water than someotherlow-flowshowerheads.Atthesink,aeratorsshouldflowbetween0.5 and 1 gpm—plenty of pressure for brushing teeth and washing hands.

4 Flush responsibly. According to the

EPA, the toilet alone can use 27 per-cent of household water. Replace older toilets (pre-1994) with new, higher efficiencymodelsforsavingsoftwotosixgallonsperflush.

4 Heat water wisely. A tankless water heater supplies instantaneous hot water only as needed. Or, install a timer on a traditional water heater to cut warming time to a few hours a day at most.

4 Shun a plastic shower curtain. Polyvinyl chloride (PVC) has been called “the poison plastic” for its highly toxic lifecycle, which includes the release of dioxins into the air and water. These toxic chemicals persist in ecosystems and can cause cancer. PVC shower curtains are also a short-life product that cannot be re-cycled, so switch to a PVC-free alterna-tive. Organic hemp is the eco-shower curtain gold standard.

4 Ban antibacterial products. Triclosan is a popular antibacte-rial agent found in many household cleaners, hand soaps, cosmetics and even toothpaste. It’s also a registered pesticide and probable human car-cinogen that’s showing up in the en-vironment and children’s urine. The Mayo Clinic suggests that triclosan may contribute to the development of antibiotic-resistant germs and harm the immune system, making us more susceptible to bacteria.

4 Install a shower filter that re-

moves chlorine. Chlorine, which is increasingly being linked to some cancers, is used by many municipali-ties to disinfect water supplies. People absorb more chlorine through the skin and by inhaling chlorine vapors when bathing and showering than from drinking it.

4 Use recycled and unbleached paper products.Usingrecycledbathtissue helps close the recycling loop on all the paper we dutifully recycle atthecurb.Unbleachedvarietieskeep chlorine byproducts like dioxins out of the environment.

4 Remove bad odors instead of covering them up. InaUniversityofCalifornia study, chemical air fresh-eners were found to have higher concentrations of polluting volatile organic compounds (VOC) than any other household cleaning product. Long-term exposure to some VOCs have been linked with adverse health effects.

This Natural Awakenings checklist sug-gests steps that are possible in making any home healthier, safer and more enjoyable. Start checking off items today and begin shrinking the family’s ecological footprint right away.

Crissy Trask is the founder of Green Matters.com and author of the bestsell-er, It’s Easy Being Green: A Handbook for Earth-Friendly Living. Follow her at Twitter.com/greenmatters.


Urban composting solution BokashiComposting.com

Toxins in consumer products Toxipedia.org

Eco-water filters Brita.com/your-brita/recycle-your-filter BritishBerkefeld.com TerraFlo.com/recycle.htm

Textile certifications Tinyurl.com/7wd9vlr

GO-TO RESOURCESPVC fact sheet MyHouseIsYourHouse.org/pvcfacts.html

Radiation exposure facts epa.gov/radtown/index.html

Safe cosmetics and personal care products ewg.org/skindeep

choose your planet-friendly version:

• In print on recycled paper with soy-based ink

• E-zine on your computer

FoR youR FReee-SubSCRiPtioN

to the Columbia Edition, visit

HealthyLivingColumbia.com,

to the Grand Strand Edition, visit

GrandStrandHealthyLiving.com.

Natural Awakenings

e-zine is now available in your

inbox


Call today for a FREE Consultation 843-957-6926 MaximizedMind.com [email protected]

YOU HAVE THE POWER ALL YOU NEED IS THE

Maximized Mind Mike Oglesbee Advanced Hypnotist

Smoking Weight loss Stress Self-esteem Migraines

and much more

90% of your

Brain90%

of your BrainWHO?

The 90% you keep ignoring,

NOW OPENTHE DOOR!!!

Who‛sThere?

KNOCK!!KNOCK!!

TapTap

consciouseating

Waste Not, Want Not10 Ways to Reduce Costly Food Waste

by amber lanier nagle

Most of us regularly discard food items—week-old cooked pasta, stale cereal, half a loaf of moldy bread, suspicious leftovers and other foods we fail to eat before they perish. But consider that the Natural Resources

DefenseCouncilreportsthat40percentofallediblefoodproductsintheUnitedStates—comprising 34 million tons—is wasted each year. Food waste occurs at all levels of the supply chain. Farm fresh fruits and veg-etables are often left unharvested because their appearance does not meet aes-thetic standards imposed by grocery stores, and pieces bruised or marred during shipping and handling are routinely discarded. Many restaurants serve supersized portions of food, even though much of it is left on plates when customers leave, and thrown into dumpsters. Plus, many shoppers buy more than they need. With a little care and a more enlightened system, we could help prevent much ofthewasteandbetteraddresshungerintheUnitedStates.Researchersestimatethat Americans could feed 25 million people if we collectively reduced our com-mercial and consumer food waste by just 20 percent. From an environmental standpoint, wasted food equals wasted water, energy and chemicals. Producing, packaging and transporting these food items gener-ate pollution—all for nothing: a zero percent return on our dollars. Food waste

represents the single largest component of all municipal solid waste now going intolandfills.Althoughitisbiodegrad-able when properly exposed to sun-light, air and moisture, decomposing foodreleasessignificantamountsofmethane, a heat-trapping greenhouse gas that is more than 20 times more potent than carbon dioxide. Ten tips make it possible to reduce our “food print”. Shop smarter. Preplan meals for the week, including non-cooking days and leftover days. Make a shopping list and stick to it after inventorying the pantry, fridge and freezer. Buy produce in smaller quantities to use within a few days. Because we tend to overbuy when we’re hungry, don’t walk the aisles with a growling stomach. Organize the refrigerator. Place leftovers at eye level in the fridge, so they are front-and-center anytime someone opens it. When stowing groceries, slide older items to the front. Pay attention to use-by dates and un-derstand that food is good for several days beyond a sell-by date. Freeze foods. Many food items will last for months in the freezer in appropriate storage bags and contain-ers. Share surplus food. For larger dishes such as casseroles and crockpot meals, invite a friend over for supper, deliver a plate to an elderly neighbor or pack leftovers to share with co-workers. Donate extra nonperishable or unspoiled food items to a local soup kitchen, food bank or pantry or home-less shelter. Store food properly. To maximize food’s edible life, set the fridge be-


tween 35 and 38 degrees Fahrenheit and arrange containers so that air cir-culates around items; the coldest areas are near the back and bottom of the unit. For fruits and vegetables stored in plastic bags or designated bins or containers, squeeze out air and close tightly to reduce the damaging effects of exposure to oxygen. Buy ugly fruits and veggies. Grocery stores and markets throw out a substantial volume of vegetables and fruits because their size, shape or color is deemed less than ideal. Purchase produce with cosmetic blemishes to save perfectly good, overlooked food from being discarded as waste. Use soft fruits and wilted vegeta-bles. Soft, overripe fruits can be con-verted to jellies, jams, pies, cobblers, milkshakes and smoothies. Wilted carrots, limp celery, soft tomatoes and droopy broccoli can be chopped up and blended into soups, stews, juices and vegetable stocks. Dish up smaller portions. Smaller portions are healthier and allow left-overs for another meal. Take home a doggie bag. Only about half of restaurant diners take leftovershome.Asktohaveunfinishedfood boxed in a recyclable container, and then enjoy it for lunch or dinner within two days. Compost routinely. If, despite daily best efforts, food waste still occurs, recycle it with meal prepa-ration scraps into a nutrient-rich soil amendment. Create an outdoor compost heap, or compost cooked and uncooked meats, food scraps and small bones quickly and without odor in an indoor bokashi bin. “Earth Day—April 22nd—serves as a reminder that each of us must exercise personal responsibility to think globally and act locally as en-vironmental stewards of Earth,” says Kathleen Rogers, president of Earth Day Network. “Reducing food waste is another way of being part of the solu-tion.”

Amber Lanier Nagle is a freelance writer specializing in how-to articles pertaining to Southern culture, healthy living and the environment.

7611 N. Kings Hwy., Myrtle Beach, SC 843-448-0011 Bay-Naturals.com

helping people to live healthier lives since 1993.Welcome to Myrtle Beach's "Original" healthy market where you'llfind everything you need to get you and your family on the path tohealthier living. We offer a large selection of all-natural foods,

nutritional supplements, fresh local produce, and a knowledgeableand friendly staff who are always here to help.

Hungry? Grab a snack or a meal from our healthy kitchen, servinghomemade sandwiches, soups, salads & smoothies made fresh daily.Come by or shop with us online and start living healthier today.

11BAY1430HlfPgBN:Layout 1 1/11/12 4:39 PM Page 1


“It is more mentally exhausting than physical,” says BrittanySimmerman,first-yearlawschoolstudentatIndianaUniversity.Sheisoneoffourrouteleaders

in charge of 30 young adults between the ages of 18-25 who will each raise $4,500 for Bike and Build, an organi-zation whose members bicycle across the country to raise money and build houses for an array of affordable housing

associations. “We bike about 75 to 80 miles a day for 80 days, 4,109 miles, from Charleston to the shore of Santa Cruz, CA. No matter how good of a shape you are in, you are expending so much energy and so many calories, you arereallypushingtheline.Thefirstweekandahalfisveryphysically demanding. After that you get into a groove. The hardest part is getting done with one day, going to sleep, and getting up to do the next.”

Marc Bush, the former leader of the Habitat Bicycle Chal-lenge, founded Bike and Build in Pennsylvania 10 years ago. Bush believes that this type of community work helps

Bike and Build

to empower and raise awareness for the growing situation in unaffordable housing. According to the National Coalition for the Homeless, in 2012, 3.5 million people will experi-ence homelessness: 23 percent will be children on any given night, and at least 100,000 will be veterans. “So far, we have donated more than 3 million dollars; built for more than 100,000 hours; pedaled over 5 million miles; and en-

gaged more than 1,500 young adults in spreading the word about the affordable housing crisis in America.”

The South Carolina trip will have the most build days in history. They will stop and build for 18 days in between tra-versing the country. Simmerman is excited and a little proud about this. “This route was one of my two top picks because I’m from Indiana and have done a Northern route, but not a Southern, and the South is so beautiful!”

The riders will leave Charleston May 24 and bike through 12 states. They will journey across the country, staying in

by Judi burton


Linda SacchettiPersonal Wellness Coach

Inlet NutritionFast Food for Smart People

FREE METABOLISM TEST843.651.9350 or [email protected]

Business Opportunity: www.excitingbizop.com

churches, gymna-siums and in the homes of some good-hearted folks, and help build houses along the way. The hosts are repaid by a donation made in their name to one of the grants that Bike and Build is sponsor-ing. They will raise $135,000 before they leave, but will always be taking on more donations as they go. A donor can track a particular rider online to see how he or she is doing with fundraising, building and distance covered. Everyone has a different way of gathering donations. For a lot of riders, it is simply writing letters to old friends and relatives, but some people get very creative and help neighbors teach their kids how to ride their bikes safely, or ride around the mall parking lot with a helmet laid out for cash donations. Some riders have even shaved their heads for the money. What-ever it is they do, they must come up with the money before the deadline. The donations are used throughout the trip at building sites, and the cyclers actually get a say in where their money goes.

For handling the haul of sup-plies, a large van will carry their stuff for them on their journey all through to the end. And then many of the families will

meettheridersatthefinishlineinSantaCruz.Oncetheyreachthefinaldestination,theridersarelefttotheirowndevices to get back home. Some even turn around and ride the whole distance back, if you can believe it.

Thetripoffersexcellentbenefitsforstudentswhowantanimpressive resume or an extra bonus on a graduate school application. “A lot of people get very interested when you tell them about it. They like to hear the story, which in turn, builds awareness,” says Simmerman, happily.

To learn more about Bike and Build or to donate, visit Bike-AndBuild.org.


wisewords

Eco-Mind: Creating the World We Want

A Conversation with Frances Moore Lappé

by linda sechrist

Frances Moore Lappé, author of 18 books

including Diet for a Small Planet, is the co-founder of Food First: The Institute for Food and Development Policy, and Small Planet Institute. She also serves on the board of advisers of Grass-roots Interna-tional. In her most recent release, EcoMind: Chang-ing the Way We Think, to Create the World We Want, Lappé explores the latest in climate studies, an-

thropology and neuroscience. She aims to dismantle the seven widely held messages, or thought traps, that undermine our re-sponses to current eco-crises.

How can civi-lization think more like an eco-system to better handle en-vironmental challenges? Ecology is the science of rela-tionships among

organisms and their environment. Seeing life through an ecological lens

allows us to see the world and our place in it without managing quanti-ties of limited things. The most stun-ning implication of this way of seeing is its endless possibilities, as we learn to align with the laws of nature. With an “eco-mind,” we see that ours is not afinished,fixedworld,butratheranevolving and relational world. Through an ecological worldview, we realize that everything, including ourselves, is co-created, moment-to-moment, in relation to all else. Separateness is anillusionandnotionsof“fixed”or“finished”arefanciful. With an eco-mind, we can move fromfixingsomethingoutsideofour-selves to realigning our relationships within our ecological home. Making such leaps of thought can uplift us from disempowerment and despair to empowerment and hope.

How are our culture’s current stories about the causes of environmental crises disempowering us?Current metaphors pointing to such causes of environmental crises as “insatiable consumers” and this “age ofirresponsibility”fixattentiononourcharacter failings. They make us feel blameworthy and incite feelings of guilt and fear. Fear doesn’t motivate humans to be more engaged and giv-ing; rather, it too often has the op-posite effect, and leads us to objectify


and dismiss the “other,” even if the other is nature. Metaphors of contemporary envi-ronmentalism, such as “power down” and “we’ve hit the limits,” keep us locked in quantitative thinking. They don’t encourage us to see the underly-ing patterns of waste and destruction. They also fail to offer emotionally compelling, alternative ways of seeing current challenges and their rich, posi-tive possibilities. People need to see a new path, a way ahead, in order to leave the old.

Which of your seven “thought traps” do you see as most significant?I encourage all of us to examine and reshape the stories we tell ourselves and others. “We’ve hit the limits of afiniteEarthandgreedyconsumersthat overtax the planet are to blame,” is a thought trap that engenders fear. People then think there isn’t enough to go around, so they have to grab what they can now. This thinking locks our imagination inside an inherited, un-ecological worldview that focuses on separateness and lack; that’s precisely the thinking that got us into this mess. Considering the power of frame and language, we can ask ourselves: What is the one piece of my current mental map—my core assumption about life—that limits me? How could I reframe it to free myself? How do I keep my thinking from being mired in the world of separateness and lack? What are other terms I want to start using?

What “thought leap” can move us forward?In some ways, my “thought leaps” all reflectashiftfromfocusingonlimitsto that of alignment. We’re in the mess we’re in because our economic rules are perversely unaligned with the laws of nature and with human nature itself; they bring out the worst and keep the best in check. We need the opposite. For example, we now know how to align food production with ecological principles so that there’s enough for all, whileregeneratingfloraandfauna.Inthisthoughtleap,weshiftfromfixating

FOR TICKETS CALL: 843.448.8379TICKETS ALSO AVAILABLE ONLINE AT: www.LONGBAYSYMPHONY.com

Epic ProportionA Season of2 0 1 1 - 2 0 1 2 S E A S O N

A P R I L E V E N T S

SATURDAY & SUNDAY, APRIL 14-15, 2012

A Musical Tour ofEuropeAPRIL 14 at 7:30pm First Presbyterian Great Hall, Grissom Parkway Campus

APRIL 15 at 4:00pm All Saints Waccamaw, Pawleys Island

Tickets $15 | Students $5

SATURDAY, APRIL 21, 2012

House ConcertJoin us for a one hour chamber concert and reception with lightrefreshments and wine. 570 Creekside Drive, Mt. Gilead, Murrells InletHosted by Drew Streett of Garden City Realty7:00pm | Tickets: $35

Springbank Retreat

Register by calling 843-382-9777 or e-mail [email protected]

1345 Springbank Rd., Kingstree, SC 29556 l www.SpringbankRetreat.org

for Eco-Spirituality and the Arts

1-, 2-, & 3-monthsabbaticals — Feb. 1-May 2 Sept. 12-Dec. 5

Rest the body, Renew the spirit, Refresh the mind Sabbaticalparticipantscan enjoy

programs/retreats at no extra charge.

Easter Hope in a Time of Ecological Decline, April 5-8Awakening the Spirit Within: Playing the Flute, April 10-11Planting Seeds of Hope: Growing Your Own Veggies, April 13-15Healing Remedies: Self Care, April 20-22

Spring Retreats

on quantities and focus instead on the quality of ever-changing relationships with all life. We work to replace fear with curiosity—asking why we are together creating a world that none of us as individuals would choose? We see the nature of life as con-nection and change—realizing, therefore, that it’s just not possible to know what’s possible. How freeing. When we put our eco-minds into action with the power of connection, we can reach out and spark face-to-face gatherings with others that are also eager to move from feeling overwhelmed to taking rewarding action. Everyone benefits.

Visit SmallPlanet.org.

Linda Sechrist is a senior staff writer for Natural Awakenings magazines.


One year ago, Robert and Sheri Ward bought the scariest “you pick” blueberry farm in

South Carolina. Hidden in the Francis Marion National Park, near McClellan-ville,fireants,poisonivy,venomoussnakes and an array of blood-thirsty bugs ruled the plot. The couple never ownedafarmbeforeandfiguredtheywere in way over their heads. Now, Blue Pearl Farms is not only very safe, but also produces the sweetest, plump-est and most juicy blueberries you will ever pop into your mouth.

But the berries are just the “juicing on the cake.” The buzz throughout the state is their monthly Blueberry Jam, a free music festival held every third Sunday. Five to six hundred people stream in to hear local indie, jazz, blues and rock bands.

The Blueberry Jam started when Robert was preparing for the grand opening celebration. He couldn’t fathom hus-bands, like himself, choosing blueber-ries over watching a football game at home, so there had to be something extra to draw them. Since live music has a universal appeal, he decided to go with that. The grand opening was such a hit that everyone asked when they would do it again. Robert looked at his wife, Sheri, she looked back, and together they said, “Next month! Why not?”

They built a stage in front of a wall of pine trees next to a pond, and invited artisanstoselltheirwares.Asyoufloatthrough the crowd, you can browse through tents offering such crafts as felted soap, sock monsters, sea glass jewelry and pottery. Backstage Cafe, from Georgetown, provides craft beer and shrimp Creole, while the music plays until around dusk. “We like to get very seasoned musicians, but we often have a newcomer to the scene open up the show,” says Robert. “We’re just about booked for the year.” There is no charge to come and see the show; the bands get paid a portion from the farm and from a communal tip jar for all the bands. “When I was young, I didn’t go to the bars to see the bands, and I couldn’t take my kids now, so it’s great for families to be able to hear the local music here on the farm and not have to wait late into the nightforthefirstbandtostart,likeinclubs and other concerts.”

Blue Pearl Farms blueberries are natural,butnotcertifiedorganic.Theyhave to wait a certain number of years beforethefarmcanbecertifiedor-ganic, but they do boast being strictly chemical free. “The mosquito sprayer plane knows not to go anywhere near the farm. We got rid of the ants the natural way by shoveling out

by Judi burton

an Ear

A Mouth Fullof Blueberries

Full of Jam


a scoop of one ant hill and putting it into another hill, and then shoveling a scoop from that and putting it into the other. The ants go to war with each other and end up annihilating their unfamiliar competition. And we put on snake boots and gloves and weed by hand.”

A bonus for the Wards was that in ad-dition to the blueberries, they found muscadine grapes on the property. The vines were hidden in an overgrown area they discovered when they started pruning. The grapes yielded three to four thousand pounds at harvest time.

Blue Pearl blueberries are available at the Charleston Farmers’ Market at Mar-ion Square, the Pawleys Island Farmers’ Market at Parkersville Park, and the Mt. Pleasant Farmers’ Market at McMillan Park. They also encourage visitors to come out and pick their own.

For more info on Blue Pearl Farms, visit BluePearlFarms.com. For more info on Backstage Cafe, go to ReverbNation.com/venue/thebackstagecafe.

Earth DayMusic FestEarth DayMusic FestSaturday, April 21st 11- 6

Family Friendly, Outdoor Festival featuring live music from:

Finnegan Bell Sai Collins

Bullfrog Soulful ~ i Strike-O-MaticsTreehouse Sideways Derby

Grand Park

Sponsored in part by:

Health and Wellness Expo - Kids ZoneGordon Beirsch Beer Garden - Art Show

and more.....EarthDayMusicFest.com Falk Family Chiropractic & Wellness


Sept. 1, 1859, astronomer Rich-ard Carrington observed the largestsolarflareeverrecorded.It was a double coronal mass

ejection (CME),referred to as the Car-rington Super Flare—one enormous flareimmediatelyfollowedbyanother.When supercharged particles from this event impacted the Earth’s magneto-sphere, a severe G5 geomagnetic storm broke out. It produced spectacular auroras all over the world, even as far south as the Caribbean and the Rocky Mountains. The aurora lights were so bright over the Rockies that miners awakened in the middle of the night, believing it was daybreak. According to historical records this geomagnetic

super storm also knocked out telegraph systems in Europe and North America, occasionally shocking the operators andsettingfiretotelegraphpylons.Thankfully,therewasnosignificantharm done, but then 150 years ago there wasn’t the same dependency on technology as there is today. Even earlier, after Galileo dis-covered sunspots in 1612, European astronomers were fascinated and started logging them. They began to witness days and even months where no sunspots were observed. This was troubling, but it also corresponded to fewersolarflares.In1843,Germanastronomer Samuel Schwabe, after 17 years of his own observations, recog-nized a distinct repeating pattern, or cycle. Swiss astronomer Rudolf Wolf compiled sunspot observations back to 1745 and created a meaningful graph thatquantifiedSchwabe’sdiscovery.This painstaking work these scientists conducted may seem unessential, even boring. Ironically, the discovery of solar cycles is more important to our society now than it ever was back then. Thanks to Schwabe and Wolf’s work and the development of com-puter technology, the National Oce-anic & Atmospheric Administration is developing sophisticated computer modelstopredictsolarflares.Analysisof the data these renaissance scientists

diligently documented are leading present-day scientists and engineers to improving predictive algorithms. Accu-ratepredictionsofsolarflareswillnotonly protect astronauts, spacecraft and essential satellites from harmful bursts of solar radiation and electromagnetic flux,butalsothepeoplebelow.At35,000 feet, airline passengers can be exposed to harmful levels of radia-tion during strong geomagnetic storms causedbysolarflares.Technologysuch as the Smart Grid, which gives us power, and microwaves, which give us cellular communications, are in danger of failing in the wake of a large solar flare.

(march 6, 2012, g3 geomagnetic storm broke out resulting in this aurora)

(soho photo march 5, 2012, X5.4, solar flare – largest since X6.9 of June 2011)

by dan evans


Solarstorms,orflares,havebeen happening since the sun formed about 4.5 billion years ago. During this period, the sun has gone through many cycles of intense storm activ-ity, just like the cycle we’ve recently entered. Solar cycles are nine- to14-year intervals where the sun goes from solar-min (minimum activity) to solar-max (maximum activity) then back to solar-min for a spell. Solar-max is basically a geomagnetic storm season, comparable to hurricane season on the Southeast Coast. Hurricane season is when we see barometric pressure systems that turn into depressions, then tropical storms and, unfortunately, hur-ricanes that can be rated by damaging strength.Likehurricanes,solarflaresare rated in strength, but of intensity not velocity. How? The easy answer is S1-5, but the rating commonly used (An, Bn, Cn, Mn, Xn) is a little confus-inganddifficulttoexplain. On Jan. 28, there was an X6.9 solarflare,resultinginaG3geomag-neticstormthatcausedairtraffictobe rerouted and cell communication outages. March 6 an X5.4 was re-corded, causing another G3 storm in ouratmosphere,andagainflightswerererouted and there were cell outages. If an S5 ever erupts in Earth’s direction it would cause serious trouble—certainly power and communication outages. There is a lot of doomsday talk whenitcomestosolarflareactivity.My research on the Internet revealed an onslaught of phrases like, “Massive Solar Flare Headed Toward Earth … Armageddon out of here!” From what

I’ve learned, I can say the threat is over exaggerated but certainly real. An article on NASA Science’s website stated the following: “The National Academy of Sci-ences framed the problem two years ago in a landmark report [titled] ‘Se-vere Space Weather Events—Societal and Economic Impacts.’ It noted how people of the 21st century rely on high-tech systems for the basics of dai-ly life. Smart power grids, GPS naviga-tion,airtravel,financialservicesandemergency radio communications can all be knocked out by intense solar activity. A century-class solar storm, the Academy warned, could cause twenty times more economic damage than Hurricane Katrina.” Evenhugeflare-upsonthesundonot necessarily result in geomagnetic stormshereonEarth.Theflaresthat

affect us are those that occur in our direction. The more direct and greater the extent, the more the effect. If the storm happens on the side away from us at the time, we may not even know aboutit.WhenanotherS5flareerupts,it will have to be directly toward Earth to cause really serious damage, and the odds are, shoulder shrug, 50/50. There’s really no reason to be stressed or panicked over the threat of solar storms or CMEs. However, it does make good sense for Carolinians to be prepared for power outages, whether from solar storms or Earth storms. Personally, I recommend solar-charged battery backup systems. These systems do not rely on refueling with gas, so theycanprovidepowerindefinitelyonce the clouds clear. With the sun in its active cycle, there’s plenty of energy for solar panels to harvest. Gas may not be available for weeks in the aftermath. Also there are federal and state tax credits that give you 55 per-cent back on your taxes for any solar purchase. These battery systems can be very affordable and keep your refrig-erator, lights and electronics powered during prolonged outages. Install an affordable solar thermal system, and youcanhavehotwaterindefinitelyaswell.

For more info, contact Dan Evans, president of Solar Plus Energy Pros, at [email protected]. See ad, page 21.

(thanks to wikipedia - http://en.wikipedia.org/wiki/File:sunspot_numbers.png)

(earth compared to ridiculously huge s3 solar flare)sun Fact: sun is 2.7 million miles around. 342 earths could encompass it.


note: All calendar events must be received by April 10 (for May issue) and adhere to our guidelines. To submit listings,

check for calendar guidelines, updates and cancellations, visit GrandStrandHealthyLiving.com.

ALWAYS CALL AHEAD BEFORE ATTENDING EVENTS TO AVOID LATE CANCELLATIONS AND CHANGES

calendarofevents

APRIL-OCTOBERButterfly House Opens at Brookgreen. 10am-4:30pm. Seasonal exhibit features lush tropical garden filled with hundreds of butterflies of all species. Pupae emergence room where visitors may observe chrysalis to butterfly transition. Open daily, $3-adults, $2-children, 30 minute timed visit, in addition to garden admission charge. Brookgreen Gardens US Hwy17 Bypass, across from Huntington Beach. Info: Brookgreen.org.

SUNDAY, APRIL 1Building Your Forearm Balance Workshop w/Todd Geiser−9-11am. Focus on forearm balance. Open to all levels. Detailed instruction on basic building blocks for this challenging posture as well. Advancing instruction offered to advancing work. By donation. 417 79th Ave N, Ste E, MB. [email protected], 843-333-2656; SecretLotusYoga.com.Unity –11am Palm Sunday Service, “Welcoming the Christ”. Service will include the Unity com-munion Ceremony. All are welcome to participate. Youth program available. Unity Christ Church, 1270 Surfside Ind Pk Dr, Surfside Info, 843-238-8516, UnityMyrtleBeach.org.Mind Spa w/Mike Oglesbee−1-2:30pm. Amaz-ing and powerful class will take you deep into hypnosis and allow you to rejuvenate, renew, and heal your mind and body. Mind Spa will allow you to release negative energy and fill yourself with positive energy for a healthier life. $20. 196C Stonebridge Dr, MB, 843 957-6926, [email protected].

TUESDAY, APRIL 3Prosperity Plus Program w/Cathy Hatch & Rev. Margaret Hiller−6-7:30pm. 1st of 10-week series. Catalyst for greater self-awareness, deeper spiritual practice, more meaningful relationships, financial increase, and stronger self-esteem. Developed by speaker, best-selling author, and consultant Mary Morrissey, LifeSOULutions. $49 fee includes materials. 1270 Surfside Industrial Park Dr, Surfside, 843 238-8516, UnityMyrtle-Beach.org.

WEDNESDAY, APRIL 4Unity Healing & Prayer Service w/Olivia Rose−6:30-7:30pm. Meditation, prayer, hands-on-healing. Love offering. Unity Peace Chapel, Unity Christ Church of MB, 1270 Surfside Industrial Park Dr, Surfside, 843 238-8516,UnityMyrtle-Beach.org.

APRIL 5-8Easter Triduum: Easter Hope in a Time of Ecological Decline w/Jim Profit. Can we hear

the cry of Jesus on the cross in the cry of Earth and experience the resurrection in the regenerative power of Earth? Our experience of Easter gives us hope in a time of ecological decline. This retreat includes Holy Thursday, Seder/Eucharistic liturgy, Good Friday, Way of the Cross, Holy Saturday, Great Easter Fire/Vigil, early Easter Sunday lit-urgy. Springbank Retreat for Eco-Spirituality and the Arts, 1345 Springbank Rd., Kingstree. $375 fee includes lodging and meals. 843-382-9777 orSpringbankRetreat.org.

FRIDAY, APRIL 6Gathering of the Arts−Noon-5pm. How Bazzaar Gallery and Mermade invite you to share your art, your music, your performance, your talent, and yourself. Have fun and make friends. Wachesaw Oaks, 4650 Highway 17, Murrells Inlet. Group Game Night at How Bazzaar! Gallery−7:30pm. Meet new friends at a hilarious interactive social play experience. Anytime, 10am to evening, come in and paint on a 16x20 canvas, we provide all the paint and supplies you need until your painting is finished and ready to hang. 10764 Hwy 707, Murrells Inlet near Salt Creek Café.

SATURDAY, APRIL 7Law of Attraction Workshop w/Mike Oglesbee–1-4pm. Join advanced Law of Attraction expert Mike Oglesbee to learn, in depth, how to utilize the Law of Attraction in your everyday life. $30. 196C Stonebridge Dr, MB, 843-957-6926 or Maxi-mizedmind.com.

SUNDAY, APRIL 8Unity –11am Easter Sunday Service, “Divine As-signments” w/Rev Margaret Hiller. Unity Christ Church, 1270 Surfside Ind Pk Dr, Surfside Info, 843-238-8516, UnityMyrtleBeach.org.

APRIL 10 & 11Awakening the Spirit Within: Learning to Play the Flute w/Cerantha Corley. Find out how a Na-tive American-style flute can express your inner song. Let your soul speak to you through flute-play-ing and expressive painting. Springbank Retreat for Eco-Spirituality and the Arts, 1345 Springbank Rd., Kingstree. $250 fee includes lodging and meals. 843-382-9777 or SpringbankRetreat.org.

WEDNESDAY, APRIL 11Are You Earning What You’re Worth? w/Linda Sachetti−10:30am or 6pm. Dare to dream. Attend the Inlet Nutrition orientation. Limited seat-ing- reserve space. Refreshments served. Linda: 843-424-9586.

Free Anti-Aging & Wellness Seminar w/Alsuna Roland, Wellness Coach−6-8pm. Take the 90 sec-ond non-invasive anti-oxidant test as seen on the Dr Oz show. Get the resources to enjoy satisfaction & peace of mind from sustaining a healthy body, and an environmentally responsible life. Yoga Room, 196C Stonebridge Dr. MB Reserve at 718-807-1790 or: [email protected].

APRIL 13-15Planting Seeds of Hope: Growing Your Own Veggies w/ Rita Wienken. This workshop will explore the current food system and look at ways to become more conscious of Earth’s sustainability through food choices we make. Learn to build a 5- by 8-foot raised bed for growing your own food. Springbank Retreat for Eco-Spirituality and the Arts, 1345 Springbank Rd., Kingstree. $200 fee includes lodging and meals. 843-382-9777 or SpringbankRetreat.org.Triom Touch Healing Workshop – Level 1 w/Dr. Olympia Freeman−6:30-8:30pm Fri, 9:30-6pm Sat, 10am-6pm Sun. Relieve stress, pain, allergies, & illness easily for family and clients with gentle touch system of 6 seconds on specific points of body. Restores fluid flow of energy and light be-tween higher self, body, & mind. Simple, effective techniques for symptoms of almost every illness including CFS, sciatica, and diabetes. For begin-ners and seasoned practitioners alike. Intensive hands-on training. $355 Early Bird fee until 4/5, $399 after. About Your Health, 120 Kaminer Way Parkway, Suite J, Columbia, Info: Dr. Olympia Freeman, 828-226-0660, [email protected], SoulsMidwife.com.

SATURDAY, APRIL 14Building Futures Autism Clinic 5k Run/Walk, 1 mile Run/Walk and Dog Walk. April is Autism Awareness Month. Help fund programs for children with Autism Spectrum Disorders. The 5k and 1 mile run/walk will take place at The Market Common, 5k Run/Walk,−9 am; 1 mile Run/Walk,−10:15am. Runners Awards Ceremony 10am for the 5k and 12pm for the walk. Info & register at 843-449-0554 or SOS-Healthcare.com. Yamuna Body Rolling w/Cat Corchado–11:30am. Improves alignment, stretches muscles from origin to insertion,and Feels like a Deep Tissue Massage,Supports your chiropractic adjustments and extendsthe benefits from yoga & massage. For every body,no matter skill level or athletic ability,fibromyalgia,Arthritis, Rheumatoid Arthri-tis, Parkinson’s. The Yoga Room, 196 Stonebridge Dr, MB, 843 450-9402, MyrtleBeachYogaRoom.com, AllAboutBodyRolling.com. Raw Vegan Potluck Lunch & Movie−Noon. Bring a raw vegan dish to share and bring your own plates and eating utensils. Raw vegan food is the most nutrient dense food. Learn and share


its health benefits. Movie about the food industry, or raw vegan food, starting at 12:45. Socastee Library, 707-Connector Rd, MB. Meetup.com/rawveganmyrtlebeach.A Musical Tour of Europe w/Long Bay Sympho-ny–4pm. Popular symphonic selections, from Vi-ennese Classical to Italian comic opera, Romantic period works from France, Russia and Germany, and folk-inspired classics from Eastern Europe. First Presbyterian Church Great Hall, Grissom Parkway Campus. $35 and up, 843-448-8379, LongBaySymphony.com.

APRIL 14-15Plantacular Sale at Brookgreen−9:30am-4pm. Top quality hard-to-find plants, trees and flowers from Brookgreen’s greenhouse available for pur-chase. Brookgreen Gardens US Hwy17 Bypass, across from Huntington Beach. Info: Brookgreen.org.Art in the Park at Chapin Park-Myrtle Beach w/Waccamaw Arts and Crafts Guild−10am-4pm. Over 60 artists from the East Coast with about 20 from our local area. Paintings, woodworking, photography, jewelry, fabric, glass, metal, pottery and stone. 1400 N Kings Hwy, MB. Free admission. Child and pet friendly. Info: JoAnne Utterback 843 446-7471, ArtsyParksy.com.

SUNDAY, APRIL 15Unity –11am Sunday Service, “A Time to Soar Beyond Limitation” w/Guest Speaker, Rev David Hiller, Interfaith Minister, Counselor and Psych-K Consultant.. Service followed by 1:30-4:30pm workshop “A Time to Soar”. Release limiting beliefs, create miraculous outcomes, learn about power of the subconscious mind and experience Psych-K process. Suggested donation, $20. Unity Christ Church, 1270 Surfside Ind Pk Dr, Surfside Info, 843-238-8516, UnityMyrtleBeach.org.Hypnosis Seminar w/Mike Oglesbee−1-2:30pm. Advanced Hypnotist & NLP practitioner will teach, in depth, how the mind works and how to effectively create change in desired areas of life. Free. Guests will receive a free hypnosis CD. 196C Stonebridge Dr. MB. 843 957-6926, [email protected] Musical Tour of Europe w/Long Bay Sym-phony–4pm. Popular symphonic selections, from Viennese Classical to Italian comic opera, Romantic period works from France, Russia and Germany, and folk-inspired classics from Eastern Europe. All Saints Church, 3560 Kings River Rd., Pawleys Island. $35 and up, 843-448-8379, Long-BaySymphony.com.Yoga with live Sitar Music w/Will & Ben−6-7:30 pm. An all-levels class., $15 drop in; $10 for pass holders Yoga in the Forest, 4006 Postal Way, MB, YogaInCommon.com.

savethedate

Spring Garden Festival 2012 w/Low Coun-try Herb Society & Inlet Culinary Garden–

8am-5pm. Herbal food samples, 80+ varieties of herbs, 30+ varieties of heirloom vegetables, edible and fruiting plants, butterfly and hum-mingbird perennials, and plants that attract beneficial insects. Pottery, organic fertilizer,

and potting and seeding soil.

APRIL 20-21Free entry. Inlet Culinary Garden, 5071 Hwy 17 BypS, in Murrells Inlet Info: LCHS at lch-

[email protected] or call 843-215-6985

savethedate

Earth Day Music Fest–11am-6pm. Health and wellness Expo, Kids Zone, Art Show,

Beer Garden. Family friendly outdoor festival featuring live music.

SATURDAY, APRIL 21 Grand Park and Market Common, Myrtle

Beach. Info and to be a vendor, email Kristi at [email protected].

APRIL 21-22Art in the Park at Valor Park-Market Common w/Waccamaw Arts and Crafts Guild−10am-4pm. Over 60 artists from the East Coast with about 20 from our local area. Paintings, woodworking, pho-tography, jewelry, fabric, glass, metal, pottery and stone. 1120 Farrow Parkway in Market Common, MB. Free admission. Child and pet friendly. Info: JoAnne Utterback 843 446-7471, ArtsyParksy.com.

SATURDAY, APRIL 21Morning Beach Walk w/Fun & Fit Meetup−8am. Start at the public beach access at Nash St & walk to the MB State Park pier & back, Feel free to bring children, pets & friends. Wesly Gray,843-650-1714, Meetup.com/FunandFitMyrtleBeach. 3rd Saturday Health Talk w/Melody Iles, NP, Phd 10am. Free Natural Health Seminar. 315 Main St. Conway, 843-446-0293; SCWellness.net; [email protected] Clearing and Balancing Workshop w/Stan Case −12-6pm. Learn how energy flows in the body, how to use meditations to activate light body, tools for deeper personal healing and healing others, using sound. 19 years experience working with energy and light body. $65. Incl 45 min lunch break. register or call 843-450-9402, SagaoftheS-age.com, [email protected]. The Great Cloth Diaper Change 2012 w/Holistic Parent & Bella Baby−Noon. Guinness Record breaking international event to raise awareness and money to bring back cloth diapers for health and the environment. Bella Baby on 7269 Highway 707, Myrtle Beach. Ends Real Diaper Week April 16-21.

Cloth diapering is alive and well. 843-882-7111 or 520-907-2363, HolisticParent.com, Facebook: Holistic Parent, and Facebook: Great Cloth Diaper Change Myrtle Beach.Kundalini Class with Music w/Anahata, guest instructor−6-7:30pm, $15 drop in; $10 for pass holders. Yoga in Common, 3080 Deville St, MB, Market Common, 843-839-9636, YogaInCom-mon.com.

SUNDAY, APRIL 22Unity –11am Earth Day Sunday Service w/Rev Margaret Hiller. Unity Christ Church, 1270 Surfside Ind Pk Dr, Surfside Info, 843-238-8516, UnityMyrtleBeach.org.Mind Spa w/Mike Oglesbee−1-2:30pm. Amaz-ing and powerful class will rejuvenate, renew, and heal your mind and body through hypnosis. $20. 196C Stonebridge Dr, MB, 843-957-6926, Maximizedmind.com.Tea & Symphony–1pm. The Long Bay Symphony Guild presents the annual Tea & Symphony at the Franklin G. Burroughs-Simeon B. Chapin Art Mu-seum, 3100 S. Ocean Blvd. Long Bay Symphony Youth Orchestra will perform. Sample teas and sweets and enjoy. $35. Benefit for The Long Bay Symphony, its educational programs and the Youth Orchestra. Info: Helen Barnett, 843-903-4211. Tickets: 843-448-8379. LongBaySymphony.com.Balancing Your Life w/Karyl Tych, Iyengar In-structor and guest teacher−6-7:15pm. Balancing postures anyone can do. $15 drop in; $10 for pass holders. Yoga in Common, 3080 Deville St, MB, Market Common, 843-839-9636, YogaInCom-mon.com.

APRIL 24-25Reiki 1 & 2 Classes w/Bridget Kelly−9am-4pm. Learn Reiki, an ancient traditional practice used all over the world in clinics, hospitals and hospices, rediscovered by Dr Mikao Usui in the mid 1800’s to promote healing and wellbeing.. Call for info. 843-695-0304.

WEDNESDAY, APRIL 25Are You Earning What You’re Worth? w/Linda Sachetti−10:30am or 6pm. Dare to dream. Attend the Inlet Nutrition orientation. Limited seat-ing- reserve space. Refreshments served. Linda: 843-424-9586.

APRIL 27-29“Like Changing Clothes”: Vitality in Aging w/Christie Derrick-Guess. To paraphrase the Dalai Lama, “Aging is like changing clothes.” This workshop helps participants explore their resources for resilience and vitality. Springbank Retreat for Eco-Spirituality and the Arts, 1345 Springbank Rd., Kingstree. $275 fee includes lodging and meals. 843-382-9777 or SpringbankRetreat.org.

SATURDAY, APRIL 2815% Off Customer Appreciation Day at Bay Natural & New Life Naturals Last Saturday of every month is 15% off all non sale items. New Life Natural Foods, NMB at Gator Hole, 556

Your calendar listinghere

reaches 44,000 readers monthlyfor as little as $10

843-497-0390


ongoingevents

Unity Church Sunday Morning Circle w/Susan Boles, LUT & Lesta Sue Hardee−9:30-10:30am. Metaphysical Studies. Current book: Keeping a True Lent by Charles Fillmore. Love Offering. Unity Church, 1270 Surfside Ind Pk Dr, Surfside, 843-238-8516, UnityMyrtleBeach.org.Bookstore for the Miracle Minded–10am-1pm. Books on healing, spirituality, personal growth, wellness; metaphysics as well as beautiful, unique gift items. Unity Christ Church, 1270 Surfside Industrial Pk Dr., Surfside, 843-238-8616, Unity-MyrtleBeach.org. Yoga Fitness Boot Camp w/Island Wave Yoga−10-11:30am. A 12-week series designed to tone, increase strength & stamina. Prior yoga experience not necessary. Drop in to one, two, five or all. Drop in, series passes or regular membership fee applies. 10555 Unit A Ocean Hwy 17 Business Pawleys Isl. Info: 843-314-3206, IslandWaveYoga.comUnity Church Service w/Rev Margaret Hiller & guest speakers−11am celebration service. Prayer, meditation, song, messages & family. Youth pro-grams. Unity Church, 1270 Surfside Ind Pk Dr, Surfside, 843-238-8516. UnityMyrtleBeach.org.Sharing Meals with the Hungry w/Food Not Bombs–noon. At Wither Swash Park, protest war, poverty and the destruction of the environment while feeding the hungry. The food is always free to everyone without restriction, rich or poor, stoned or sober. Food Not Bombs is dedicated to nonviolent direct action, &works for nonviolent social change. 843-957-2859, [email protected] Blessing w/ Unity Blessing Givers–12:20pm. Held in Peace Chapel after the regular service. Love Offering. Unity Christ Church, 1270 Surfside Industrial Pk Dr., Surfside, 843-238-8516, UnityMyrtleBeach.orgInlet Yoga Yin Yang Meditation Sunday Series w/Maribeth Mackenzie & Lauren Davis–6pm-7:30pm. Challenging both mentally and physi-cally. Yin: holding supported postures and getting deep into connective tissues. Yang: stretching and strengthening muscles using breath and movement. Different class each week. Yin, Candlelight Yoga, Meditation. Inlet Yoga, 637D Bellemy Ave, Mur-rells Inlet. 843-655-6272, InletYogaStudio.com.

Chair Stretch Yoga w/Wesly–11:30am. Appropri-ate for everybody, targeting those who are fit as well as those who are sedentary, intimidated, unfamiliar with exercise, or entering post-rehabilitation pro-grams. A flowing series that creates warmth and energy. Light to moderately intense rhythmic and static range of movement choreography and restor-ative breath instruction. $8, pay at the door. Yoga Room, 196 Stonebridge Dr, MB, 843-450-9402, MyrtleBeachYogaRoom.com.

A Course in Miracles w/ Ken Lennon−5:30-7pm. A combination of psychology & spirituality. Save yourself years of therapy, learn how to have a mentally healthier & emotionally happier life. Love offering. Unity Christ Church, 1270 Surfside Industrial Pk Dr, Surfside. 843-238-8516 Unity-MyrtleBeach.org.Kripalu Yoga w/Penny–7-8:15pm. Gentle stretch-ing & Restorative yoga, with breathing techniques, warm-ups, postures, meditation & relaxation. Kripalu teacher. Suggested $10 love offering. Unity Christ Church, Surfside. 843-902-1416, [email protected] Study Group−7:30pm. Myrtle Beach Karma Kagyu Tibetan Buddhist study group of-fers a 7 wk course, “Intro to Buddhism”. Group meditation & meditation instruction. Free, dona-tions accepted, not req. Forestbrook Area, MB. Info: 843-655-8056, [email protected], KagyuStudySC.info.

Spring Fling Weight Loss Challenge w/Inlet Nutrition. AM & PM appts avail. Murrells Inlet or Georgetown locations. $35/12 wk program. Free if you refer 3. Free coaching and metabolism test, prizes weekly and more. Linda: 843 424-9586Lava Flow–9:15-10:30am. Come prepared to flow and sweat. Will move through the asanas in a heated room using the heat and asana sequence to open the body up and clear toxins. Leave feeling cleansed from the inside out. Don’t miss the cool, lavender scented towels in savasana. Bring water and a towel. Recommended for those with yoga experience. 10555 Unit-A Ocean Hwy 17, Pawleys Isl, 843-314-3206, IslandWaveYoga.com, [email protected] for Hips & Shoulders w/Susie−9:30-11am. All levels vinyasa with a heavy concentration on mobilizing the pelvis & shoulder girdle. Shanti Myrtle Beach, 3901 N Kings Hwy, MB, 843-467-5444, ShantiMyrtleBeach.com.Awareness Through Movement, Feldenkrais® Method w/Heidi McGovern PT CFP−10am-11am. To feel better, move easier, look younger & release stress. Scientifically based non-habitual movements capitalize on the brain’s capacity to change. Offered in series or single classes. 6wk series $50, 5 wk series $40. Walk in $10. Bring a mat. Possum Trot Rec Center in NMB. 843-361-8436, [email protected], HeidiMcGovern.com.Tai Chi w/Fred–10:30-11:30am & 7:30-8:30pm. A low impact healing exercise that works at all levels in the mind body continuum, fostering well being and body awareness. Beginners welcome. The Yoga Room, 196 Stonebridge Dr, MB, 843-294-5486.Hot Vinyasa w/Dawn−6:30-7:30pm. Using heat to move deeper into asanas, explore the limits of the body while challenging your strength. It’s hot, it’s hard. Leave humbled. Shanti Myrtle Beach, 3901 N Kings Hwy, MB, 843-467-5444, Shanti-MyrtleBeach.com.

Hwy 17N, NMB 843-272-4436, & Bay Naturals, 76th Ave N & Kings Hwy, MB, 843-448-0011, NLnaturalfoods.com.Law of Attraction Workshop w/Mike Oglesbee–1-4pm. Join advanced Law of Attraction expert Mike Oglesbee to learn, in depth, how to utilize the Law of Attraction in your everyday life. $30. 196C Stonebridge Dr, MB, 843-957-6926 or Maxi-mizedmind.com.

APRIL 28, 29Yoga 101 Workshop w/Island Wave Yoga−2-4pm. Perfect for those who are new to yoga or just need a refresher. Bring a notebook and pen for notes. We provide the mat and booklets. Wear clothes that allow you to move. $50. Pre-register by 4/20 and get 50% off. IslandWaveYoga.com, 10555 Unit A Ocean Hwy 17, Pawleys Isl, 843-314-3206, IslandWaveYoga.com.

SUNDAY, APRIL 29Finding Lightness-Floating in Your Practice w/Todd Geiser−1-3:30pm. Creating more lightness in moving through your Vinyasa yoga practice. devel-oping more body awareness in the strength of the arms, along with creating a more firm connection to the core with proper bandha work. Study with Myrtle Beach’s master of floating, All levels with knowledge of sun salutations. $25 members, $30 non-members. Inlet Yoga 637D Bellemy Ave, Mur-rells Inlet, 843-655-6272, InletYogaStudio.com.Mind Spa w/Mike Oglesbee−1-2:30pm. Amaz-ing and powerful class will rejuvenate, renew, and heal your mind and body through hypnosis. $20. 196C Stonebridge Dr, MB, 843 957-6926, Maximizedmind.com.

lookingforwardWEDNESDAY, MAY 2Unity Healing & Prayer Service w/Olivia Rose−6:30-7:30pm. Meditation, prayer, hands-on-healing. Love offering. Unity Peace Chapel, Unity Christ Church of MB, 1270 Surfside Industrial Park Dr, Surfside, 843 238-8516,UnityMyrtleBeach.org.

A good garden

may have

some weeds. ~Thomas Fuller


BUSINESS OPPORTUNITYCURRENTLY PUBLISHING NATURAL AWAKENINGS MAGAZINES – For sale in North Central FL; Lexington, KY; Ashe-ville, NC; Santa Fe/Albuquerque, NM; Cincinnati, OH; Tulsa, OK; Northeast PA; Columbia, SC; Southwest VA. Call for details 239-530-1377.DARE TO DREAM. Earn What You Are Worth. Step by Step training; PT/FT Bilingual a plus. Call for orientation: 843-424-9586NATURAL AWAKENINGS MAGAZINE FOR SALE, COLUMBIA SC. Call 803 233-3693 for details. Currently publishing, 15,000 copies per month. Training provided.

WE PAY YOU TO LOSE Weight Loss Chal-lenge. 36 people needed who are serious about losing weight. Join for $35. Every Tues. (am or pm avail). 843-424-9586 or 843-267-4399

FOR RENTLARGE TREATMENT ROOM for rent in busy, therapeutic massage office. Opportunity for an LMT or other natural health care provider! Incl referrals, ability to co-advertise, convenient Carolina Forest location near 31/Bypass/Intl Drive. Professional, healing space to grow your practice. Call Cyndie: 843 448-9800.YOGA TEACHERS AND HEALING ARTS PRACTITIONERS : The Yoga Room Healing Arts Co-op has a fully furnished private counsel-ing and massage office available as well as a 1100 sq ft Yoga Studio with bamboo flooring, chairs, and a great sound system. Available on a part-time/shared basis and at affordable rates. Great opportunity for practitioners who want to meet new clients in a professional, centrally located secure environment, to host an educational talk, hold a class or a private session. Book with Google Calendar and easy turn key. Contact Donna Stead at [email protected]. Check out at Myrtle-BeachYogaRoom.com.

HELP WANTEDSALES: advertising sales, Natural Awakenings. Have your heart in your work. [email protected].

MISCMeet New People at How Bazzaar! Come in and paint on a 16x20 canvas, we provide all the paint and supplies you need until your painting is finished and ready to hang! Hours: 10am-late night located at 10764 Hwy 707.

VOLUNTEERSFood Not Bombs is looking for new resources and new volunteers. FNB shares meals with the hungry to protest war, poverty and the destruction of the environment. The food is always free to everyone without restriction, rich or poor, stoned or sober – 843-957-2859, [email protected] SANCTUARY VOLUNTEERS willing and able to do odd jobs for lots of furry hugs and kisses as payment..18 years or older or with chaperon. SC CARES is a non-profit no kill shelter for exotic animals. support by donat-ing time and love. Lisa 843 546-7893, [email protected] WITH THE WELLNESS COUNCIL for S.C. today. wellnesscouncilcsc.org

classifiedsWholistic Childbirth Class w/Pat Burrell, RN, CHT, CLC, CD (DONA)−6:30-8:30pm. Have the birth you deserve. Comprehensive, informative, empowering, supportive & welcoming. Call to reserve. $350 for 10 2hr sessions. Payment plans available. Info: Pat, 843-213-1393, BeachBabys.org.Kriya Yoga Meditation Group−7-8pm. Ongoing Meditation Group for personal & spiritual growth. Beginners & advanced are welcome for instruction & support. Love offering Basis. Call for Strand location. Paula Kenion, MS, Meditation Teacher, 843-650-4538 SpiritualAwakening.vpweb.com.Inlet Yoga Power Hour w/Sherry Peckham–7:30-8:30pm. Come lose the stress of the day and maybe even a little ego as you work through a powerful vinyasa series of posters designed to build endur-ance, strength, flexibility and breath awareness. Be prepared to sweat! Inlet Yoga, 637D Bellemy Ave, Murrells Inlet. 843-655-6272, InletYogaStu-dio.com.

Seniors Day at Bay Naturals & New Life Natural Foods. Shoppers over 60 get 10% discount Wed at New Life Natural Foods, NMB at Gator Hole, 556 Hwy 17N, NMB 843-272-4436, & Bay Naturals, 76th Ave N & Kings Hwy, MB, 843-448-0011, NLnaturalfoods.com.Free Metabolism Test w/Linda Sacchetti. Find out your body fat %, pounds of body fat, lean body weight & what your targets should be, by individual appt in MB. Info: Linda, 843-651-9350. Free Spa Beauty Facial w/Linda Sacchetti. Learn the 7 signs of aging and discover the solutions Defy aging for younger-looking skin with antioxidants, aloe vera & glucosamine. By individual appt in MB. Info: Linda, 843-651-9350.108 Sun Salutations on the Beach–9:30am. Bring beach towel, water, sunglasses. Vinyasa yoga on beach, harmonizing with breath and ocean sound-ings. at 8th Ave N, NMB All Levels. Community class by donation. Carolina Power Yoga 769 Main St, NMB 843-877-5839, CarolinaPowerYoga.com.Bookstore for the Miracle Minded–10am-1pm. Books on healing, spirituality, personal growth, wellness; metaphysics as well as beautiful, unique gift items. Unity Christ Church, 1270 Surfside Industrial Pk Dr., Surfside, 843-238-8616, Unity-MyrtleBeach.org. Meditation, Silent & Guided w/Kelly Faith Payne–Noon-12:30pm. In Unity’s Peace Chapel, Unity Christ Church, 1270 Surfside Industrial Pk Dr., Surfside, 843-238-8516, UnityMyrtleBeach.org.Brown Bag Lunch & Book Group w/Rev. Marga-ret Hiller & Friends–12:30-1:3pm, based on book A New Earth by Eckhart Tolle. Love Offering. Unity Christ Church, 1270 Surfside Industrial Pk Dr., Surfside, 843-238-8516, UnityMyrtleBeach.org.Down by the Riverside & Other Spirituals w/Ron Daise–1pm. Learn Gullah songs that shaped the culture. gain understanding and appreciation for Gullah/Geechee heritage. Info from Charles Joyner’s book about Gullah culture, Down by the Riverside: A South Carolina Slave Community. Da-

ise’s books and personal insights will be featured. Free with garden admission. (Not 4/11.) Wall Low-country Center Auditorium, Brookgreen Gardens US Hwy17 Bypass, across from Huntington Beach. Info: Brookgreen.org.Ashtanga Short Form at Shanti−5:15-6:15pm. A sequence that is available & yet challenging for all levels, an amazing foundation for any practitioner who finds assists & adjustments helpful. 38th Ave, N Kings Hwy, MB, 843-467-5444, ShantiMyrtle-Beach.com. Yoga for Golf & Sports w/Maribeth MacKen-zie–5:45-6:45pm. Class for golfers and sports enthusiasts, and everyone interested in working specific muscle groups to build strength, endurance, and to bring longevity to any sport, even yoga. Inlet Yoga 637D Bellemy Ave, Murrells Inlet, 843-655-6272, InletYogaStudio.com.Dharma Gentle–6:30-7:30pm. Students led and helped according to their needs and abilities. Learn important breathing exercises, key in restoring vitality and a balanced functioning of the inner workings of the body and mind. Sessions end with a guided deep relaxation to rebalance and restore. Shanti Yoga, 38th Ave N, Kings Hwy, MB 843-467-5444, ShantiMyrtleBeach.com.Oneness Blessing−6:30–8pm. (not 1st Wed of the mo), Unity Peace Chapel, Love Offering Unity Church, 1270 Surfside Ind Pk Dr, Surfside, 843-238-8516 UnityMyrtleBeach.org.Wellness Wednesdays Workshops at YIC w/guest Patricia A. Burrell, RN, CD (DONA), CHT, CLC, WCBE−6-7:15pm. 4/4 Healing Body-Mind-Spirit through Past Life Therapy, 4/11 Prosperity Consciousness 4/18 An Integrated Approach to Be-ing Present in the Present 4/25 Letting Go of what you don’t need to be happy now! Yoga in Common, $15 drop-in, $10 for pass holders Kriya Yoga Meditation Group−7-8pm. Ongoing Meditation Group for personal & spiritual growth. Beginners & advanced meditators are welcome for instruction & support in their practice. Love offering Basis. Call for Strand location. Paula Kenion, MS, Meditation Teacher, 843-650-4538 SpiritualAwakening.vpweb.com.

Sunrise Vinyasa–6-7am. Flow into the morning with an invigorating wake-up practice for all levels. Leave balanced, smiling and ready to take on the day. 10555 Unit-A Ocean Hwy 17, Pawleys Island, SC, IslandWaveYoga.com, [email protected], 843-314-3206. All levels Open Vinyasa Yoga w/Karley Lott–9-10:30am. Breath work and a powered up flow of postures linking mind and body together for a mindful moving meditation. All levels, be prepared to sweat and detoxify. $15 Drop-in or class passes accepted 417 79th Ave N, Ste E, MB, [email protected]; 843-333-2656; SecretLo-tusYoga.com


Gentle Morning Yoga w/Penny–9-10:15am. For all levels & all bodies. Variations on postures for those with medical problems. Suggested love offer-ing $5. Call Penny, certified Kripalu Yoga teacher, 843-902-1416, [email protected]. Unity Christ Church, 1270 Surfside Industrial Pk Dr., Surfside, UnityMyrtleBeach.org.Vinyasa w/Dawn−9:30-11am. All levels practice that is challenging while giving modifications if needed. Time to take your practice beyond the asa-na. Combines physical discipline with meditation to heal on all levels. Shanti Yoga, 38th Ave N Kings Hwy , MB 843-467-5444, ShantiMyrtleBeach.com. Bones for Life™ w/Heidi McGovern PT, BFLT−10-11am. Support your bones with easy to learn exercises developed by Ruthy Alon. Learn what your bones respond to & have fun doing it. Offered in series or single classes. 6 wk series $50. 5 wk series $40. Walk in $10. Possum Trot Rec Center Bring a mat. 843-361-8436 [email protected], HeidiMcGovern.com.A Guide to Practical Spirituality w/Ken Len-non–Noon-1:30pm. Dialog group on the perennial wisdom found in Unity’s principles & great world religions & how we live these ancient spiritual truths in our lives & world today. Love Offering. Unity Christ Church, 1270 Surfside Industrial Pk Dr., Surfside, 843-238-8616, UnityMyrtleBeach.org.Ovis Hill Farmers Market in Florence−4-7pm. Local farm products, grass-fed beef, lamb, poul-try, eggs, dairy & seasonal organic vegetables. At parking lot, 2519 W Palmetto St, Florence. Info: Charlie, 843-992-9447, OvisHillFarm.com. Alkaline, Antioxidant, Detoxifying Water w/Raymond Owens−5:30pm. Full water demos & power-point presentation. Learn about the impor-tance of body ph, drinking bottled & tap water. Call for reservations. Joyfilled Gifts, 805 Front St. Georgetown, Raymond, 843-833-1773, [email protected]. Tai Chi w/Fred–10:30-11:30am & 7:30-8:30pm. A low impact healing exercise that works at all levels in the mind body continuum, fostering well being and body awareness. Beginners welcome. The Yoga Room, 196 Stonebridge Dr, MB, 843-294-5486.

Early Morning Ashtanga Primary Series Challenge w/Maribeth MacKenzie–6am. Better than any cup of coffee out there! Come breathe, empower, and transform yourself with a powerful practice that will change face of the rest of your day. Inlet Yoga, 637D Bellemy Ave, Murrells Inlet. 843-655-6272, InletYogaStudio.com.Ashtanga Primary Series w/Dawn−9:30-11am. A sequence that is available & yet challenging for all levels, an amazing foundation for any practitioner who finds assists & adjustments helpful. Shanti Yoga, 38th Ave N Kings Hwy , MB 843-467-5444, ShantiMyrtleBeach.com. Gamblers Anonymous & Gam-Anon−7:30-9pm. Gamblers Anonymous is for the gambler & Gam-Anon is for those affected by the gambler. First Baptist Church, 200 Hwy 17S & 2nd Ave S, MB. Info: Chris or Lou, 843-399-9043.

Ovis Hill Farmers Market in Florence−9am-2pm. Local farm products, grass-fed beef, lamb, poultry, eggs, dairy & seasonal organic vegetables. At parking lot, 2519 W Palmetto St, Florence. Charlie 843-992-9447, OvisHillFarm.com.Power Yoga w/Maribeth MacKenzie or Mimi Rose (rotate)–9am. Be prepared to sweat, build strength and endurance challenging enough for all levels as modifications will be offered for those looking to build their strength and endurance while others may be looking to test it. Inlet Yoga 637D Bellemy Ave., Murrells Inlet. 843 655-6272, InletYogaStudio.com. All levels Open Vinyasa w/Lyndsay Bahn Trimble–10:30-noon. A strong flow of Ashtanga postures focusing on opening and strengthening of the body and mind. Breath and core emphasized. For all levels, be prepared to sweat and detoxify. $15 or class passes accepted. 417 79th Ave N, Suite E MB, [email protected]; 843-333-2656; secretlotusyoga.com.

GROW Your BusinessSecure this special ad placement! Contact us for more information.

843-497-0390


Cabin rentals, motel rooms, RV sites, tent sites, a spa and wellness center, an organic farm, more than 300 animals to delight the kids, troutfishingandthebesthome-cookedmealsavailable anywhere. See ad, page 9.

HYPNOTHERAPY

MAXIMIZED MINDMike Oglesbee, CAH, MPNLP843-957-6926MaximizedMind.com

Mike Oglesbee has developed the most powerful and effective system of treatment for most any chal lenge you may face. Mike utilizes hypnosis, NLP, law of attraction, life coaching, and other traditional

psychology methods to provide immediate positive change within the 90 percent of the mind known as the subconscious where the root of problems actually exist. If you want to create real lasting change with ease, the subconscious mind is where you must go. Call Mike or visit MaximizedMind.com for more information. See ad, page 22.

INTEGRATIVE BODYWORK

WHOLISTIC ALIGNMENTRev. Lindsley Field, CTPCertified Trager® Practitioner & TutorFacilitator of Healing for Body Mind Spirit843-651-1086LindsleyField.com

Receiving a Trager® session feels fantastic, deeply relaxes and rejuvenates and i t ’s uniquely transformational. A licensed Spiritual Counselor/Intuitive, Reiki Master teacher since 1990, Lindsley draws from 20+ years experience

in mind/body energy and emotional healing techniques, including the use of organic, therapeutic grade essential oils. An approved provider of CEUs for massage therapists/bodyworkers, she offers a variety of classes. Self-care and releasing stress are key ingredients to better health and wellness. Free consultations, affordable rates, discount packages. She and her husband, John, combine therapies at Wholistic Alignment. See ad, page 26.

as a chiropractor to educate the public about what true health care is. The main focus of her message: There are no secrets or shortcuts to achieving health, but rather using good sense and knowledge to make the right choices in life. See ad, page 2.

JOHN W. FISHER, DCMurrells Inlet843-651-1086johnwesleyfisher.com

Dr. John W. Fisher graduated from the Palmer College of Chiropractic in 1977 and is the founder of the Balance Chiropractic Technique—advanced methodologies for structural, chemical and

emotional well-being. Incorporated in his practice are allergy elimination, clinical nutrition and neuro-emotional techniques. He specializesindifficultcasesworkingwiththewhole body and has been acclaimed for his adjusting expertise. He and his wife, Lindsley, work together at Wholistic Alignment and offer free consultations. See ad, page 26.

CHURCHES

ALL SOULS METAPHYSICALCHAPELRev. Alma SwartzweiderCoastal Carolina University, Wall Building, Room [email protected]

“God said, I will pour out my spirit upon all flesh” (Acts 2:17). Sunday service healing, 10:45. Worship and message, 11 am. Spiritual counseling and healing readings by appointment. Devine metaphysics expands your understanding of the Bible and your own spirituality. We welcome you to join us and expand your consciousness to accept all humanity just as we are.

ECO-TOURISM RETREATS

ENOTA MOUNTAIN RETREAT1000 Hwy 180Hiawassee, GA 30546800-990-8869706-896-9966www.enota.com

Enota is a family-friendly retreat many say is their best cabin or campground experience ever. The natural springs, hiking trails and rushing waterfalls each hold the promise of adventure.

ACUPUNCTURE

ALTERNATIVE HEALTH CLINICSuzanne Swearengen, DOM, AP4810 N Kings Hwy, MB 843-692-9243AlternativeHealthClinicMB.com

Suzanne Swearengen, AP, Dipl.OM (NCCAOM), is a licensed acupuncture physician and is board certified in both acupuncture and Chinese herbal medicine. In her work, she strives to provide

compassionate care for individuals seeking wholistic solutions for ailments, illnesses and maintenance of good health. Additional modalities include, but are not limited to, craniosacral therapy, homeopathic medicine and cold laser. Over the course of 15 years, she has developed her professional skills through credited courses and seminars in order to best serve her patients. See ad, page 2.

BONE HEALTH

HEIDI McGOVERN, PTGuild Certified Feldenkrais® PractitionerBones for Life® Teacher/[email protected]

One can always improve posture and mobility. Bones for Life® and Awareness Through Movement® classes, work shops and p r iva t e Funct ional In tegra t ion® sessions are offered on the

Strand and Florence. CE units available for “Bones” workshops. Heidi brings to her practice 30 years experience and a strong focus on the human drive to live a life of harmony with one’s self and others. See ad, page 28.

CHIROPRACTIC

ALTERNATIVE HEALTH CLINICLinda Audino, DC4810 N Kings Hwy, MB 843-692-9243AlternativeHealthClinicMB.com

A g r a d u a t e o f Pa l m e r Chiropract ic Col lege in 1994, Dr. Linda Audino has practiced in New York, New Jersey, Arizona, and, in South Carolina, since 2003. She has treated newborns to geriatrics

and everyone in between. It is Audino’s desire

communityresourceguideConnecting you to the leaders in natural health care and green living in our community. To find out how you can

be included in the Community Resource Guide, email [email protected] to request a media

kit, or visit our website at GrandStrandHealthyLiving.com.


Dr. Melody Iles is a naturapathic practitioner who listens to you and carefully examines your fingernails,tongueandeyestodistinguishthehealth of organs and body systems. She then suggestsspecificfoods,herbsandsupplementsto help place your body in a state of healing.

NATURAL INFANT AND CHILDREN’S PRODUCTS

HOLISTIC PARENTInside Bella Baby7269 Hwy 707, north of Big Block RdMyrtle BeachHolisticParent.com

Holistic Parent carries products that are good for you, the environment and your budget. They are reusable, long lasting and most importantly products you need. They have been tried, tested and loved by our family and friends. Some of our products include Klean Kanteen, Boppy pillows, Moby Wraps, Boba baby carriers, Itzy Ritzy, Lusa Organics, cloth and swim diapers, mama cloth, toys and more. We are located inside Bella Baby, the only cloth diaper shop on the Grand Strand. Together we can meet all your natural product needs.

NATURAL WELLNESS CENTER

CLEANSING POWER AT THE BEACHSusan Bullin, CNHP211 Hwy 17 N, Ste 201, NMB843-427-7263

When I opened Cleansing Power at the Beach my vision was that it would evolve into an all-natural wellness center, and we are growing at a rapid pace to fulfill the vision.Weeducate our clients on how natural lifestyle approaches

can facilitate the body’s healing potential. We learned that symptoms are signs of an underlying imbalance due to improper nutrition, rest and stress management which over time result in weakening the body. I have a personal testimony to how the things I have incorporated in my business have helped me, and I would love to help you. See ad, page 29.

PEST CONTROL

AAA PEST CONTROLJoseph DavisGrand Strand843-333-5790AAAPestControlOnline.com

I t ’s no secret that heavy chemical pesticide use can be damaging to the health of our families, pets and environment. Nobody wants their home and yard covered in poisons.We specialize in low-impact

organic and green solutions at an affordable

MARTIAL ARTS

DEAN [email protected]

Students of martial arts and qigong often show stress relief, reduction in body weight and improvement in their overall health and well-being. Learn from a master with more than 40 years experience the ancient

arts of tai chi, qigong, jujitsu, karate, samurai sword and other various weapons. Take control and call Dean Sutzer today.

MASSAGE THERAPY

SANDRA HALES MASSAGETHERAPYSandra Hales, LMBT7246 Beach Dr, Ste 2Ocean Isle Beach, [email protected] Sandra Hales has been practicing massage therapy since 1993. She is a graduate of Body Therapy Institute and has practiced Reiki since 1986. She is also certified in prenatalmassage and offers swedish and deep tissue. Giftcertificatesareavailable.Massagesessionsby appointment. Visit the website for more information. “It’s Nice to Be Kneaded.”

NATURAL CHILDBIRTH

BEACH BABY’S DOULA SERVICES INCPat Burrell, RN, CD, (DONA), WCBE, CLC,CHT843-213-1393BeachBabys.org

Beach Baby’s provides services to assist families throughout p r e g n a n cy, a s w e l l a s assistance with caring for baby after birth. It provides doula services and baby nurses in Horry, Georgetown and Marion

counties. Its services also include rebirthing, wholistic childbirth education and massage. See ad, page 8.

NATURAL HEALTH COUNSELING

MELODY ILES PhD315 Main St, Ste 6 (Upstairs), Conway4810 N Kings Hwy, Myrtle Beach843-446-0293 [email protected]

If you are living with pain, chronic illnesses, mental fogginess or poor health conditions that never seem to resolve, it’s time to look at natural solutions and wholistic care to optimize your health.

cost. Safe for you, your children, pets and the planet. See ad, page 8.

PSYCHOTHERAPY

KENNETH LUX, PhDAlternative Health Clinic4810 N Kings Hwy, MB843-712-2330

I work with individuals and couples. My approach is in the general area of what is called Transpersonal Psychology, which means healing beyond the personal or ego self. It is also specifically referred to a s “Ka rma Sens i t ive

Psychotherapy.” It uses a natural conversational methodology that is not based on what is called the medical model, with its disease categories, and has little or no need for psych drugs. Call me for a free phone consultation.

SHAMANIC SERVICES

REV. DR. CRAIG TALBOTOne Who Talks to Doves 843-957-3306

Dr. Craig Talbot is a trained Shamanic counselor and recognized medicine chief of eight Native tribes in South Carolina. Offering The 7 Sacred Rites of the Peoples, smudgings, pipe circles, drum circle, spirit circle, teacher of the medicine way, traditional teepee demonstrations, ordained minister for wedding ceremonies, carrier of the sacred bundle. How may I serve you?

WATER HEALTH

RAYMOND OWENSKangen Water Independent Distributor843-833-1773 or 843-527-8681

In my wildest dreams, I never thought that at 72, drinking water could clean the plaque from my arteries, dissolve kidney stones and repair my health, until I researched ionized water. With a body pH of 7.0 or higher cancer cannot

survive. See ad, page 9..

WELLNESS COACH

LINDA SACCHETTIPersonal Wellness CoachMurrells Inlet 843-424-9586 or 843-651-9350

As a personal wellness coach, Linda Sacchetti has served the Grand Strand for seven years. My mission is teaching nutrition to promote health and well-being. I provide many services: weight-loss challenge facilitating, wellness

evaluations, free metabolism tests, healthy breakfast in-services for businesses, and free


personal 1-1 coaching for weight loss or weight gain. Join my team! Training provided. See ad, page 25..

YOGA

CAROLINA POWER YOGA769 Main StNorth Myrtle Beach843-877-5839CarolinaPowerYoga.com

Carolina Power Yoga specializes in inspiring Power Vinyasa yoga, Hot yoga, Gentle yoga, and Beach yoga. An uplifting Power Vinyasa class links breath with asanas, flowing throughsun salutations, backbends, inversions, restorative, and

balancing poses. Vinyasa yoga harmonizes the body, mind and spirit while achieving optimal health, and cultivating compassion, peace, energy and joy. “Health is the greatest gift, contentment the greatest wealth, faithfulness the best relationship.” ~Buddha

INLET YOGA STUDIO637 D Bellamy Rd, Murrells Inlet843-655-6272InletYogaStudio.com

Breathe. Empower. Transform. Inlet Yoga is dedicated to serving yoga students at every level of their personal practice,offering classes seven days a week, from beginner to

advanced. Classes include: Ashtanga, Power, Vinyasa,Slowflow,YogaforGolfandSports,Iyengar, Restorative and Hot. $5 Community Class at 6pm Fridays benefits the Coastal Animal Rescue of Murrell’s Inlet. Come breathe, empower and transform yourself through practice. See ad,page 10.

ISLAND WAVE YOGA10555 Unit-A, Ocean Hwy 17Pawleys Island843-314-3206IslandWaveYoga.comFacebook: Island Wave Yoga

Island Wave Yoga offers a welcoming space for both those who know yoga and those who want to know yoga. Classes are drop-in, and series passes and memberships are available. Classes include Lava

Flow, Beginners, Intro & Mixed Flow, Ashtanga, Family Fun, Power, Yoga for Golf & Sports, $5 Community, Relax & Renew. Workshops include YOGA 101, Prenatal, Chair, Meditation, and YIN. Island Wave Life retail carries prAna activewear, Manduka mats and props, Om Sweet Om Jewelry, books and more.

SECRET LOTUS YOGA &HEALING ARTS 417 79th Avenue N, Ste E (upstairs)Myrtle Beach843-333-2656SecretLotusYoga.com

Secret Lotus offers Ashtanga-based yoga classes ranging from beginner to advanced, challenging the breath, mind and body to connect in a powerful union. Brand new or experienced practitioners

welcome! In addition to Ashtanga classes, we offerAshtanga-influencedprenatal,gentleandMommy & Me yoga. Also offering massage and Reiki.Mentionthisadandyourfirstclassisfree.

SHANTI YOGA3901 N Kings Hwy, Ste 20-A843-467-5444ShantiMyrtleBeach.com

Shanti Yoga offers Ashtanga (led and mysore), Vinyasa and Hot yoga classes. Free community class every Sunday; all donations benefit h.e.a.r.t.of Myrtle Beach. Each class explores breath, movement

and perception. Emphasis on both theory and practice provides students with the necessary foundation to expand in a personal and profound way.

THE YOGA ROOMHEALING ARTS CO-OP196C Stonebridge Dr, MB843-450-9402MyrtleBeachYogaRoom.com

The Yoga Room Healing Arts Co-op is shared by practitioners trained to enhance, encourage and empower you on your path to well-being. The modalities we offer support you in this process by gently assisting you

in awakening your own healing abilities. We offer several styles of yoga, tai chi, kung fu, sound healing, Trager® Mentastics, Reiki, and life/wellness coaching. See our ad and visit our website, MyrtleBeachYogaRoom.com. See ad, page 12.

YOGA IN COMMON3080 DeVille St (same as cinema)The Market Common, MB843-839-9636, 843-385-6176YogaInCommon.com

YOGA in COMMON offers classes during a wide variety of hours, seven days per week. We welcome all students—new or those returning to yoga. Our schedule is also great for those who want to practice daily. Visit our website or follow

us on Facebook to keep up with our wellness gatherings and special events.

For more information about advertising and how you can participate, call

843-497-0390

WOMEN’S WELLNESS

The Latest GreatTips and

Technologies for Aging

Beautifully

Experience Life at its Best

Coming in May

Grand Strand 0412

Documents

Transcript of Grand Strand 0412