The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

48
The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza

Transcript of The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Page 1: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

The Greedy Prepend Algorithm for Decision List Induction

Deniz Yuret

Michael de la Maza

Page 2: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Overview

• Decision Lists

• Greedy Prepend Algorithm

• Opus search and UCI problems

• Version space search and secondary structure prediction

• Limited look-ahead search and Turkish morphology disambiguation

Page 3: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Introduction to Decision Lists

• Prototypical machine learning problem:– Decide democrat or republican for 435

representatives based on 16 votes.

Class Name: 2 (democrat, republican)1. handicapped-infants: 2 (y,n)2. water-project-cost-sharing: 2 (y,n)3. adoption-of-the-budget-resolution: 2 (y,n)4. physician-fee-freeze: 2 (y,n)5. el-salvador-aid: 2 (y,n)6. religious-groups-in-schools: 2 (y,n)…16. export-administration-act-south-africa: 2 (y,n)

Page 4: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Introduction to Decision Lists

• Prototypical machine learning problem:– Decide democrat or republican for 435

representatives based on 16 votes.

1. If adoption-of-the-budget-resolution = y and anti-satellite-test-ban = n and water-project-cost-sharing = y then democrat2. If physician-fee-freeze = y then republican3. If TRUE then democrat

Page 5: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Alternative Representations

• Decision trees:

Page 6: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Alternative Representations

• CNF:

• DNF:

Page 7: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Alternative Representations

• For 0 < k < n and n > 2,

k-CNF(n) U k-DNF(n) is a subset of k-DL(n)

• For 0 < k < n and n > 2,

k-DT(n) is a subset of k-CNF(n) ∩ k-DNF(n)

• k-DT(n) is a subset of k-DL(n)

Rivest 1987

Page 8: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Overview

• Decision Lists

• Greedy Prepend Algorithm

• Opus search and UCI problems

• Version space search and secondary structure prediction

• Limited look-ahead search and Turkish morphology disambiguation

Page 9: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Decision List Induction

• Start with an empty decision list or a default rule.

• Keep adding the best rule that covers the unclassified and misclassified cases.

Design Decisions:

• Where to add the new rules (front, back)

• Criteria for best rule

• Search algorithm for best rule

Page 10: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

The Greedy Prepend Algorithm

GPA(data)1. dlist = NIL2. default-class = most-common-class(data)3. rule = [ if true then default-class ]4. while gain(rule, dlist, data) > 05. do dlist = prepend(rule, dlist)6. rule = max-gain-rule(dlist, data)7. return dlist

Page 11: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

The Greedy Prepend Algorithm

• Starts with a default rule that picks the most common class

• Prepends subsequent rules to the front of the decision list

• The best rule is the one with maximum gain (increase in number of correctly classified instances)

• Several search algorithms implemented

Page 12: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Rule Search

• The default rule predicts all instances to belong to the most common category

+ -

Correct

Assignments

Partition with respect to the

Base Rule

False Assignments

Training Set

Page 13: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Rule Search

• At each step add the maximum gain rule

+ -

+

+

-

-

Partition with respect to the Decision List

Partition with respect to the

Next Rule

Page 14: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Overview

• Decision Lists

• Greedy Prepend Algorithm

• Opus search and UCI problems

• Version space search and secondary structure prediction

• Limited look-ahead search and Turkish morphology disambiguation

Page 15: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Opus Search: Simple tree

Page 16: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Opus Search: Fixed order tree

Page 17: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Opus Search: Optimal pruning

Page 18: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

GPA-Opus on UCI Problems

Page 19: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Overview

• Decision Lists

• Greedy Prepend Algorithm

• Opus search and UCI problems

• Version space search and secondary structure prediction

• Limited look-ahead search and Turkish morphology disambiguation

Page 20: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

A Generic Prediction Algorithm: Sequence to Structure

MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGD??????????????????????????????????????

Page 21: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

A Generic Prediction Algorithm: Sequence to Structure

MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGD-?????????????????????????????????????

Page 22: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

A Generic Prediction Algorithm: Sequence to Structure

MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGD-?????????????????????????????????????

Page 23: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

A Generic Prediction Algorithm: Sequence to Structure

MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGD--????????????????????????????????????

Page 24: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

A Generic Prediction Algorithm: Sequence to Structure

MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGD--????????????????????????????????????

Page 25: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

A Generic Prediction Algorithm: Sequence to Structure

MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGD---???????????????????????????????????

Page 26: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

A Generic Prediction Algorithm: Sequence to Structure

MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGD----H-----????????????????????????????

Page 27: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

A Generic Prediction Algorithm: Sequence to Structure

MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGD----H-----H???????????????????????????

Page 28: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

A Generic Prediction Algorithm: Sequence to Structure

MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGD----H-----H???????????????????????????

Page 29: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

A Generic Prediction Algorithm: Sequence to Structure

MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGD----H-----HH??????????????????????????

Page 30: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

A Generic Prediction Algorithm: Sequence to Structure

MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGD----H-----HHHHHHHHHH------EEEEE------?

Page 31: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

A Generic Prediction Algorithm: Sequence to Structure

MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGD----H-----HHHHHHHHHH------EEEEE-------

Page 32: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

GPA Rules

• The first three rules of the sequence-to-structure decision list – 58.86% performance (of 66.36%)

Page 33: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

GPA Rule 1

• Everything => Loop

Page 34: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

GPA Rule 2

        HELIX        

L4 L3 L2 L1 0 R1 R2 R3 R4

* * !GLY !GLY !ASN !GLY !PRO !PRO !PRO

      !PRO !GLY !PRO      

        !PRO        

        !SER        

               

        (Non-polaror large)        

Page 35: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

GPA Rule 3

        STRAND        

L4 L3 L2 L1 0 R1 R2 R3 R4

!LEU !ALA !ASP !ALA CYS !PRO !ARG !LEU !LEU

!LEU

!GLN 

!ASP ILE !GLN !MET  !MET

   

!GLU 

!GLY LEU !GLU  

      !PRO PHE !LYS  

      TRP !PRO  

        TYR

 (Non-Polar and Not

Charged)

   

        VAL      

        (Non-polar)      

Page 36: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

GPA-Opus not feasible for secondary structure prediction

• 9 positions

• 20 possible amino-acids per position

• Size of rule space:– With only pos=val type attributes: 21^9– If we include disjunctions: 2^180

Page 37: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

GPA Version Space Search

Searching for a candidate rule:• Pick a random instance• If the instance is currently misclassified

and candidate rule corrects it: generalize candidate rule to include instance

• If the instance is currently correct and candidate rule changes classification: specialize candidate rule to exclude instance

Page 38: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

GPA Secondary Structure Prediction Results

• PhD 72.3

• NNSSP 71.7

• GPA 69.2

• DSC69.1

• Predator 69.0

Page 39: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Overview

• Decision Lists

• Greedy Prepend Algorithm

• Opus search and UCI problems

• Version space search and secondary structure prediction

• Limited look-ahead search and Turkish morphology disambiguation

Page 40: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Morphological Analyzer for Turkish

masalı• masal+Noun+A3sg+Pnon+Acc (= the story)• masal+Noun+A3sg+P3sg+Nom (= his story)• masa+Noun+A3sg+Pnon+Nom^DB+Adj+With (= with

tables)

• Oflazer, K. (1994). Two-level description of Turkish morphology. Literary and Linguistic Computing

• Oflazer, K., Hakkani-Tür, D. Z., and Tür, G. (1999) Design for a turkish treebank. EACL’99

• Kenneth R. Beesley and Lauri Karttunen, Finite State Morphology, CSLI Publications, 2003

Page 41: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Features, IGs and Tags

• 126 unique features• 9129 unique IGs

• ∞ unique tags• 11084 distinct tags observed

in 1M word training corpus

masa+Noun+A3sg+Pnon+Nom^DB+Adj+With

stemfeatures features

inflectional group (IG) IGderivationalboundary

tag

Page 42: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Morphological disambiguation

• Task: pick correct parse given context1. masal+Noun+A3sg+Pnon+Acc

2. masal+Noun+A3sg+P3sg+Nom

3. masa+Noun+A3sg+Pnon+Nom^DB+Adj+With

– Uzun masalı anlat Tell the long story– Uzun masalı bitti His long story ended– Uzun masalı oda Room with long table

Page 43: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Morphological disambiguation

• Task: pick correct parse given context1. masal+Noun+A3sg+Pnon+Acc

2. masal+Noun+A3sg+P3sg+Nom

3. masa+Noun+A3sg+Pnon+Nom^DB+Adj+With

Key Idea

Build a separate classifier for each feature.

Page 44: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

GPA on Morphological Disambiguation

1. If (W = çok) and (R1 = +DA)

Then W has +Det

2. If (L1 = pek)

Then W has +Det

3. If (W = +AzI)

Then W does not have +Det

4. If (W = çok)

Then W does not have +Det

5. If TRUE

Then W has +Det

• “pek çok alanda”(R1)

• “pek çok insan”(R2)

• “insan çok daha”(R4)

Page 45: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

GPA-Opus not feasible

Attributes for a five word window:• The exact word string (e.g. W=Ali'nin)• The lowercase version (e.g. W=ali'nin)• All suffixes (e.g. W=+n, W=+In, W=+nIn,

W=+'nIn, etc.)• Character types (e.g. Ali'nin would be

described with W=UPPER-FIRST, W=LOWER-MID, W=APOS-

MID, W=LOWERLAST)

Average 40 features per instance.

Page 46: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

GPA limited look-ahead search

• New rules are restricted to adding one new feature to existing rules in the decision list

Page 47: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

GPA Turkish morphological disambiguation results

• Test corpus: 1000 words, hand tagged

• Accuracy: 95.87% (conf. int: 94.57-97.08)

• Better than the training data !?

Page 48: The Greedy Prepend Algorithm for Decision List Induction Deniz Yuret Michael de la Maza.

Contributions and Future Work

• Established GPA as a competitive alternative to SVM’s, C4.5 etc.

• Need theory on why the best-gain rule does well.

• Need to study robustness to irrelevant or redundant attributes.

• Need to speed up the application of the resulting decision lists (convert to FSM?)