Molecular Pharmacology Fast Forward. Published on November...
Transcript of Molecular Pharmacology Fast Forward. Published on November...
MOL #83337
Title Page
Title: “Dynorphin – Still an Extraordinarily Potent Opioid Peptide”
Charles Chavkin
Department of Pharmacology
Box 357280
University of Washington
Seattle, WA 98195
Molecular Pharmacology Fast Forward. Published on November 14, 2012 as doi:10.1124/mol.112.083337
Copyright 2012 by the American Society for Pharmacology and Experimental Therapeutics.
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
2
Running Title: Enduring Impact of Avram Goldstein’s Discovery of Dynorphin
Address correspondence to:
Dr. Charles Chavkin
Department of Pharmacology
Box 357280
University of Washington
Seattle, WA 98195
206-543-4266 (v)
206-685-3822 (f)
Text pages: 5.5
Figures: 2
Tables: 1
References: 99
Abstract: 250 words
Text: 4070 words
Abbreviations: guinea pig ileum, GPI; mouse vas deferens, MVD; equilibrium dissociation constant
derived from Schild analysis, Ke; [D-Ala2,D-Leu5]-enkephalin, DADLE; �-chlornaltrexamine, �-CNA;
extracellular signal-regulated kinase, ERK; mitogen-activated protein kinase, MAPK; norbinaltorphimine
(17,17'-(dicyclopropylmethyl)-6,6',7,7'-6,6'-imino- 7,7'-bimorphinan-3,4',14,14'-tetrol), norBNI; ((3R)-7-
Hydroxy-N-[(2S)-1-[(3R,4R)-4-(3-hydroxyphenyl)-3,4-dimethylpiperidin-1-yl]-3-methylbutan-2-yl]-
1,2,3,4-tetrahydroisoquinoline-3-carboxamide), JDTic; c-Jun N-terminal kinase 1, JNK1.
Abstract:
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
3
Abstract:
This issue of Molecular Pharmacology is dedicated to Dr. Avram Goldstein, the journal’s founding Editor
and one of the leaders in the development of modern pharmacology. This chapter focuses on his
contributions to the discovery of the dynorphins and evidence that members of this family of opioid
peptides are endogenous agonists for the kappa opioid receptor. In his original publication describing the
purification and sequencing of dynorphin A, Avram described this peptide as ‘extraordinarily potent’ (‘dyn’
from the Greek, dynamis = power and ‘–orphin’ for endogenous morphine peptide). The name originally
referred to its high affinity and great potency in the bioassay that was used to follow its activity during
purification, but the name has come to have a second meaning: Studies of its physiological function in
brain continue to provide powerful insights to the molecular mechanisms controlling mood disorders and
drug addiction. In the 30 years since its discovery, we have learned that the dynorphin peptides are released
in brain during stress exposure. Once released, they activate kappa opioid receptors distributed throughout
the brain and spinal cord where they trigger cellular responses resulting in different stress responses:
analgesia, dysphoria-like behaviors, anxiety-like responses, and increased addiction behaviors in
experimental animals. Avram predicted that a detailed molecular analysis of opiate drug actions would
someday lead to better treatments for drug addiction, and he would be gratified to know that subsequent
studies enabled by his discovery of the dynorphins resulted in insights that hold great promise for new
treatments for addiction and depressive disorders.
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
4
Introduction
It is appropriate that this issue of Molecular Pharmacology is dedicated to Dr. Avram Goldstein,
who died June 1, 2012 one month short of his 93rd birthday. Avram was the journal’s founding Editor in
1965, and he was major force in the development of modern molecular pharmacology through his textbook,
“Principles of Drug Action”, written with Lewis Aronow and Sumner Kalman, and first published in 1968
(Goldstein et al., 1968). In his long career as a professor of pharmacology at Stanford University, he made
numerous contributions to neuroscience, but perhaps he is best known for his leadership in the study of
drug addiction where he applied biochemical principles to the understanding of opiate and nicotine drug
actions, sociological approaches to an understanding of the impacts of drug addiction on our communities,
and treatment research designed to identify more effective addiction therapies. In this brief review, I focus
on his studies in their historical context and describe some of their continuing implications and
ramifications.
Discovery
The 1970’s and 80’s were a golden era of neuropeptide discovery that dramatically changed our
conceptions of neurotransmitter structure and function. The presence of endogenous morphine-like
substances in brain was first reported by Terenius and Walstrom (1974), using a radioligand binding
method first suggested by Avram Goldstein and colleagues (Goldstein et al., 1971). Subsequently, John
Hughes and Hans Kosterlitz succeeded in identifying the first endogenous opioid peptides: methionine and
leucine enkephalin (Hughes et al., 1975). Also in 1975, Avram Goldstein and colleagues detected peptide-
like opioid activity(s) in bovine and porcine pituitary extracts (Teschemacher et al., 1975; Cox et al., 1975).
Shortly afterwards, C-H Li and David Chung reported the sequence of a 31 amino acid polypeptide, β-
endorphin isolated from pituitary extracts having homology with methionine enkephalin (Li & Chung,
1976) and demonstrated its opioid receptor activity with the help of Brian Cox and Avram Goldstein (Cox
et al., 1976). The highly basic fraction of the pituitary extracts (originally supplied by J.D. Fisher, Armour
Pharmaceuticals as by-products of commercial corticotropin production, also contained a different, trypsin-
sensitive opioid activity that gave a slower onset of action and reversed more slowly than previously
described opioid peptides (Cox et al., 1975). The latter opioid peptide was ultimately purified, sequenced
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
5
and named dynorphin-A (a 17 amino acid polypeptide having homology with leucine enkephalin)
(Goldstein et al., 1979; Goldstein et al., 1981). In parallel, Hisayuki Matsuo and colleagues were isolating a
different group of opioid peptides from porcine hypothalami (Kangawa et al., 1979), and determined the
complete sequence of α-neo-endorphin shortly later (Kangawa et al., 1981). The sequence of a precursor
polypeptide containing dynorphin-A followed by a second related sequence, dynorphin B was next
described (Fischli et al 1982). The same 13 amino acid, dynorphin B sequence was also isolated from
bovine pituitary and named ‘rimorphin’ (Kilpatrick et al., 1982) (Table 1). In addition two c-terminally
extended forms of dynorphin B (big-dynorphin and leumorphin) were described (Fischli et al., 1982;
Kilpatrick et al., 1982). During this time, powerful new methods of neuropeptide detection, purification and
sequence identification were being developed that greatly enhanced the rate of discovery of many other
neuropeptides in brain and fundamentally changed our conception of neuro-signaling.
Intense effort by many groups at the time was devoted to identifying other members of this family
of opioid peptides, discovering the biosynthetic pathways involved, and describing the structural
relationships between these neuropeptides. This effort culminated in the cloning and sequencing of the
cDNAs for corticotropin-β-lipotropin (the β-endorphin precursor) (Nakanishi et al., 1978),
preproenkephalin (the precursor of methionine and leucine enkephalins) (Noda et al., 1982), and
preprodynorphin (the precursor for dynorphin A(1-17), dynorphin-A(1-8), dynorphin B(1-13), α-neo-
endorphin, β-neo-endorphin, big-dynorphin and leumorphin) (Kakidani et al., 1982) (Table 1). Since that
time, the neurophysiological actions of these opioid peptides have been the subject of considerable research
effort: enkephalins (6143 citations), endorphins (9042 citations), and dynorphins (2395 citations), with no
evidence of slowing (see Schwarzer, 2009).
The rapid pace of the initial descriptions of these peptides (less than 8 years from an initial
suggestion of their existence in 1974 to the full characterization of their primary structures, biosynthesis
and brain-distributions in 1982) led to great optimism that their roles in nociception, opiate addiction, and
mental health would soon follow. In his ‘Nathan B. Eddy Award’ lecture (1981), Avram speculated that
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
6
opiate addiction is associated with a disturbed regulation of an endogenous opioid, but concluded that
promising studies of the functions of the endogenous opioids including dynorphin were only just beginning.
Receptors
Perhaps with the benefit of hindsight and following the cloning of the three opioid receptor genes
in 1992-1993, the conceptual struggles to define the nature of the opiate receptor and distinguish multiple
forms of the receptor during the preceding decades may seem overblown. But contemporaneous with the
struggle to define the structures and properties of the endogenous opioid peptides, an intense effort was
devoted to the characterization of the receptors mediating their actions. In reality, this struggle continues to
this day since the roles of receptor splice variants and hetero-oligomeric forms of the receptors are still not
resolved (see Rozenfeld & Devi 2011; Barrie et al., 2012 for recent reviews). In addition, new concepts of
functional selectivity and ligand-directed signaling (Urban et al., 2007; Bruchas & Chavkin, 2010) also
cloud any simple definition of opioid receptor types. The original conception of a monomeric seven-
transmembrane protein, free-floating in the membrane to interact with heterotrimeric G-proteins has been
replaced by a more nuanced, multicomponent macromolecular complex combining the receptor, accessory
proteins, and signaling effectors whose tissue-specific composition may influence the ligand binding
properties and functional consequences of opioid receptor activation. Nevertheless, Avram Goldstein made
important contributions to the characterization of opioid receptors in the 1970’s and 80’s described below.
The existence of a specific opiate receptor had already been postulated by A.H. Beckett and A.F.
Casy (1954) based on their analysis of the stereochemistry of morphine-type analogs and the structural
properties of opiate antagonists. Differences in the modes of drug-receptor interactions had also been noted
by Phil Portoghese who postulated the existence of opiate receptor ‘dualism’ (Portoghese, 1965). These
multiple opioid receptor concepts were refined by Bill Martin and colleagues who proposed the existence
of distinct mu, sigma, and kappa receptors based on differences in the physiological responses (e.g. miosis,
bradycardia, etc) and cross-tolerance between classes of opiate drugs (Martin et al., 1976). Strong evidence
for multiple opioid receptors was also provided by the studies by Hans Kosterlitz and colleagues who
distinguished differences between mu, delta and kappa type opioid actions in the in vitro smooth muscle
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
7
contraction bioassays (Lord et al., 1977). In vitro bioassays had advantages over behavioral
pharmacological measures because pharmacokinetic and metabolic differences between drugs are less
likely to confound the biological response. In the Lord et al. (1977) study, potencies in radioligand
displacement in guinea pig brain membrane binding assays were compared to agonist potencies in the
guinea pig ileum (GPI) and mouse vas deferens (MVD) bioassays. The sensitivities to naloxone-
antagonism of the different agonists were particularly revealing: mu-type agonists were equally sensitive to
naloxone in GPI and MVD (naloxone Ke = ~2 nM); whereas naloxone was 10 fold less potent in blocking
the effects of the enkephalins in MVD than GPI (naloxone Ke = ~22 nM vs. ~2 nM). They interpreted these
data as suggesting that enkephalins activated mu receptors in GPI and delta receptors in MVD.
Interestingly, they also noted that opiates in the class of drugs Martin called ‘kappa’ were less sensitive to
naloxone than mu-type opiates in both MVD and GPI (naloxone Ke = ~9-15 nM).
These in vitro bioassay results provided strong support for the concept of physically distinct types
of opioid receptors, but alternative interpretations were still plausible. Specifically, a competing concept at
the time was that the opioid receptor was a single binding protein that adopted different conformations
depending on interactions with auxiliary proteins. Evidence supporting the concept of interconverting
receptor states was provided by Candace Pert’s group who suggested that the opioid receptor could adopt
different conformations based on allosteric interactions (Bowen et al., 1981). This latter idea is not
fundamentally different from how we currently view the effects of receptor dimerization on ligand
potencies (Jordan & Devi (1999), where opioid drug potencies and efficacies depend on which receptors
(e.g. kappa:delta, kappa:kappa or kappa:mu) are physically associated.
It was in this historical context that the initial characterization of dynorphin-A(13) actions in the
GPI assay were performed (Goldstein et al., 1979). Although the dynorphin-A(1-13) fragment was
extraordinarily potent in the guinea pig ileum bioassay (>700 times more potent than leucine enkephalin),
its effects were 1/13th as sensitive to naloxone antagonism in this assay. The lower sensitivity to naloxone
was shared by ethylketocyclazocine, a drug related to ketocyclazocine which is the prototype used by Bill
Martin and colleagues to propose the existence of mu, kappa, and sigma type opioid receptors. In the MVD
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
8
assay, dynorphin A(1-13) was 3 times more potent than leucine enkephalin, and the effects of both peptides
were substantially less sensitive to naloxone antagonism. Strong conclusions about the relationship between
the ‘dynorphin receptor’ and other possible receptor forms were not made in the 1979 paper: “If this tissue
contains more than one type of opiate receptor, it follows that the [Leu]enkephalin receptor is different
from the dynorphin receptor with respect to affinity both for these peptide ligands and for naloxone.”
(Goldstein et al., 1979). This conservative stance was presumably because the two principal competing
conceptions: ‘physically distinct opioid receptor types’ and ‘interconverting conformations of a single
opioid receptor’ had not been convincingly resolved.
There next followed a period of intense examination of the properties of the ‘dynorphin receptor.’
Michael Wuster and Rudiger Schulz (1980c) suggested that dynorphin receptor was the kappa receptor
based on further comparison of potassium-sensitivities between dynorphin-A(1-13) and kappa opioid
effects in the MVD assay. Others drew attention in print to the resemblance between the dynorphin
receptor and the kappa-type receptor (Huidobro-Toro et al., 1981; Yoshimura et al., 1981; Oka et al., 1982),
but these studies re-iterated the previously established resemblance between dynorphin-A(1-13) and kappa-
type opioids in their sensitivity to antagonists in bioassay without resolving the fundamental relationship.
Efforts to resolve this question using radioligand binding assay were also published. Remi Quirion &
Candace Pert (1981) found that dynorphin-A(1-17) and dynorphin-A(1-13) did not have different affinities
for mu, delta and kappa binding sites in rat striatum labeled with [3H]-dihydromorphine, [3H]-[D-Ala2, D-
Leu5]enkephalin and [3H]-ethylketocyclazocine, respectively. Andreas Pfeiffer & Albert Herz (1982)
developed a computer curve-fitting technique to resolve the radioligand binding sites and concluded that
dynorphin-A(1-13) had highest affinity for the [3H]-ethylketocyclazocine binding site; Corbett et al. (1982)
did a similar analysis to show that dynorphin A(1-8) and dynorphin A(1-9) also had their highest binding
affinity for the [3H]-ethylketocyclazocine site. Radioligand binding is a powerful tool, but has intrinsic
limits; specifically the conformation of the opioid receptor binding site (and thus its ligand selectivity) is
strongly affected by assay temperature and concentrations of sodium ions, GTP, and buffer molarity
(Simon & Groth, 1975; Werling et al., 1984), none of which are within the physiologic range in the
radioligand competition assays typically used.
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
9
A more persuasive strategy was developed by Michael Wuster, Rudiger Schulz and colleagues
(Wuster et al., 1980a; 1981) who used a selective tolerance approach to distinguish opioid receptors in the
MVD. Mice were implanted with osmotic minipumps that delivered either the stable analogue [D-Ala2,D-
Leu5]-enkephalin (DADLE) or the potent and selective mu agonist sufentanil for 6 days prior to isolating
the vas deferens tissue for organ bath bioassays. Pretreatment with DADLE selectively reduced the potency
of delta-type agonists without affecting dynorphin or mu-type agonists, and pretreatment with sufentanil
selectively reduced the potencies of mu-type agonists without affecting delta-type or dynorphins.
Surprisingly in retrospect, the simultaneous infusion of DADLE and sufentanil strongly shifted the potency
of ketocyclazocine in MVD without affecting the potency of dynorphin A(1-13) (Wuster et al., 1980a,b).
Pretreatment with the more selective kappa opioid ethylketocyclazocine shifted the potency of α-
neoendorphin but had only a weak effect on dynorphin-A(1-13) potency in MVD (Wuster et al., 1981;
Schulz et al., 1982). These studies provided important evidence that the receptors mediating the effects of
mu, delta and kappa opioids in MVD could be distinguished by selective-tolerance methods and that
dynorphin-A(1-13) and α-neoendorphin likely acted through the kappa opioid receptor. However, issues of
incomplete cross-tolerance between dynorphin and ethylketocyclazocine and uncertainty about the
molecular mechanisms of tolerance remained to be resolved.
Contemporaneously, Avram felt that the ‘interconverting states’ and ‘physically distinct forms’
alternative conceptions needed to be directly addressed before conclusions about the nature of the
dynorphin receptor could be made. For this purpose, we adopted a selective-receptor protection strategy
using the nitrogen mustard analog of naltrexone, β-chlornaltrexamine (β-CNA) that had recently been
developed by Phil Portoghese and colleagues (1978). β-CNA is a site-directed alkylating agent that
covalently binds to the opioid receptor(s) and nonselectively inhibits the effects of all classes of opioid
agonists. By pretreating with either the stable enkephalin analog, DADLE or dynorphin-A(1-13) prior to β-
CNA treatment, we were able to selectively protect from inactivation either the dynorphin receptors or the
enkephalin receptors present in the GPI (Chavkin & Goldstein, 1981a). Because the receptors protected by
dynorphin remained dynorphin-selective for hours after washing out the β-CNA and did not interconvert,
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
10
we could conclude that receptors were physically distinct (Figure 1). We went on to show that selective
protection with dynorphin A(1-13) equally protected the receptors in GPI mediating the effects of
dynorphin and ethylketocyclazocine without protecting leucine-enkephalin or normorphine’s potency
(Chavkin et al., 1982). The selective protection studies also revealed that ethylketocyclazocine preferred
the kappa receptor, but was not as selective as dynorphin-A(1-13). The lack of strong receptor specificity
of ethylketocyclazocine helped explain some of the ambiguous results obtained in the selective tolerance
studies cited above. Selective protection had been previously used by Robson and Kosterlitz (1979) and
Smith and Simon (1980) to resolve delta and mu binding sites in brain homogenate binding assays. Our
1981 study extended those findings by distinguishing mu and dynorphin receptors in a functional opioid
receptor bioassay, and the 1982 study strongly supported the concept that the dynorphin A was an
endogenous ligand for a physically distinct, non-interconverting kappa opioid receptor.
Interestingly, low doses of β-CNA produced a parallel shift in the agonist dose-response curves in
the GPI assay suggesting for the first time that spare opioid receptors could control opioid sensitivity in
tissue (Chavkin & Goldstein, 1981a). Differences in dynorphin potency in the GPI and MVD were
subsequently shown to be a consequence of differences in tissue expression of kappa opioid receptors (Cox
& Chavkin, 1983). In addition, the presence of spare opioid receptors suggested that morphine tolerance
could be a consequence of the loss of spare receptors (Chavkin & Goldstein, 1982), and this concept was
further established in subsequent studies (Porreca & Burks, 1983; Chavkin & Goldstein, 1984).
As described in the initial paper on dynorphin (Goldstein et al., 1979), dynorphin-A(1-13) had
both high potency and low sensitivity to naloxone. Its high potency is a consequence of its high receptor
binding affinity, intrinsic efficacy and spare receptor fraction. Its effects in the GPI and MVD are fully
blocked by naloxone, which is the principal definition of an opioid receptor mediated response, but the
~10-fold lower sensitivity to naloxone is consistent with its kappa opioid receptor selectivity. Structural
analysis of the dynorphin sequence revealed that the strongly basic residues in its carboxy-terminal domain
(arginine-7, lysine-11 and lysine-13) were cumulatively responsible for dynorphin-A’s kappa selectivity
(Chavkin & Goldstein, 1981b). Dynorphin-B and α-neo-endorphin also have strongly basic residues in
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
11
comparable positions (dynorphin B: arginine-7, lyine-10; α-neo: arginine-7, lysine-10) and also show
strong kappa receptor selectivity (James et al., 1984). In contrast, natural fragments of prodynorphin
include dynorphin A(1-8) and β-neo-endorphin, which lack the carboxy-terminal lysines and have lower
kappa receptor potencies and selectivities (Chavkin & Goldstein, 1981b; James et al., 1984) (Table 1).
Neurotransmitter Properties of Dynorphin
The cloning of the prodynorphin cDNA by Shosaku Numa and colleagues (Kakidani et al., 1982),
revealed that the preprodynorphin sequence contained three opioid domains having the leucine enkephalin
pentapeptide sequence followed by three different, highly basic carboxy terminal extensions (Table 1).
Working with Lakshmi Devi, Avram began a study of the processing enzymes responsible for generating
the active peptides from the precursor (Devi & Goldstein, 1984; 1986), and subsequent studies identified
the thiol protease present in brain responsible for cleaving the single and paired basic sites as prohormone
convertase PC2 (Berman et al., 2000). The range of prodynorphin opioids derived from the precursor is
fairly broad, extending from large forms (big-dynorphin and leumorphin) intermediate-sized, kappa-
selective forms (dynorphin A, dynorphin B, α-neoendorphin), to shorter forms that do not distinguish
between the opioid receptor types (dynorphin A(1-8) to leucine enkephalin). The ability of
preprodynorphin to act as a precursor for the latter two peptides was convincingly established (Weber et al.,
1982; Whitnall et al., 1983; Zamir et al., 1984); however the functional implications of having a precursor
able to generate peptide products having differing degrees of kappa receptor selectivity are not yet clear.
Furthermore, preprodynorphin is also the precursor for peptides that do not activate opioid receptors
(Walker et al., 1982; Lai et al., 2006).
Since 1921 when Otto Loewi first characterized cholinergic transmission in the heart (Loewi,
1921), the criteria necessary to establish that a candidate is a neurotransmitter includes the demonstration of
its: 1) presence in presynaptic terminals, 2) release following physiological stimulation, 3) post-synaptic
actions that can be blocked by selective antagonist and mimicked by selective agonist, and 4) metabolic
mechanisms of its elimination. The specific distribution of the dynorphin peptides in brain and peripheral
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
12
tissues at the cellular and ultrastructural levels has been well-defined using highly selective antibodies (see
Akil et al., 1984). The pro-dynorphin derived opioids can be released from rat brain tissue in a calcium-
dependent manner and positively identified by HPLC-C18 chromatography resolution followed by specific
radioimmunoassay (Chavkin et al., 1983). These released dynorphins were found to selectively bind to
kappa opioid receptors following release (Wagner et al., 1991). Focal stimulation of dynorphin containing
pathways caused presynaptic inhibition of excitatory synaptic transmission in hippocampus that could be
selectively blocked by kappa receptor antagonism (Wagner et al., 1993; Weisskopf et al., 1993; Terman et
al., 1994; Drake et al., 1994). These studies are summarized in more complete reviews (Castillo et al.,
1996; Simmons & Chavkin, 1996) and diagrammed in figure 2. The final criterion of ‘specific metabolic
clearance’ is more difficult for peptide transmitters since their actions are typically terminated by non-
specific peptidases in the extracellular matrix rather than by reuptake or selective degradation mechanisms.
Detailed studies of the neurotransmitter properties of the endogenous dynorphin system has
documented its broad distribution in brain, consistent with the broad range of pharmacological effects of
dynorphin and kappa selective drug actions. Prodynorphin-derived opioids are contained in large dense
core vesicles and principally released in a calcium-dependent manner as dynorphin B, dynorphin A(1-8),
dynorphin A(1-17) and α-neoendorphin forms. They can be released from nerve terminals to cause
presynaptic auto-inhibition (e.g. mossy fiber terminals in the CA3 region of the hippocampus or hilar
collaterals in the dentate gyrus). They can also be released from dendrites to cause retrograde inhibition of
excitatory afferents (e.g. in the molecular layer of the dentate gyrus). Biophysical measurements of
dynorphin diffusion rate in the extracellular space and the kinetics of action support an estimate of the
dynorphin synapse dimensions as being approximately 50 -100 µm from sites of release to sites of action
(Drake et al., 1994). At the sites of action, they principally activate kappa opioid receptors selectively (no
other source of endogenous kappa opioid has been identified). Kappa receptor activation is acutely
inhibitory through the activation of potassium channels (Kir3 and Kv), inhibition of voltage gated calcium
channel opening, or direct inhibition of synaptic vesicle exocytosis through a Gβγ mechanism. In addition,
sustained kappa receptor activation also results in stimulation of MAPK pathways (ERK1/2, p38 MAPK,
and cJun Kinase) (see Bruchas & Chavkin, 2010), and the activation of p38α MAPK in serotonergic
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
13
neurons was demonstrated to be necessary for the dysphoric/aversive effects of stress-induced dynorphin
release (Bruchas et al., 2011).
Dynorphins and Addiction
The preceding summary of the molecular physiology of the dynorphins supports the conclusion
that dynorphins are endogenous neurotransmitters that function through kappa opioid receptors in brain,
and these insights would have gratified Avram, but he was particularly interested in how dynorphins might
help explain drug addiction risk. Several clues to this question have emerged in the last 25 years. Albert
Herz and colleagues clearly established that kappa opioid agonists are profoundly dysphoric when
administered to people (Pfeiffer et al., 1986) and aversive when given to rodents (see Shippenberg et al.,
2001). Dynorphins are released during exposure of rats or mice to stressful behavioral experiences. Rodents
subjected to repeated forced swim show norBNI-sensitive increases in immobility (a depression-like
behavior) (Mague et al., 2003; McLaughlin et al., 2003), and this effect is blocked by prodynorphin or
kappa receptor gene knockout (McLaughlin et al., 2003; 2006). Stress-induced dysphoria or anxiety is
known to increase the risk of drug abuse in people (see de Kloet et al., 2005) and reinstate extinguished
drug seeking in rodents (see Shaham et al., 2000). Repeated stress-exposure produces dynorphin-dependent
dysphoria (see Bruchas & Chavkin 2010; Bruchas et al., 2010; Knoll & Carlezon, 2010). Importantly,
stress-induced release of dynorphin increases the rewarding effects of cocaine and nicotine in a conditioned
place preference model (McLaughlin et al., 2003; 2006; Schindler et al., 2010; Smith et al., 2012; Schindler
et al., 2012), and stress-induced release of dynorphin reinstates cocaine self-administration and drug
seeking (Beardsley et al., 2005; Redila & Chavkin, 2008). Brandon Walker and George Koob (2008) also
found that kappa antagonism reduces ethanol consumption in dependent rats.
These results suggest that dynorphins acting through kappa opioid receptors encode the dysphoric,
aversive and anxiogenic effects of stress in ways that increase the risk of drug abuse and addiction. The
abstinent state during drug withdrawal is also profoundly dysphoric, and dynorphin activation of kappa
opioid receptors may contribute to the intense craving that results in drug seeking behaviors in humans and
animal models of drug addiction. A role for the endogenous dynorphins in mediating the dysphoric effects
of drug withdrawal has been demonstrated following cessation of morphine (Carroll et al., 2005),
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
14
tetrahydrocannabinol (Zimmer et al., 2001), nicotine (McCarthy et al., 2010), cocaine (Chartoff et al.,
2012), and ethanol (Walker & Koob, 2008; Schank et al., 2012; Valdez & Harshberger, 2012). Animals
lacking a functional kappa opioid system either through genetic deletion or receptor antagonism seem to be
stress-resilient and less likely to seek drugs. Kappa antagonists do not affect addictive drug consumption in
the absence of stress and do not affect cue-induced drug reinstatement, thus they are unlikely to be broadly
effective as anti-addiction medications. These results in preclinical animal models suggest that kappa
receptor antagonists might be therapeutically effective in treating the anxiety and depressed affective states
during withdrawal. These antagonists could become an important adjunctive treatment for addiction, but
whether kappa antagonists reduce craving (and thus reduce drug seeking) or reduce the negative
consequences of withdrawal (and thus promote drug use) for humans remains to be established. However,
the concept that enhancing stress-resilience in vulnerable individuals could protect them from addiction
seems plausible, and the therapeutic potential of kappa opioid receptor antagonists in promoting stress-
resilience seems worth further study (Chavkin, 2011).
Highly selective kappa receptor antagonists have been developed: Phil Portoghese and colleagues
initially introduced norbinaltorphimine (norBNI) (Portoghese et al., 1987), and Ivy Carroll and colleagues
subsequently developed JDTic (Carroll et al., 2004). Both norBNI and JDTic have antidepressant-like and
anxiolytic-like properties in rodent models of stress-behaviors (see Bruchas & Chavkin 2010; Knoll &
Carlezon, 2010), and these actions may be therapeutically useful. However, both norBNI and JDTic have
very long-durations of action (>3 weeks in rodents following a single dose), and this long-duration of effect
is likely a consequence of kappa receptor inactivation through a c-Jun N-terminal kinase 1 (JNK1)
dependent mechanism (Melief et al 2011). Short acting, selective kappa antagonists that do not activate c-
Jun kinase have more recently been developed by scientists working at AstraZeneca (Peters et al., 2011),
Pfizer (Grimwood et al., 2011), and Eli Lilly (Mitch el al., 2011), and further development of these and
related compounds is ongoing. Developing safe and drug-like compounds is an expensive and difficult
process, but hopefully clinical trials will soon reveal whether antagonism of endogenous dynorphin tone in
humans can be an effective treatment of depression, anxiety, or addiction disorders.
Summary
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
15
Substantial progress in the molecular, physiological and behavioral characterizations of the
endogenous dynorphin/kappa opioid system and its relationship to brain function have been made in the
last 30 years. This brief review focused on the initial contributions of Avram Goldstein’s lab, then
expanded on the specific topics that he was interested in addressing. In many ways, the recent history of
this field validates his original belief that a molecular understanding of opiate drug action would lead to
important therapeutic advances. New treatments are not yet in hand, but they seem nearly in grasp.
Dynorphin has been an extraordinarily potent peptide, and this would have greatly pleased Avram.
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
16
Acknowledgments
I am grateful to the members of the Addiction Research Foundation who helped make Avram’s lab a
dynamic training environment in 1979-1982, particularly Drs. Brian M. Cox and Frances M. Leslie.
Authorship Contributions Charles Chavkin is solely responsible for the accuracy and any omissions in this mini-review.
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
17
References
Akil H, Watson SJ, Young E, Lewis ME, Khachaturian H, Walker JM. (1984) Endogenous opioids:
biology and function. Annu Rev Neurosci. 7:223-255.
Barrie ES, Smith RM, Sanford JC, Sadee W. (2012) mRNA transcript diversity creates new opportunities
for pharmacological intervention. Mol Pharmacol. 81:620-630.
Beardsley PM, Howard JL, Shelton KL, Carroll FI. (2005) Differential effects of the novel kappa opioid
receptor antagonist, JDTic, on reinstatement of cocaine-seeking induced by footshock stressors vs cocaine
primes and its antidepressant-like effects in rats. Psychopharmacology (Berl). 183:118-126.
Beckett AH, Casy AF. (1954) Synthetic analgesics: stereochemical considerations. J Pharm Pharmacol.
6:986-1001
Berman Y, Mzhavia N, Polonskaia A, Furuta M, Steiner DF, Pintar JE, Devi LA. (2000) Defective
prodynorphin processing in mice lacking prohormone convertase PC2. J Neurochem. 75:1763-1770.
Bowen WD, Gentleman S, Herkenham M, Pert CB. (1981) Interconverting mu and delta forms of the
opiate receptor in rat striatal patches. Proc Natl Acad Sci U S A. 78:4818-4822
Bruchas MR, Chavkin C. (2010) Kinase cascades and ligand-directed signaling at the kappa opioid
receptor. Psychopharmacology (Berl). 210:137-147.
Bruchas MR, Land BB, Chavkin C. (2010) The dynorphin/kappa opioid system as a modulator of stress-
induced and pro-addictive behaviors. Brain Res. 1314:44-55.
Bruchas, M.R., Schindler, A.G., Shankar, H., Messinger, D.I., Miyatake, M., Land, B.B., Lemos, J.C.,
Hagen, C., Neumaier, J.N., Quintana, A., Palmiter, R.D., Chavkin, C. (2011) Selective p38α MAPK
deletion in serotonergic neurons produces stress-resilience in models of depression and addiction. Neuron,
71:498-511.
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
18
Carroll FI, Harris LS, Aceto MD. (2005) Effects of JDTic, a selective kappa-opioid receptor antagonist, on
the development and expression of physical dependence on morphine using a rat continuous-infusion
model. Eur J Pharmacol. 524:89-94.
Carroll FI, Thomas JB, Dykstra LA, Granger AL, Allen RM, Howard JL, Pollard GT, Aceto MD, and
Harris LS (2004) Pharmacological properties of JDTic: a novel kappa-opioid receptor antagonist. Eur J
Pharmacol 501:111–119.
Castillo PE, Salin PA, Weisskopf MG, Nicoll RA. (1996) Characterizing the site and mode of action of
dynorphin at hippocampal mossy fiber synapses in the guinea pig. J Neurosci. 16:5942-5950.
Chartoff E, Sawyer A, Rachlin A, Potter D, Pliakas A, Carlezon WA. (2012) Blockade of kappa opioid
receptors attenuates the development of depressive-like behaviors induced by cocaine withdrawal in rats.
Neuropharmacology. 62:167-176.
Chavkin C, Bakhit C, Weber E, Bloom FE. (1983) Relative contents and concomitant release of
prodynorphin/neoendorphin-derived peptides in rat hippocampus. Proc Natl Acad Sci U S A. 80:7669-7673.
Chavkin C, Goldstein A. (1981a) Demonstration of a specific dynorphin receptor in guinea pig ileum
myenteric plexus. Nature. 291:591-593.
Chavkin C, Goldstein A. (1981b) Specific receptor for the opioid peptide dynorphin: structure--activity
relationships. Proc Natl Acad Sci U S A. 78:6543-6547
Chavkin C, Goldstein A. (1982) Reduction in opiate receptor reserve in morphine tolerant guinea pig ilea.
Life Sci. 31:1687-1690.
Chavkin C, Goldstein A. (1984) Opioid receptor reserve in normal and morphine-tolerant guinea pig ileum
myenteric plexus. Proc Natl Acad Sci U S A. 81:7253-7257.
Chavkin C, James IF, Goldstein A. (1982) Dynorphin is a specific endogenous ligand of the kappa opioid
receptor. Science. 215:413-415.
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
19
Chavkin C. (2011) The therapeutic potential of κ-opioids for treatment of pain and addiction.
Neuropsychopharmacology. 36:369-370.
Corbett AD, Paterson SJ, McKnight AT, Magnan J, Kosterlitz HW. (1982) Dynorphin and dynorphin are
ligands for the kappa-subtype of opiate receptor. Nature. 299:79-81.
Cox BM, Chavkin C. (1983) Comparison of dynorphin-selective Kappa receptors in mouse vas deferens
and guinea pig ileum. Spare receptor fraction as a determinant of potency. Mol Pharmacol. 23:36-43.
Cox BM, Goldstein A, Li CH. (1976) Opioid activity of a peptide, beta-lipotropin-(61-91), derived from
beta-lipotropin. Proc Natl Acad Sci U S A. 73:1821-1823.
Cox BM, Opheim KE, Teschemacher H, Goldstein A. (1975) A peptide-like substance from pituitary that
acts like morphine. 2. Purification and properties. Life Sci. 16:1777-1782.
de Kloet ER, Joels M, Holsboer F (2005) Stress and the brain: from adaptation to disease. Nat Rev Neurosci
6:463– 475.
Devi L, Goldstein A. (1984) Dynorphin converting enzyme with unusual specificity from rat brain. Proc
Natl Acad Sci U S A. 81:1892-1896.
Devi L, Goldstein A. (1986) Conversion of leumorphin (dynorphin B-29) to dynorphin B and dynorphin B-
14 by thiol protease activity. J Neurochem. 47:154-157.
Drake CT, Terman GW, Simmons ML, Milner TA, Kunkel DD, Schwartzkroin PA, Chavkin C. (1994)
Dynorphin opioids present in dentate granule cells may function as retrograde inhibitory neurotransmitters.
J Neurosci. 14:3736-3750.
Fischli W, Goldstein A, Hunkapiller MW, Hood LE. (1982) Isolation and amino acid sequence analysis of
a 4,000-dalton dynorphin from porcine pituitary. Proc Natl Acad Sci U S A. 79:5435-5437.
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
20
Goldstein A., Aronow L., and Kalman S.M. (1968) Principles of drug action: The basis of pharmacology.
New York: Harper and Row.
Goldstein A, Fischli W, Lowney LI, Hunkapiller M, Hood L. (1981) Porcine pituitary dynorphin: complete
amino acid sequence of the biologically active heptadecapeptide. Proc Natl Acad Sci U S A. 78:7219-7223.
Goldstein A, Lowney LI, Pal BK. (1971) Stereospecific and nonspecific interactions of the morphine
congener levorphanol in subcellular fractions of mouse brain. Proc Natl Acad Sci U S A. 68:1742-1747.
Goldstein A, Tachibana S, Lowney LI, Hunkapiller M, Hood L. (1979) Dynorphin-(1-13), an
extraordinarily potent opioid peptide. Proc Natl Acad Sci U S A. 76:6666-6670.
Goldstein A. (1981) Dynorphin. Nathan B. Eddy memorial award lecture. NIDA Res Monogr. 34:1-10.
Grimwood S, Lu Y, Schmidt AW, Vanase-Frawley MA, Sawant-Basak A, Miller E, McLean S, Freeman J,
Wong S, McLaughlin JP, et al. (2011) Pharmacological characterization of 2-methyl-N-((2-(pyrrolidin-1-
ylsulfonyl)biphenyl-4-yl)methyl-)propan-1-amine (PF-04455242), a high-affinity antagonist selective for
kappa opioid receptors. J Pharmacol Exp Ther 339:555-566.
Hughes J, Smith TW, Kosterlitz HW, Fothergill LA, Morgan BA, Morris HR. (1975) Identification of two
related pentapeptides from the brain with potent opiate agonist activity. Nature 258:577-580.
Huidobro-Toro JP, Yoshimura K, Lee NM, Loh HH, Way EL. (1981) Eur J Pharmacol. 72:265-266.
James IF, Fischli W, Goldstein A. (1984) Opioid receptor selectivity of dynorphin gene products. J
Pharmacol Exp Ther. 228:88-93.
Jordan BA, Devi LA. (1999) G-protein-coupled receptor heterodimerization modulates receptor function.
Nature. 399:697-700.
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
21
Kakidani H, Furutani Y, Takahashi H, Noda M, Morimoto Y, Hirose T, Asai M, Inayama S, Nakanishi S,
Numa S. (1982) Cloning and sequence analysis of cDNA for porcine beta-neo-endorphin/dynorphin
precursor. Nature. 298:245-249.
Kangawa K, Matsuo H. Igarashi M.(1979) alpha-Neo-endorphin : a "big" Leu-enkephalin with potent
opiate activity from porcine hypothalami. Biochem Biophys Res Commun. 86:153-160.
Kangawa K, Minamino N, Chino N, Sakakibara S, Matsuo H. (1981) The complete amino acid sequence of
alpha-neo-endorphin. Biochem Biophys Res Commun. 99:871-878.
Kilpatrick DL, Wahlstrom A, Lahm HW, Blacher R, Udenfriend S. (1982) Rimorphin, a unique, naturally
occurring [Leu]enkephalin-containing peptide found in association with dynorphin and alpha-neo-
endorphin. Proc Natl Acad Sci U S A. 79:6480-6483.
Knoll AT, Carlezon WA Jr. (2010) Dynorphin, stress, and depression. Brain Res. 1314:56-73.
Lai J, Luo MC, Chen Q, Ma S, Gardell LR, Ossipov MH, Porreca F. (2006) Dynorphin A activates
bradykinin receptors to maintain neuropathic pain. Nat Neurosci. 9:1534-1540.
Li CH, Chung D. (1976) Isolation and structure of an untriakontapeptide with opiate activity from camel
pituitary glands. Proc Natl Acad Sci U S A 73:1145-1148.
Loewi O. (1921) "Über humorale Übertragbarkeit der Herznervenwirkung. I." Pflügers Archiv, 189, pp.
239–242.
Lord JA, Waterfield AA, Hughes J, Kosterlitz HW. (1977) Endogenous opioid peptides: multiple agonists
and receptors. Nature. 267:495-499.
Mague SD, Pliakas AM, Todtenkopf MS, Tomasiewicz HC, Zhang Y, Stevens Jr WC, Jones RM,
Portoghese PS, Carlezon Jr WA (2003) Antidepressant-like effects of kappa-opioid receptor antagonists in
the forced swim test in rats. J Pharmacol Exp Ther. 305:323–330.
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
22
Martin WR, Eades CG, Thompson JA, Huppler RE, Gilbert PE. (1976) The effects of morphine- and
nalorphine- like drugs in the nondependent and morphine-dependent chronic spinal dog. J Pharmacol Exp
Ther. 197:517-532.
McCarthy MJ, Zhang H, Neff NH, Hadjiconstantinou M. (2010) Nicotine withdrawal and kappa-opioid
receptors. Psychopharmacology (Berl). 210:221-229.
McLaughlin JP, Li S, Valdez J, Chavkin TA, Chavkin C (2006) Social defeat stress-induced behavioral
responses are mediated by the endogenous kappa opioid system. Neuropsychopharmacology 31:1241–1248.
McLaughlin JP, Marton-Popovici M, Chavkin C (2003) kappa-Opioid receptor antagonism and
prodynorphin gene disruption block stress-induced behavioral responses. J Neurosci 23:5674 –5683.
Melief, E.J., Miyatake, M., Carroll, F.I., Beguin, C., Carlezon, W.A., Cohen, B.M., Grimwood. S., Mitch,
C.H., Rorick-Kehn, L., Chavkin, C. (2011) Duration of action of a broad range of selective kappa opioid
antagonists is positively correlated with c-Jun kinase 1 activation. Molecular Pharmacology, 80:920-929.
Mitch CH, Quimby SJ, Diaz N, Pedregal C, de la Torre MG, Jimenez A, Shi Q, Canada EJ, Kahl SD,
Statnick MA, McKinzie DL, Benesh DR, Rash KS, Barth VN. (2011) Discovery of
aminobenzyloxyarylamides as κ opioid receptor selective antagonists: application to preclinical
development of a κ opioid receptor antagonist receptor occupancy tracer. J Med Chem. 54:8000-8012.
Nakanishi S, Inoue, A, Kita, T, Numa, S, Chang, AC, Cohen SN, Nunberg, J, Schimke RT (1978)
Construction of bacterial plasmids that contain the nucleotide sequence for bovine corticotropin-beta-
lipotropin precursor Proc Natl Acad Sci U S A. 75: 6021–6025.
Noda M, Furutani Y, Takahashi H, Toyosato M, Hirose T, Inayama S, Nakanishi S, Numa S. (1982)
Cloning and sequence analysis of cDNA for bovine adrenal preproenkephalin. Nature. 295:202-206.
Oka T, Negishi K, Suda M, Sawa A, Fujino M, Wakimasu M. (1982) Evidence that dynorphin-(1-13) acts
as an agonist on opioid kappa-receptors. Eur J Pharmacol. 77:137-141.
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
23
Peters MF, Zacco A, Gordon J, Maciag CM, Litwin LC, Thompson C, Schroeder P, Sygowski LA, Piser
TM, and Brugel TA (2011) Identification of short-acting kappa-opioid antagonists with anxiolytic-like
activity. Eur J Pharmacol 661:27–34.
Pfeiffer A, Brantl V, Herz A, Emrich HM (1986) Psychotomimesis mediated by kappa opiate receptors.
Science 233:774–776
Pfeiffer A, Herz A. (1982) Discrimination of three opiate receptor binding sites with the use of a
computerized curve-fitting technique. Mol Pharmacol. 21:266-271.
Porreca F, Burks TF. (1983) Affinity of normorphine for its pharmacologic receptor in the naive and
morphine-tolerant guinea-pig isolated ileum. J Pharmacol Exp Ther. 225:688-693.
Portoghese PS, Larson DL, Jiang JB, Takemori AE, Caruso TP. (1978) 6beta-[N,N-Bis(2-
chloroethyl)amino]-17-(cyclopropylmethyl)-4,5alpha-epoxy-3,14-dihydroxymorphinan(chlornaltrexamine)
a potent opioid receptor alkylating agent with ultralong narcotic antagonist activity. J Med Chem. 21:598-
599.
Portoghese PS, Lipkowski AW, and Takemori AE (1987) Binaltorphimine and norbinaltorphimine, potent
and selective kappa-opioid receptor antagonists. Life Sci 40:1287–1292.
Portoghese PS. (1965) A new concept on the mode of interaction of narcotic analgesics with receptors. J
Med Chem. 8:609-616.
Quirion R, Pert CB. (1981) Dynorphins: similar relative potencies on mu, delta- and kappa-opiate
receptors. Eur J Pharmacol. 76:467-468.
Redila, V.A., Chavkin, C., 2008. Stress-induced reinstatement of cocaine seeking is mediated by the kappa
opioid system. Psychopharmacology (Berl) 200:59–70.
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
24
Robson LE, Kosterlitz HW. (1979) Specific protection of the binding sites of D-Ala2-D-Leu5-enkephalin
(delta-receptors) and dihydromorphine (mu-receptors). Proc R Soc Lond B Biol Sci. 205:425-432.
Rozenfeld R, Devi LA. (2011) Exploring a role for heteromerization in GPCR signalling specificity.
Biochem J. 433:11-18.
Schank JR, Goldstein AL, Rowe KE, King CE, Marusich JA, Wiley JL, Carroll FI, Thorsell A, Heilig M.
(2012) The kappa opioid receptor antagonist JDTic attenuates alcohol seeking and withdrawal anxiety.
Addict Biol. 17:634-647.
Schindler AG, Li S, Chavkin C. (2010) Behavioral stress may increase the rewarding valence of cocaine-
associated cues through a dynorphin/kappa-opioid receptor-mediated mechanism without affecting
associative learning or memory retrieval mechanisms. Neuropsychopharmacology. 35:1932-1942,
Schindler, A.G., Messinger, D.I., Smith, J.S., Shankar, H., Gustin, R.M., Schattauer, S.S., Lemos, J.C.,
Chavkin, N.W., Hagan, C.E., Neumaier, J.N., Chavkin, C. (2012) Stress produces aversion and potentiates
cocaine reward by releasing endogenous dynorphins in the ventral striatum to locally stimulate serotonin
reuptake. J Neurosci. in press.
Schulz R, Wüster M, Herz A. (1982) Endogenous ligands for kappa-opiate receptors. Peptides. 3:973-976.
Schwarzer C. (2009) 30 years of dynorphins--new insights on their functions in neuropsychiatric diseases.
Pharmacol Ther. 123:353-370.
Shaham Y, Erb S, Stewart J. (2000) Stress-induced relapse to heroin and cocaine seeking in rats: a review.
Brain Res Brain Res Rev. 33:13-33.
Shippenberg TS, Chefer VI, Zapata A, Heidbreder CA (2001) Modulation of the behavioral and
neurochemical effects of psychostimulants by kappaopioid receptor systems. Ann NY Acad Sci. 937:50-73.
Simmons ML, Chavkin C. (1996) Endogenous opioid regulation of hippocampal function. Int Rev
Neurobiol. 39:145-96.
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
25
Simon EJ, Groth J. (1975) Kinetics of opiate receptor inactivation by sulfhydryl reagents: evidence for
conformational change in presence of sodium ions. Proc Natl Acad Sci U S A. 72:2404-2407.
Smith JR, Simon EJ. (1980) Selective protection of stereospecific enkephalin and opiate binding against
inactivation by N-ethylmaleimide: evidence for two classes of opiate receptors. Proc Natl Acad Sci U S A.
77:281-284.
Smith JS, Schindler AG, Martinelli E, Gustin RM, Bruchas MR, Chavkin C. (2012) Stress-induced
activation of the dynorphin/κ-opioid receptor system in the amygdala potentiates nicotine conditioned place
preference. J Neurosci. 32:1488-1495.
Terenius, L. and Wahlstrom, A. (1974) Morphine-like ligand for opiate receptors in mammalian brain. Acta
Pharmacol Toxicol. 35: 55-59.
Terman GW, Wagner JJ, Chavkin C. (1994) Kappa opioids inhibit induction of long-term potentiation in
the dentate gyrus of the guinea pig hippocampus. J Neurosci. 14:4740-4747.
Teschemacher H, Opheim KE, Cox BM, Goldstein A. (1975) A peptide-like substance from pituitary that
acts like morphine. I. Isolation. Life Sci. 16:1771-1775.
Urban JD, Clarke WP, von Zastrow M, Nichols DE, Kobilka B, Weinstein H, Javitch JA, Roth BL,
Christopoulos A, Sexton PM, Miller KJ, Spedding M, Mailman RB. (2007) Functional selectivity and
classical concepts of quantitative pharmacology. J Pharmacol Exp Ther. 320:1-13.
Valdez GR, Harshberger E. (2012) Kappa opioid regulation of anxiety-like behavior during acute ethanol
withdrawal. Pharmacol Biochem Behav. 102:44-47.
Wagner JJ, Evans CJ, Chavkin C. (1991) Focal stimulation of the mossy fibers releases endogenous
dynorphins that bind kappa 1-opioid receptors in guinea pig hippocampus. J Neurochem. 57:333-343.
Wagner JJ, Terman GW, Chavkin C. (1993) Endogenous dynorphins inhibit excitatory neurotransmission
and block LTP induction in the hippocampus. Nature. 363:451-454.
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
26
Walker BM, Koob GF. (2008) Pharmacological evidence for a motivational role of kappa-opioid systems
in ethanol dependence. Neuropsychopharmacology. 33:643-52.
Walker JM, Moises HC, Coy DH, Baldrighi G, Akil H. (1982) Nonopiate effects of dynorphin and des-Tyr-
dynorphin. Science. 218:1136-1138.
Weber E, Evans CJ, Barchas JD. (1982) Predominance of the amino-terminal octapeptide fragment of
dynorphin in rat brain regions. Nature. 299:77-79.
Weisskopf MG, Zalutsky RA, Nicoll RA. (1993) The opioid peptide dynorphin mediates heterosynaptic
depression of hippocampal mossy fibre synapses and modulates long-term potentiation. Nature. 362:423-
427.
Werling LL, Brown S, Cox BM. (1984) The sensitivity of opioid receptor types to regulation by sodium
and GTP. Neuropeptides. 5:137-140.
Whitnall MH, Gainer H, Cox BM, Molineaux CJ. (1983) Dynorphin-A-(1-8) is contained within
vasopressin neurosecretory vesicles in rat pituitary. Science. 222:1137-1139.
Wüster M, Rubini P, Schulz R. (1981) The preference of putative pro-enkephalins for different types of
opiate receptors. Life Sci. 29:1219-1227.
Wüster M, Schulz R, Herz A. (1980a) Highly specific opiate receptors for dynorphin-(1-13) in the mouse
vas deferens. Eur J Pharmacol. 62:235-236.
Wüster M, Schulz R, Herz A. (1980b) Opiate activity and receptor selectivity of dynorphin1-13 and related
peptides. Neurosci Lett. 20:79-83.
Wüster M, Schulz R. (1980c) Differential effects of potassium on the potency of different opioids in the
mouse vas deferens. Naunyn Schmiedebergs Arch Pharmacol. 315:181-184.
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
27
Yoshimura K, Huidobro-Toro JP, Lee NM, Loh HH, Way EL. (1982) Activation of Kappa-opiate sites by
dynorphin in the myenteric plexus. Adv Biochem Psychopharmacol. 33:91-98.
Zamir N, Palkovits M, Weber E, Mezey E, Brownstein MJ. (1984) A dynorphinergic pathway of Leu-
enkephalin production in rat substantia nigra. Nature. 307:643-645.
Zimmer A, Valjent E, Konig M, Zimmer AM, Robledo P, Hahn H, Valverde O, Maldonado R. (2001)
Absence of delta -9-tetrahydrocannabinol dysphoric effects in dynorphin-deficient mice. J Neurosci.
21:9499-9505.
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
28
Footnotes: The author is supported by USPHS grants [KO5DA20570, R37DA11672, RO1DA030074] from
the National Institute on Drug Abuse.
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
29
Legends
Figure 1
The two principal competing conceptions describing opioid receptors in the 1960-70’s are diagrammed. In
the upper panel, a single opioid receptor structure could adopt differently shaped binding sites depending
on the actions of allosteric modulators and distinguished by different opioid ligands. In the second
conception, multiple types of opioid receptor proteins exist in cells and opioids differ in their affinities and
selectivities for the different physical forms. A selective protection strategy is outlined in the lower panel.
β-CNA can non-selectively bind and inactivate both OpR1 and OpR2 in the absence of a reversible
protective ligand. Once excess β-CNA and the reversible ligand are washed away, the protected population
of receptors remain available for activation. If the receptor forms are freely interconverting, then no
selective protection would be evident.
Figure 2
A granule cell from the dentate gyrus of the hippocampal formation is cartooned. These neurons contain
both excitatory amino acids and prodynorphin-derived opioid peptides. When activated by excitatory
synaptic input in the perforant path from the entorhinal cortex, granule cells release glutamate to excite
hilar interneurons and CA3 pyramidal cells. Kappa receptor agonists reduce granule cell excitation by
inhibiting glutamate release from the perforant path fibers, reduce hilar neuron activation by inhibiting
glutamate release from mossy fiber collateral fibers, and reduce CA3 pyramidal cell activation by
presynaptic inhibition of the mossy fibers. High frequency activation of the granule cells causes dynorphin
release at each of these sites within the hippocampus, which also reduces excitation at these synapses.
Biophysical studies of dynorphin transmission in the hippocampus have helped to define the special
dimensions of this neuropeptide synapse in brain.
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
MOL #83337
30
Table 1
Proenkephalin-derived opioids methionine-enkephalin (YGGFM) leucine-enkephalin (YGGFL)
several additional carboxy-terminally extended forms have been
described, but physiological significance is not established
Proopiomelanocortin-derived opioids
β-endorphin (31 amino acid sequence beginning with YGGFM) several carboxy terminally truncated forms have been described, but
physiological significance is not established
Prodynorphin-derived opioids
dynorphin A(1-17) (YGGFLRRIRPKLKWDNQ) dynorphin A(1-8) (YGGFLRRI) dynorphin B (YGGFLRRQFKVVT) (aka rimorphin) α-neo-endorphin (YGGFLRKYPK) β-neo-endorphin (YGGFLRKYP) Big dynorphin (YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT) Leumorphin (YGGFLRRQFKVVTRSQQDPNPNAYYGGLFNV)
Legend: Three families of endogenous opioid peptides have been identified. Their names and primary
sequences are shown in this list and further explained in the text.
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from
This article has not been copyedited and formatted. The final version may differ from this version.Molecular Pharmacology Fast Forward. Published on November 14, 2012 as DOI: 10.1124/mol.112.083337
at ASPE
T Journals on A
ugust 27, 2020m
olpharm.aspetjournals.org
Dow
nloaded from