HazMat Management Winter 2010

An EcoLog Group Publication / CPMP no. 40069240

Brownfields Marketplace

Emergency Response

Waste Management

WINTER 2010www.hazmatmag.com

ANNUAL BUYERS’ GUIDE – pages 21-36

HazMat ma

na

ge

me

nt

Solutions for the Business of the Environment

NanomaterialsAre they the next “asbestos”? — page 8

http://www.hazmatmag.com

http://issuu.com/action/page?page=8





http://www.agruamerica.com

contentsvol 21 no 4 WINTER 2010

WINTER 2010 HazMat Management 3

next edition (spring 2010)

Supplements: Brownfields Marketplace, CleanTech CanadaEditorial Focus: • Environmental products & services • BioHazardous waste disposal • Compliance • PCBs • TDG • In-plant spills cleanup • SorbentsBonus Distribution: GLOBE 2010, Vancouver, BC • Canbuild10, Toronto, ON • CANECT10, Toronto, ONAdvertising closes, February 12, 2010. Advertising Artwork required, February 19, 2010. Contact Brad O'Brien at 1-888-702-1111 ext. 1.

features

departmentsEditorial 4UpFront 6EnvironmentBusiness 48HazMatProducts 49News 52AdIndex 53LegalPerspective 54

FACILITYPROFILE:ENVIRONMENTALSERVICESSafety-Kleen’s Chambly Operations Centre.by Frank Wagner

41

NANOMATERIALRISKS8on the cover

NANOMATERIALRISKSMore than a thousand consumer products around the world contain nanomaterials, yet there are huge deficiencies in definitions, labeling, environmental and health impact assessments, and there’s little government regulation. Could another “asbestos” crisis be in the making?by Colin Isaacs

8

EMERGENCYRESPONSE:BENCHMARKINGTwenty years of ER industry and equipment change.by John Hosty

45

(PAGES 13-20 & 37-40) COVER ART: PHOTO BY JOSEPH HARTMAN

BROWNFIELDS MARKETPLACE

EDITORIAL Property taxes and brownfields. by Bonnie Prior 14

GROUNDWATER CLEANUP PCB removal. by Jeff Marmarelli &

John Sherbondy 16

CONTAMINATED SITES

Addressing federal government sites. by Rob Lindsay 19

LAB TESTING

Uncertainty with analytical results. by Marc Paquet 20

REMEDIATION

The true cost of remediation. by Gary Millard 38

BROWNFIELD PRODUCTS

New ERIS products. by Carol Bell-LeNoury 39

WASTEMANAGEMENT:PESTICIDESClean-FARMS’ pesticide residuals program.by Barry Friesen

43

PERSONALPROTECTION:EQUIPMENTPPE for high-level exposure.by Stuart Whitbread

47 2009-2010ANNUALBUYERSGUIDEProducts and services for environment, health and safety.Pages 21-36

2010Annual

Buyers’ Guide

HazMat ma

na

ge

me

nt


hmm winter 2010 BG pg 21.indd 25

10/12/09 8:50 AM





















4 www.hazmatmag.com WINTER 2010

editorial

Two Decades of HazMat Management

by Guy Crittenden

Year 2009 was our 20th year publishing HazMat Management magazine. We chose this final edition of the calendar year to acknowledge the anniversary. It doesn’t matter much which month we chose; the official launch date of the publication back in 1989 was a bit blurred. While the first printing as

a glossy magazine was in September of that year, HazMat initially started as a little-known newsletter called the Hazardous Waste Industry Review, founded earlier that year. In truth, the newsletter — which appeared only a couple of times — was more of a marketing tool than anything else, to show prospective advertisers that we were serious about publishing something.

HazMat Management started out as a true “kitchen table” business. It was originally the brain-child of a childhood friend of mine, Matthew Keegan, who enlisted two of his friends as partners. Arnie Gess, who had a marketing diploma, ran the advertising sales side of the business. Todd Latham helped with ads (as did Matthew) and oversaw the magazine’s art direction and printing. The three of them enlisted the help of another friend, Kelvin, to fill in as “editor” for the first glossy edition.

My name is on the masthead of the very first edition as Associate Editor. At that time I hadn’t officially signed on, but was being courted by Keegan to join the company. I’d come back from a year studying filmmaking in California, and had taken courses at Ryerson Polytechnical University with a view to potentially entering the advertising business, which would exploit my visual art training and the writing skills I’d acquired through my English major at the U of T. The prospect of a magazine editor’s job held appeal for similar reasons.

I didn’t need much convincing to give the company a try, for several reasons. My family background in journalism runs deep. My father Max was city editor of the now-defunct Toronto Telegram newspaper. The man who eventually became my stepfather is Peter Worthington, the Tely’s top foreign correspondent who went on to co-found the Toronto Sun. My mother Yvonne and stepmother Carol all worked for the Tely and continued with successful media careers.

In addition to having been “born an ink-stained wretch” another reason HazMat appealed to me is that I’d seen the potential of such a business up close and personal as a teenager. Childhood friend Keegan’s dad was Robert (Bob) Keegan, an America with a deep career in business-to-business publishing. I spent a lot of time with the Keegans, a family with six kids who lived in a large house near my street. A serial entrepreneur, old man Keegan always seemed to be starting up another business venture. I remember him once showing us all a gizmo he’d co-invented, essentially a wheel with a handle that allowed people to single-handedly move large objects around, like boats and trailers.

Bob Keegan saw an opportunity in the 1970s when the new US federal legislation required companies to safely manage hazardous materials. Keegan realized that industrial America would suddenly need to train its truck drivers and other staff in the new requirements. He founded a lucrative HazMat training business by repackaging free but complicated information from the federal government into a slide show presentation and other resource materials, and charged companies to visit their facilities and train their workers.

The training eventually spawned a mini-empire for Keegan that included training programs, a significant trade show and Hazardous Waste Management magazine. This was the publication that son Matthew copied closely when similar environmental regulations were passed here.

I remember Bob Keegan as the only person among my friend’s dads who drove a big Cadillac and flew his own plane. As teenagers, Matt and I would visit old man Keegan at his out-of-the-way business headquarters in Kutzstown, Pennsylvania. I once went on a date there, and was handed the keys to a shiny white convertible for the evening.

So, you might say I was sort of “pre-sold” on the idea of being a partner in such a business.After its inception the story of HazMat Management became complicated. Gess, Latham and I eventually

bought out Keegan Jr. after disagreements over the direction of the business. In 2000 we sold the magazine to the current owners. Gess and Latham have moved on, with Gess now managing the trade show for which our affiliate publication Solid Waste & Recycling is show guide, and Latham presiding over his own trade magazine company.

I continue to enjoy editing HazMat Management after 20 years, even though the Cadillac and private plane continue to elude me.... HMM

Guy Crittenden is editor of this magazine. Contact Guy at [email protected]

“I remember Bob

Keegan as the only

person among my

friend’s dads who

drove a big Cadillac,

and flew his own

plane.”


mailto:[email protected]

http://www.hazco.com


Guy CrittendenEDITOR

[email protected]

Brad O’BrienPUBLISHER416-510-6798

[email protected] Ross

ACCOUNT MANAGER416-510-5221

[email protected] WilsonART DIRECTOR

Kimberly Collins PRODUCTION MANAGER

[email protected]

Selina RahamanCIRCULATION MANAGER

Carol Bell-LeNouryGENERAL MANAGER, ECOLOG GROUP

Bruce CreightonPRESIDENT

HazMat Management, USPS 016-506 is published four times a year by EcoLog Group, a division of Business Information Group Inc., a leading Canadian business-to-business information services company.

HazMat Management magazine provides strategic information and perspectives to North American industry and government on pol-lution prevention and waste management issues.

Readers include corporate executives, compliance and safe ty officers, industrial plant managers and operators, municipal, gov-ernment environment officials, working scientists, and consulting engineers.

EcoLog Group products include Solid Waste & Recycling maga-zine, the ERIS risk information service, and a number of newsletters affiliated with EcoLog.com

Head Office: 12 Concorde Place, Suite 800 Toronto ON M3C 4J2 Call: (416) 442-5600 Fax: (416) 510-5133Internet: www.hazmatmag.comEmail: [email protected]

Information contained in this publication has been compiled from sources believed to be reliable, thus HazMat Man age ment cannot be responsible for the absolute correctness or sufficiency of articles or editorial contained herein. Al though the information con-tained in this magazine is believed to be correct, no responsibility is assumed therefore, nor for the opinions ex pressed by individual authors. Articles in this magazine are intended to convey informa-tion rather than give legal or other professional advice. Reprint and list rental services are arranged through the Publisher at (416) 510-6780. This magazine is printed on RECYCLED PAPER made with 10% post consumer and 50% post commercial waste.

Periodical Postage PaidNiagara Falls, NY, U.S. P.S. #016-506U.S. Office of publication:2424 Niagara Falls Blvd., Niagara Falls, NY 14304-0357

U.S. Postmaster: Send address corrections to:HazMat Management,P.O. Box 1118, Niagara Falls, NY 14304

Canadian Publications Mail ProductSales Agreement No. 40069240

Return Undeliverable Canadian Addresses to Circulation Department — HazMat Management magazine12 Concorde Place, Suite 800 Toronto ON M3C4J2

From time to time we make our subscription list available to select companies and organizations whose product or service may inter-est you. If you do not wish your contact information to be made available, please contact us via one of the following methods: Phone: 1-800-668-2374 Fax: 416-510-5133 Email: [email protected] to: Privacy Officer Business Information Group 12 Concorde Place, Suite 800 Toronto ON M3C 4J2

We acknowledge the financial support of the Government of Canada through the Publications Assistance Program to wards our mailing costs.

© 2010 All rights reserved. No part of this publication may be reproduced without prior consent.PAP Registration No. 11032 ISSN-1713-9511

A W A R D - W I N N I N G M A G A Z I N E

HazMat ma

na

ge

me

nt


Vol. 22, No. 1 WINTER 2010

Canadian Business Press

Member

up-front

Mitchell Gibbs retires

Please join us in congratulating Mitchell Gibbs on his retirement from Environmental Emergency

Services. Mitchell retires as the National Director of Emergency Services for TEAM HAZCO a division of HAZCO Environmental.

Mitchell started in the environmental business in 1980. After gaining skills at vari-ous companies he founded the well respect-ed and industry trend-setting TEAM-1 Environmental Services. In early 2008 he sold his company to HAZCO Environmental, a division of CCS. After 18 months at HAZCO, he resigned as the Director.

During his career Mitchell became a well known and sought after speaker, an author of Another Day in Paradise and was best known for the successfully handling of the most sig-nificant emergency events in Ontario.

His career highlights were the infamous Plastimet fire where he was onsite from 12 minutes after the fire started and put in over 6,000 hours until the site was com-pletely remediated. Several other major fires took place after the Plastimet site; most noteworthy was the U.S.E. Hickson fire. Mitchell and his crew looked after the Sunrise Propane explosion and the Air France Jet aircraft crash at Pearson Airport.

Mitchell has gained the accreditation of a Certified Environmental Consultant (CEC), a Certified Environmental Specialist (CES), and a Certified Air Quality Specialist (CAQS). He continues on the faculty of

Mohawk College where he teaches Solid and Hazardous Waste Management.

Mitchell is best known for his industry-leading tactics and his complement of high tech gear. He designed and constructed the industry’s only CBRNE Response Unit and his two mobile decontamination trailers. Police and fire departments across Ontario would often turn to Mitchell for rapid response to various issues that affected life, health and the environment.

Friends and business associates who know Mitchell best will know to find him in South Florida renting out Boston Whalers. HazMat Management magazine and the staff wish him well but advise him that he should leave the boats at the dock so they can be rented out.Mitchell can be reached at [email protected] or 1 800 Gone Boating...

The Forest Stewardship Council logo signi-fies that this magazine is printed on paper from responsibly managed forests. “To earn FSC certification and the right to use the FSC label, an organization must first adapt its management and operations to conform to all applicable FSC requirements.” Our paper – Arborweb – contains 30 per cent post-consumer recycled content.For more information, visit www.fsc.org

CONTRIBUTING EDITORS

Michael Cant • John Hosty • Diane Saxe • Usman Valiante •

Laura Zizzo










http://www.fsc.org

up-front


The spirit of giving

Jamie Ross (right) HazMat Management magazine presents a cheque to Brother Tom Liss, Director of the Good Shepherd Ministries in support of

The Passion Campaign. The Passion Campaign was created by Restoration Environmental Contractors of Gormley, Ontario, after working in the Regent Park area of Toronto since 2006. This year has been hard for many people, and it is even harder on those who rely on the kindness of others in order to survive. The Passion Campaign is having a gingerbread house auction as well as their calendar program with photographs donated by Keith Levit Photography.

Please go to www.thepassioncampaign.com and support one of 13 registered charities that help people in need in our communities every day. They can be reached at [email protected]

E-waste recycler wins award

Barrie, Ontario-based GEEP Inc. was the recipi-ent of three Waste Minimization Awards from the Recycling Council of Ontario (RCO) held in October at Ontario Place. Photo left to right: Dave Douglas, Chris Gariepy, Kathy McKenzie, Peter Maurmann, Clyde Yorke, Wallace MacKay, Lisa Thompson-Buck, Alfred Hambsch, Patricia Medve, and George Craine.

Demolition Association online safety training

The newly revamped National Demolition Association website www.demolitionassociation.com now offers a full arsenal of online safety training and certification

courses that allow for in-house training, orientation, and per-sonnel management.

The members-only feature provides more than 7,000 training courses on topics that range from fall protection and excavator safety training to Microsoft Excel and safe driving. The courses are designed to improve safety, compliance, and risk management initiatives by providing OSHA standardized content, which is validated by industry experts. The interactive courses include instant grading and online certificates, as well. Members can pay just once for each course, but can view the course as many times as they want for up to one year.

Upcoming, the National Demolition Association is developing a demolition-specific safety training course that will be web-based and available on the newly upgraded website.Visit www.demolitionassociation.com

http://www.thepassioncampaign.com


http://www.demolitionassociation.com



cover-story

Toward managing risks from the new technology

Nanomaterials


Colin Isaacs C.Chem.

“The lack of disclosure about nanotechnology has been called comparable to

the asbestos litigation disaster for investors.”


cover-story

by Colin Isaacs C.Chem.

In classical chemistry a substance exhibits consistent properties: nickel is always nickel, ferric oxide is always ferric oxide, and each of the forms of carbon always behaves consistently. However, when physics, and especially quantum mechanics, is introduced, substances may behave in quite different ways.

That is the issue facing nanotechnology. Environmentally the change in behavior may be beneficial or it may be deleterious. In many cases all that’s known so far is that nanoparticles may behave in a different way compared to the conventional bulk substance.

What are they?In common parlance, nanomaterials are substances with a par

ticle dimension ranging from 1 to 100 nanometers. For comparison, a human hair has a diameter of about 60,000 nanometers. The extremely small particle size means that the substance may have different properties than those associated with the conventional substance. It may have a different physical strength, different solubility, or different chemical reactivity. Perhaps of greatest concern is that the particles may be so small that they can pass through the skin of humans and other living organisms and may be able to enter and disrupt the cells from which all living things are constructed. With different ways of producing nanomaterials, even those with the same chemistry — but from different manufacturers — may have different properties.

The reasons that nanomaterials have different properties from the larger particle size material include:

• the relative surface area is large compared to the mass, potentially increasing the reactivity, and hence the toxicity, significantly; and

• quantum effects apply to very small objects. These quantum effects can change optical, magnetic and electrical properties and may cause nanoparticles to agglomerate or adsorb to each other. For example, while a graphite pencil lead doesn’t conduct electricity, a carbon nanotube that is one atom thick can act as a semiconductor.For more than a decade nanomaterials have been presented as a marvel of technology. They are now used in coatings, plastics, cosmetics, toothpaste and many more consumer products. The Woodrow Wilson Institute has listed more than 1,015 consumer products in the US and around the world that contain nanomaterials, yet there is no widely accepted definition of a nanomaterial, no labeling requirements, little in the way of environmental and health impact assessment, and little government regulation. Consumer products containing nanomaterials on the Canadian market are as diverse as skin cleansers, water resistant clothing, antibacterial coating for hot tubs, and oral tablets that claim to help people lose weight faster.

In a report published in 2008, an Expert Panel of the Council of Canadian Academies concluded that there is not enough information available to assess the safety of nanomaterials. This is a highly qualified group; the members of the Council of Canadian Academies are: the Royal Society of Canada: The Academies of Arts, Humanities and Sciences of Canada; the Canadian Academy of Engineering; and the Canadian Academy of Health Sciences.

One challenge of nanomaterials is that conventional toxicity tests, which often require dissolving a substance in water, may not be applicable. If an inorganic nanomaterial is dissolved in water it’s most likely no longer in the form of a nanomaterial (note that some nanomaterials — including carbon “Bucky balls” — may retain their molecular structure when dissolved) so testing the solution for toxicity is not a proxy for toxicity of the solid material. Toxicity tests for exposure through inhalation or dermal absorption are much more complex and hence much less commonly used, but may be the only appropriate type of tests for nanoparticles.

RISKSSome of the potential risks associated with nanomaterials include that nanomaterials may contain impurities or byproducts that could affect the toxicity. For example, carbon nanotubes have been found to contain iron, cobalt and molybdenum (used as a catalyst) as well as smaller amounts of chromium, copper and lead.

Some nanomaterials are toxic materials in their own right such as heavy metals and can enter cells such as the human lung. The design of experiments to test nanomaterials for toxicity may not be scientifically valid. For example, many toxicity tests require dissolving the material in water but nanoparticles are insoluble in water.

Nanoparticles are so small they may behave somewhat like a gas and may be carried high into the stratosphere or washed down into soil and water by a rainstorm. They may also enter the environment through wastewater discharges, such as industrial waste streams and effluent from wet scrubbers used for pollution control.

Nanoparticles are likely to remain suspended in the air for some time and hence could be inhaled. Aquatic species may be exposed through their gills. They may be toxic to environmental organisms. For example, earthworms may ingest nanoparticles from contaminated soils. Fullerenes (molecular carbon nanomaterials) have strong antibacterial action so spills and disposals can cause environmental impacts. Insoluble nanoparticles

Nanomaterials


cover-story

supplements, cosmetics, drugs, medicaldevices and biologicals in terms of tox-icity,biocompatibility,andexposure.

UnitedStates’governmentresearchisalsoplanned to: improve sampling and analy-sis for workplace and airborne exposures;develop recommendations and establishguidanceforengineeringcontrols,protect-ive equipment and safe handling for con-trolling occupational exposure to carbonnanotubes;and,toaddressgapsininforma-tiononsampling,analysis,exposureassess-ment, instrumentation and controls, longtermhealtheffects,andexplosivepotentialof nanomaterials. The US and Canadaare also reported to be working with theOECD on an international level. EPA istesting 14 nanomaterials on 59 environ-mentalendpoints.

In June of this year, the US-basedInvestor Environmental Health Network,

environment, health and safety implica-tions of nanomaterials totals $350 mil-lion,mostlysince2005.Afurtherfundingrequest of $88 million to cover increasedresearch on the type and amount ofnanomaterials in biological systems, theenvironment and the workplace has beenrequested for 2010. Some of the researchfindingsandinitiativesinclude:•Coating nanoparticles with a layer of

certainmaterialschangestheirtoxicity.•Iron oxide nanocrystals can remove 98

to 99 per cent of arsenic from drinkingwater.

•The US National Institute for Occupa-tionalHealthandSafety(NIOSH)aimstocontroloccupationalexposureto fineandultrafinetitaniumdioxide.

•The FDA is developing new tools todetect and characterize nanomateri-als in food, food additives, nutritional

maysettleintoaquaticsedimentsandcouldposearisktosedimentspecies.

POLICY AND TECHNICAL CHALLENGESInCanadamostnanomaterials,thosewitha chemical structure identical to thatof aconventional substance,areconsideredbyEnvironmentCanadatobethesameastheconventionalsubstance,eventhoughthisisknownnottobethecase;hencenonotifica-tionisrequiredundertheNewSubstancesProgramoftheDomesticSubstancesList.Therearesomeexceptionswherenotifica-tionisrequired,forexampleifaproposeduse requires a Significant New ActivityNotice. Approvals are still required fornanomaterialsusedinsuchregulatedprod-uctsaspesticidesorfoods.

In the United States, cumulative gov-ernment investment in research on the


http://www.csa.ca/z1600


cover-story

found in a book sponsored by AMEC and published earlier this year:Sellers, Kathleen, Christopher Mackay, Lynn L. Bergeson, Stephen R. Clough, Marilyn Hoyt, Julie Chen, Kim Henry, and Jane Hamblen, Boca Raton, Florida: CRC Press (Taylor and Francis Group), 2009. Price: US$99.95 ISBN: 9781420060195 CRC Press Online http://www.crcpress.com/ [and search for title. Price reduction to US$79.95]. HMM

Colin Isaacs is an environmental analyst, consultant, and writer with more than 25 years experience. He is editor of the Gallon Environment Letter and his commentaries also appear regularly in this magazine’s affili-ate information products, such as EcoLog news. Contact Colin at [email protected]

• Privileging Secrecy: Privileging con-cealment by using attorney-client rela-tions as a shield against estimating liabil-ity for investors.

• Inconsistent Estimates: Providing lar-ger liability estimates to insurers than to investors.

• Hidden Assumptions: Using hidden as sump tions to minimize estimates of liability.

• Missing Benchmarks: No requirement to benchmark liabilities against other companies whose experience with rel-evant claims demonstrates realistic esti-mates of liability.

• Risk-Free Proxies: Refusing to allow shareholders to propose annual proxy ballot requests for corporate reports on specific risks of concern to investors.

More information about the environment-al implications of nanotechnology can be

which includes NGOs as well as invest-ment management firms, compared the lack of disclosure about nanotechnology to what the group calls the “asbestos litiga-tion disaster for investors.” It calls on the securities commission to close eight major loopholes to improve disclosure. The loop-holes identified by the IEHN include:• Shortsightedness: Regulations currently

allow companies to take the short view and avoid disclosure and estimation of longer-term liabilities.

• Concealed Science: Regulators cur-rently allow companies to conceal emer-ging science that forewarns of potential liabilities in the future.

• The Known Minimum: Regulations currently require accrual of only the “known minimum” of pending liabilities when greater likelihood of higher liabil-ities is uncertain.

“Nanomaterials have a particle dimension ranging from one to 100 nanometers; a human

hair is about 60,000 nanometers.”

Remediation and reclamationInfrastructure engineeringEnvironmental assessmentLEED certified designEconomic sustainabilityConstruction and operations management

For more information, please contact us at: [email protected] www.worleyparsons.com

Risk Assessment • Human health and ecological risk assessments• Toxicology and hazard assessment of chemicals• Evaluation of risks related to contaminated sites• Probabilistic, multimedia, exposure and risk

assessment modeling• Development of Property Specific Standards• Peer review of contaminated site risk assessments• Public consultation and risk communication

Helping youwith the Science

of Brownfields

Helping youwith the Science

of BrownfieldsIntrinsik Environmental Sciences Inc. is a leading science-based consulting firm, with more than 20 years of experience assisting our clients by providing them with leading edge scientific knowledge and advice related to the protection of human health and the environment.

Regulatory Affairs • Experts in Ontario Regulation 153/04 with an

established success rate with Ministry Submissions• More than 10 scientists with the qualifications,

experience and expertise to qualify as a QPRA

• Standing contracts with MOE, Environment Canada, and Health Canada to provide expert advice in toxicology and risk assessment.

For more information, contactDr. Glenn Ferguson (905) 364-7800 Ext.206

www.intrinsikscience.com

http://www.crcpress



http://www.worleyparsons.com

http://www.intrinsikscience.com

offices located nationwide • 1.800.251.7773 • [email protected] • www.quantummurray.com

Quantum Murray LP is a full-service waste management, decommissioning and environmental contracting company.

With offices across Canada qualified professionals seam-lessly provide demolition, emergency response, hazardous material abatement and environmental remediation as well as scrap metal salvage and disposal services.

Our remediation team provides a full range of services, from heavy civil and geotechnical applications, to industrial site decommissioning, site excavation and remediation, treat-ment of contaminated soil and water, all manner of cut-off walls, excavation shoring, slurry excavation, UST / AST removal and in-situ system installation.

the complete package

demolitionemergency response

hazardous materials abatementremediation

thomson metals and disposal


http://www.quantummurray.com

BROWNFIELDSBROWNFIELDSMARKETPLACEMARKETPLACE

Canadian Brownfields Network

WINTER 2010

Green Municipal Fund Fonds municipal vert

FCMThe Canadian Real EstateAssociation

S P O N S O R E D B Y :

Published by HazMat Management magazine

ADDRESSING CONTAMINATIONAt Federal sites

P U B L I S H E D I N A S S O C I A T I O N W I T H : CORPORATE PARTNER:


editorial

by Bonnie Prior

“It’s imperative

that we continue

to ‘level the

playing field’

between greenfield

and brownfield

developments.”


PROPERTY TAXESB

rownfield redevelopment typically involves the transformation of idle industrial property, often with vacant buildings, into new higher order land uses resulting in a host of benefits to the surrounding community, including increased property taxes. The

transformation requires applications for planning approvals to be made, processed and approved; the demolition of buildings; active site remediation; the preparation and approval of risk assessments; and, the filing of Records of Site Condition.

Contrast this to the typical greenfield redevelopment process where the existing land use is often agricultural lands that remain farmed while planning applications are made, processed and approved.

The current property tax regime results in very different property tax implications under these two scenarios and puts the brownfield redevelopment at a distinct disadvantage where two similar sites are competing for a developer’s attention.

To use Ontario as example, there are three determining factors in establishing the property taxes for an individual property:

The Assessed Property Value (as determined by MPAC in Ontario) based on the current value of the land including improvements; and

The Property Classification is identified by MPAC and is assigned to all property according to its use. The Property Classification determines the Tax Rate that will be applied to each property by the municipality.

This is generally the same in British Columbia, where BC Assessment establishes the assessed property value and property tax classification.

Using Ontario and British Columbia as examples, agricultural lands are of consistently lower assessed value than lands that are developed or readily developable. The tax rate for agricultural land is also among the lowest, resulting in property taxes that are significantly lower than for any other class of land. The property taxes remain low throughout the planning approval process, including rezoning, and a slight increase in property taxes is typically incurred only when the plan of subdivision is registered due to a tax class change. Only when the developer breaks ground to begin servicing

the site do the property taxes at the new higher order land use come into effect.

Brownfield properties are typically older industrial uses with assessed values based upon the values of other industrial properties in the area and an industrial tax class, resulting in property taxes that are often significantly higher than any other tax class. The brownfield property owner can achieve some tax relief upon demolition of the buildings on the site but the tax class and tax rate remain unchanged. In Ontario, the property owner can apply for a reduction in property assessment due to contamination on a site but the process can be lengthy and is uncertain and there’s still no method to amend the tax class to which the property is subject.

A recent study analyzed property tax implications in the development/redevelopment of a 15 acre site. A threeyear timeframe was applied to compare a greenfield versus brownfield site from acquisition through to rezoned and serviceable lands in four Ontario municipalities. The results clearly demonstrated a brownfield redevelopment paying between $200,000 and $500,000 in additional property taxes over the threeyear development horizon. This is obviously detrimental to any brownfield site being analyzed for redevelopment potential.

Again, to use the Ontario example, the province sets the tax policy related to property assessment. The creation of a new tax class for properties “under remediation” would allow municipalities some latitude in recognizing the benefits overall of site remediation and redevelopment. It’s important that the benefits accrue to only the sites that are being actively remediated, as there are many sites functioning at full capacity in spite of onsite contamination and they should continue to be taxed in accordance with comparable properties.

The creation of policies that would disallow property assessment reductions for contamination on fully functioning sites would be another tool to encourage site remediation. This would also discourage property owners from ignoring their site contamination issues; currently they can receive tax benefits by acknowledging onsite contamination and applying for a reduced assessment. Municipalities would still receive full property tax revenues on these sites affording them the ability to offset the property taxes on the properties that are actively undergoing remediation.

It’s imperative that we continue to “level the playing field” between greenfield and brownfield developments. Levelling property tax implications is one step to allowing the brownfield site to compete for the developer’s attention. This direction is supportive of existing provincial legislation in Ontario that supports intensification and the protection of greenfields. This would also improve the performance of existing municipal and provincial incentives provided in Community Improvement Plans (CIPs) and ultimately expedite redevelopment of brownfield properties.

Bonnie Prior, BA, CAE is Executive Director of the Canadian Brownfields Network in Burlington, Ontario. Contact Bonnie at [email protected]



www.fcm.ca/gmf [email protected] 613-907-6357

KICK-START YOUR BROWNFIELD PROJECT WITH A GMF LOAN

We beat the bank!GMF offers loans for brownfield remediation projects at rates far lower than any municipal government can get on the market. Our rates for municipalities are 1.5% lower than the Government of Canada bond rate and even further below market rates. GMF also offers loans to private-sector companies or corporations wholly owned by a municipal government for brownfield site remediation at competitive rates, if they are partners in eligible municipal projects.

“ The remediation of this site is a turning point for our town. In these times of very tight municipal budgets, the assistance of the Green Municipal Fund is very useful.”

—Mayor Céline Tremblay, Municipality of Saint-Damien, Québec

http://www.fcm.ca/gmf




As many readers of this magazine would know, for about 50 years polychlorinated biphenyls (PCBs) were commonly used in industrial materials including, caulking, cutting oils, inks, paints and as dielectric fluids in electrical equipment such as

transformers and capacitors. Concerns over health effects lead to a North American ban of manufacturing PCBs in 1977. By the mid 1980’s an initiative was started to clean up contaminated areas and to phase out PCB containing equip-ment and products that were still in use. This cleanup effort continues today.

Careless disposal practices and accidental discharges in the past contribute to the present amount of PCBs in groundwater and in sediments of rivers and lakes. Growing public and government concern over health hazards has led to new practices to safely remove and dispose of PCBs. Residual contamination has been effectively treated using systems utilizing activated carbon adsorption media.

Activated carbonadsorption

Activated carbon is widely used for the adsorption of many contaminants from liquid, air streams. The activated carbon is produced from carbonaceous organic substances including

bituminous coal, coconut shell, lignite, bone, wood and other materials. It’s used in many ap-plications including the produc-tion of foods, decolorization of

liquids such as recycling of glycol, and trace contamination removal from air.

Adsorption results from a physical process in which layers of atoms or molecules of one substance are attracted on to the surface structure of another substance. Activated carbon’s extremely high surface area within its extensive pore structure makes it an ideal adsorbent. One ounce of activated carbon has a surface area equivalent to six foot-ball fields!

Activated carbon exhibits a graphitic plate structure, and one may liken the formation of adsorption surfaces to a box of peanut brittle, with the highest energy adsorption sites formed at the intersections of the plates (Figure 1). The iodine number is used a general measurement of the sur-face area of the activated carbon. These numbers generally range from 900-1100 for higher quality carbons.

Activated carbons tend to adsorb organic compounds with increasing affinity as adsorbate (the material being adsorbed) molecular weight, boiling point, and refractive index increase and as solubility decreases. Thus, activated carbon has a high affinity for PCBs due to their high mo-lecular weight, high indices of refraction, and very low solu-bilities. PCBs have a very large molecular structure and for effective adsorption will require an activated carbon with a compatible pore size. Different base materials will yield dif-ferent pore structures. For example, coal based carbon has a pore structure that will better accommodate these types of molecules as compared to coconut based carbon. Coconut-

PCBS IN GROUNDWATER

TREATMENT USING ACTIVATED

CARBON

by Jeff Marmarelli

“One ounce of

activated carbon

has a surface area

equivalent to six

football fields!”

Peanut brittle is comparable on a real scale to the microscopic structure of carbon.



expertpeoplebetter

decisions

Environmental Site AssessmentSite RemediationRisk AssessmentHazardous Building Materials SurveySolid & Hazardous Waste ManagementGroundwater InvestigationsEnvironmental Compliance AuditsBrownfieldsIndustrial Services

Cincinnati Toronto Kitchener Kingston EdmontonEnvironmental Engineers and Scientists

www.xcg.com

based carbons are more suited to smaller molecular weight compounds with low boiling points, and therefore are not as effective in this application compared to a quality coal-based carbon.

The surface loading of adsorbate on activated car-bon varies with the concentration and conditions in the fluid stream. In order to evaluate the economic potential of an application, the activated carbon isotherms can be developed for the particular compound at a given set of conditions. Many isotherms are already available for various compounds including PCBs. They can be obtained from carbon manufacturers, purifications companies and EPA lit-erature. They can also be developed in the lab using simple procedures.

Figure 2 illustrates an isotherm for a PCB molecule with one chlorine atom on TIGG 5D 1240 coal-based activated carbon. As with any testing, these isotherms are performed under controlled laboratory conditions. Actual performance in the field can be affected by any number of factors associ-ated with the treatment system.

PCB-contaminatedgroundwater

When dealing with PCB-contaminated groundwater, the solubility of the PCB isomers molecules in the water can typically range from 20 to 60 ppb with solubilities generally

below 1 ppm. Above these levels the PCBs will be found as free product. As illustrated by the isotherm, PCBs are readily adsorbed by activated carbon, with the example of the PCB isomer with only one chlorine atom (the lowest affinity for all PCB isomers) showing excellent loading on the carbon, even at 1 ppb levels. The result is that effluent levels below 1ppb are achievable.

Treatment of this water is dependant not only on keep-ing the carbon “clean” for proper kinetic transference of the molecules but also the contact time allowed for the adsorp-tion to take place. Field experiences have shown that often under turbid conditions the PCB levels in the effluent after the carbon adsorbers can be as high as 3-5 ppb. The reason

An isotherm for a PCB molecule with one chlorine atom on TIGG 5D 1240 coal-based activated carbon.

http://www.xcg.com

http://www.pinchin.com



for the higher than expected levels in the effluent is that the PCBs will attach themselves to colloidal material in the water or any carbon fines and pass through the bed without being adsorbed.

In order to decrease these residual levels upstream and downstream filtration is required. Typically a 5-10 micron bagfilter is installed prior to the carbon bed and a 0.5 micron bagfilter is installed after the carbon bed, prior to discharge. These processes remove most suspended solids that may be entering the carbon and essentially “plugging” the bed of carbon, thus limiting adsorption; and, capturing any solids

that may be making their way through to the effluent.In addition to the pre- and post-filtration of the carbon

bed, the carbon bed needs to be properly sized. Both the bed surface area and the carbon bed depth affect the effi-ciency of removal. About seven to eight minutes empty-bed contact time (EBCT, or time to pass fluid through give actual volume of carbon present as a theoretically open volume) is optimal for proper adsorption. Typically, a minimum of three feet carbon bed depth is required. The surface area is typically designed to promote a superficial velocity of four to six gallons per minute per square foot. Slower veloci-ties can be used but very low velocities should be avoided as this may promote the occurrence of channeling, or the liquid seeking a path of least resistance through the carbon bed, resulting in poor distribution. (See Figure 3.)

Overall, activated carbon adsorption is an effective way of reducing PCB contamination in groundwater. Successful results can be achieved with a properly designed system that addresses both pre-filtration and post-filtration, along with proper carbon selection and bed design parameters including bed surface area, depth, and contact time.

Jeff Marmarelli is Business Development Manager with TIGG Corporation in Oakdale, Pennsylvania. Contact Jeff at [email protected]. John Sherbondy, Account Manager for TIGG Corporation contributed to this article.

Elements of a typical PCB removal system

RISK CHECKREPORT

RISK CHECKREPORT

RISK CHECKREPORT

RISK CHECKREPORT

The ERIS Risk Check ReportYour fi rst step in assessing environmental risk on your property!

Indicates low risk or elevated risk for environmental hazards on your property

Evaluated and interpreted by a certifi ed environmental consultant

Contains all historical and publicly registered records on your site. Includes Standard ERIS Report, Topographic Map, Fire Insurance Plans*, City Directory Search* and a Lender Consulting Services Report.* if available on requested site.

Order your ERIS Risk Check Report Today!Call: 1-866-517-5204 or visit www.eris.ca

Before any property transaction or site assessment,know your level of environmental risk.

Environmental Risk Information Services Ltd.


http://www.eris.ca



Contamination of sites under federal government responsibility is a legacy of past environmental prac-tices whose consequences were not fully understood

at the time. Federal contaminated sites contain chemical substances such as heavy metals, petroleum products, and PCBs (polychlorinated biphenyls) that may pose risks to hu-man health or the environment. The sites include harbours and ports, military bases, former Distant Early Warning (DEW) line sites, lightstations, and abandoned mines. As of October 2009, it was estimated there are approximately 20,000 actual or suspected federal contaminated sites in Canada. Nearly 4,000 of these have been classified as high (Class 1) or medium (Class 2) priority for action.

In 2005, the Government of Canada established the Federal Contaminated Sites Action Plan (FCSAP) to ad-dress contaminated sites under the responsibility of federal custodians, including departments, agencies, and consoli-dated Crown corporations. FCSAP is a 15-year, $3.5 billion government-wide initiative. Additional funding was an-nounced in January 2009 under Canada’s Economic Action Plan, to accelerate activities under the existing FCSAP over the next two years. An additional $80.5 million was provided over fiscal years 2009-2010 and 2010-2011 for program management and assessments. Canada’s Economic Action Plan is also expected to accelerate an estimated $165 million in additional environmental remediation/risk management activities on priority federal contaminated sites across Canada.

FCSAP funding is intended to complement ongoing federal contaminated sites management activities. The program is administered jointly by Environment Canada and the Treasury Board Secretariat, which provide program co-

ordination, progress monitoring and program reporting, as well as the overall policy framework for the management of federal

contaminated sites in Canada. Technical advice, training and guidance is provided to custodians by four expert support departments: Environment Canada, Fisheries and Oceans Canada, Health Canada, and Public Works and Government Services Canada. In any given year, there are approximately 15 federal departments, agencies, and consolidated Crown corporations effectively collaborating to deliver this import-ant government initiative.

FCSAP’s primary objectives are to reduce the human health and environmental risks posed by federal contamin-ated sites. The program has also created secondary benefits for the public and for industry, such as increasing employ-ment in the environmental sector, providing training and transferable skills development, and promoting technology advancement and innovation.

Project spending on the program has been between $200 and $225 million annually for the past three years. These funds have been used to carry out assessment activ-ities on 1,000 to 2,000 sites, and remediation/risk manage-ment activities to reduce risks on 400 to 500 sites (200-300 projects) annually. These numbers continue to increase each year. In total, FCSAP will provide custodians with fund-ing for assessment work on approximately 3,500 sites and remediation/risk management activities on nearly 1,000 sites (590 projects) throughout fiscal years 2009-2010 and 2010-2011.

While progress is being made to address this important priority, much remains to be done. The thousands of assess-ment projects that have been completed have given us a more comprehensive understanding of the scale of con-tamination on federal sites, and a more accurate picture of federal environmental liabilities. As assessment work winds down, custodians will be able to dedicate more resources to remediation and risk management, thus accelerating the pace of reducing or eliminating risks to human health and the environment. The FCSAP Secretariat, with support from custodians and expert departments, continues to work to improve program delivery in a way that is cost effective and accountable to Canadians.

For more information on the FCSAP program, please visit www.federalcontaminatedsites.gc.ca/ or email [email protected]

Rob Lindsay is Program Officer in the Contaminated Sites Division of Environment Canada in Gatineau, Quebec. Contact Rob at [email protected]

ADDRESSING CONTAMINATION AT FEDERAL GOVERNMENT SITES

UNDERSTANDING FCSAP

“Project spending

on the program has

been between $200

and $225 million

annually for the past

three years.”by Rob Lindsay

http://www.federalcontaminatedsites.gc.ca/





Analytical results are a key element in the environment-al industry and are essential for determining contam-ination levels in soils, water, air, residual matter, and

other sample matrices. Results are generally compared to environmental regulations and are used to determine the contamination levels of specific sites or as a reference for the handling of contaminated materials. Clearly, it’s crucial that the results provided by a lab be reflective and repre-sentative of the general level of contamination of the site being characterized.

There is an analytical uncertainty linked to all analytical results. Generally, uncertainty is associated with laboratory procedures alone; however, the uncertainty associated with environmental site history, sampling procedures, sample conservation, and the pretreatment of samples on site must also be considered. With all this taken into account, uncer-tainty is rarely used during the interpretation and evaluation of the quality of analytical results.

Still today, myths exist in regard to analytical uncertainty. Some environment industry people still have simplistic views that the quality of a result depends upon the chosen method, that an analytical method approved by a reputable organization is free of interferences, that the accreditation of a lab in itself guarantees the quality of results, that qual-ity is strictly a lab concern, and that all analytical results are true and absolute.

Of course many important decisions are taken based on the interpretation of analytical results; oftentimes decisions of high financial significance. Generally, result interpretation is limited to the comparison to regulations and is performed

by people with different profes-sional experience and qualifica-tions. In many cases, the results reported by the lab are deemed to be accurate and no further

by Marc Paquet

UNDERSTANDING UNCERTAINTY WITH SOURCES,CONTROL AND DATA INTERPRETATION

evaluation is performed. Again, uncertainty is rarely used as part of the result interpretation process. Taking all of this into consideration, the following questions arise:• What are the impacts of an erroneous result, inadequate

interpretation and uncertainty on a decision or recom-mendation?

• How is it possible to know whether a result is valid and coherent?

• What’s the uncertainty or percent error associated with an analytical result?

• What factors may influence the quality of a result?• What tools are available to validate an analytical result?Many factors may influence the degree of uncertainty and the quality of an analytical result. Considering that the results must be reflective of the general level of con-tamination contained within a site, the quality of the environmental evaluation (phase 1) and the determination of the environmental characterization program (phase 2) may have a considerable impact on uncertainty. Every step between the determination of the environmental history of a site, sampling and the reporting of analytical data may affect the quality of results; thus the importance of choos-ing an appropriate sampling method, sample conservation, sample homogeneity, difficult matrices (multiple phases), the choice of an adequate analytical method, and so on, in order to limit uncertainty.

Limiting uncertainty

In order to limit the uncertainty involved with environment-al projects, many tools can be used by both consulting firms and the laboratory. During sampling, field blanks can be taken to verify the possibility of cross contamination. Also, field duplicates allow the verification of the repeatability of the sampling technique as well as homogeneity. “Blind” performance samples coming from evaluating organizations may also be analyzed by the lab to validate the precision of analytical results.

As for the laboratories, along with the accreditation by reputable organizations, comes the obligation to follow certain quality control procedures for all samples analyzed including but not limited to a laboratory blank, control sam-ples, lab duplicates and internal standards with all analytical sequences. Each sample is associated with quality control

ANALYTICAL RESULTS

“Many tools exist

for evaluating the

uncertainty linked

to the analytical

process.”... continues on pg 37


2010Annual

Buyers’ Guide

HazMat ma

na

ge

me

nt



ABSORBENT/ADSORBENT PRODUCTS

Allen VanguardArcusCan-RossCartier ChemicalsDevconEnviro-SolFPIGator CdaHazmastersICCImbibitive Technologies Canada,Kapejo Inc.Loraday EnviroTIGG CorporationTeam-1West Coast Spill Supplies

AGITATORS

Belart ProdITT Water & Wastewater

AIR POLLUTION CONTROL

AC CarboneClear Edge FiltrationMEGTECMonroe EnvironmentalNett TechTurboSonic

AIR QUALITY/TREATMENT/MONITORING

AC CarboneAcme Engineering ProdACRActivation LabAir & Water Solutions,ALARAAmbio BiofiltrationAncal,Armstrong MonitoringAshtead TechAVARAvensys Inc.BGIBOMA Environmental & SafetyBraun IntertecCDS AnalyticalCEACEMS Chemical Emission Management

ServicesChem SolvChurch & TroughtCircul-AireClean AirCoastal EnvironmentalControl InstrumentsECOH ManagementEMC ScientificEtcos EnvironmentalFabricated PlasticsFisher EnvironmentalGrayWolfIndl ScientificINFICONJacques WhitfordLakes SoftwareLEHDER EnvironmentalLEX ScientificMil-Ram Technology

Nett TechNovaLynxOpsisPhotovacR&R LabRAE Systems Inc.RGF Environmental Group Inc.StaplexT HarrisTeam-1Thermo Scientific Nitron AnalyzersTurboSonicWestech Ind’lWilks Ent

ASBESTOS/LEAD/MOULD ABATEMENT

Abacon Environmental ConsultantsAir Earth WaterBraun IntertecThe Cannington Group Inc.Chem Solvcr/x environmental services, incFisher EnvironmentalGrayling IndustriesHazmastersJacques WhitfordKeystone EnvironmentalLEHDER EnvironmentalLEX ScientificMonaltQuantum Murray LP – Demolition

DivisionQuantum Murray LP – Hazardous

Materials AbatementRaw Materials Company Inc.Restoration Env ContractorsSafety ExpressStaplexTeam-1Thermo Scientific Nitron Analyzers

BATTERY COLLECTION & RECYCLING

Battery BrokerBattery CouncilRaw Materials Company Inc.

BATTERY DISPOSAL

Anachem

BROWNFIELDS DEVELOPMENT

AiMS EnvironmentalAird & BerlisBarencoCETCOECOLOG Info ResourcesGlobalToxGOwenGreenspoon Specialty ContractingIntrinsik Environmental SciencesIvey International Inc.Jacques WhitfordKeystone EnvironmentalKilmer Brownfield Equity Fund L.PMalroz EngineeringOCETAOsler, Hoskin, HarcourtSanexen Environmental ServicesTerrafix EnvironmentalWallace, Van Egmond Spankie

WESA Inc.XCG Consultants

CALIBRATION GASES

Scott Specialty

CLEANERS/DEGREASERS/SOLVENTS, ETC.

AnachemCartier ChemicalsEnviroSan ProductsIntl ProductsKam BiotechnologyKPR Adcor VCIPerma-TechRochester Midland

COATINGS/PROTECTIVE FLOORING

DevconGemite ProductsKPR Adcor VCIPerma-TechTerrafix Environmental

CONFINED SPACE SAFETY PRODUCTS/TRAINING/SERVICES

Scott SpecialtyArmstrong MonitoringCdn Safety EquipDemesaEmergency FilmGemtorHazmastersHetekIndl ScientificLineman’s LabsMil-Ram TechnologyProvincial SvcsSafety ExpressServomex Company Inc.Sierra MonitorSkedcoTeam-1WessucYow Canada

DISPOSAL SERVICES

AnachemEnviro Mgmt SvcsNetwork EnviroNewaltaPhotech EnvironmentalQuantum Murray LP – Metals DivisionSolution Soil Treatment FacilityTerratechnikTri-Arrow

DISTRIBUTORS & MANUFACTURER’S REPS

Alaron InstrumentsAlpha ControlsAvensys Inc.CancoppasDemesaFanchemGeneqGroundTech SolutionsMandel ScientificNorditrade

Performance Fluid EquipmentSpez-Tech Engineered Fluid Power

TechnologyWestech Ind’l

EMERGENCY RESPONSE (EQUIPMENT SVCS, TRAILERS)

Falcon Ridge GroupQuantum Murray LP – Hazardous

Materials AbatementQuantum Murray LP – Training DivisionRestoration Env ContractorsSmiths Detection – DanburyTeam-1Wells CargoYoung’s Cleanup

ENVIRONMENTAL & HUMAN HEALTH RISK ASSESSMENT

BarencoConestoga-RoversGlobalToxIntrinsik Environmental SciencesJacques Whitford

ENVIRONMENTAL & WASTE AUDITING

AECOMAird & BerlisChem SolvCIAL GroupConestoga-RoversConformance CheckEnviro Mgmt SvcsJacques WhitfordKosteckyLEHDER EnvironmentalManagement HorizonsPilot Performance Resources ISO

ManagementProcyon ConsultSendexSENES ConsultURS Canada

ENVIRONMENTAL CONSULTING/ENGINEERING

Abacon Environmental ConsultantsAGAT LaboratoriesAiMS EnvironmentalAir Earth WaterALPALTECH ConsultingAnachemAqua TerreAqua Terre Solutions Inc.AVARBarencoBOMA Environmental & SafetyBowie EnvironmentalBraun IntertecBriggs CdaC TechCEMS Chemical Emission Management

ServicesChurch & TroughtConestoga-RoversDonleyEarthguardEcoBecECOH Management

2010 Buyers’ Guide & Directory



Egmond Associates Ltd.Enviro-StewardsEnvironmental Business ConsultantsERIS (Environmental Risk Information

Service)Etcos EnvironmentalFisher EnvironmentalGOwenGreen-TechIncinerator ConsultantsIntrinsik Environmental SciencesInvestigative ScienceIvey International Inc.Jacques WhitfordJagger HimsKodiakKosteckyLakes SoftwareLEHDER EnvironmentalLEX ScientificMalroz EngineeringMTE Consultants Inc./Frontline

EnvironmentalParacel LaboratoriesPinchin EnvironmentalPurifics ESR&R LabRJ BurnsideEcoWerksSGS Geostat Ltd.SNC-Lavalin Inc.Sanexen Environmental ServicesWaterloo HydrogeologicSendexSENES ConsultSkelly and Loy,Spill MgmtStantec ConsultingStrata SoilT HarrisTerrapexTrow GlobalURS CanadaWESA Envir-EauWardrop Engineering Inc.WESA Inc.Weston SolutionsWorleyParsonsXCG Consultants

ENVIRONMENTAL DRILLING SERVICES

Atlas DewateringJacques WhitfordKodiakRocky Mountain Soil SamplingSonic Soil – ConcordStrata Soil

ENVIRONMENTAL IMPACT ASSESSMENTS

Conestoga-RoversGlobalToxJacques WhitfordRJ BurnsideWaterloo Hydrogeologic

ENVIRONMENTAL LAW

Aird & BerlisCassels Brock & Blackwell LLPConformance CheckECOLOG Info Resources

ERIS (Environmental Risk Information Service)

Gowling Lafleur Henderson LLPMiller ThomsonOsler, Hoskin, HarcourtSpecialty TechTorys LLPWillms & Shier Env Lawyers

ENVIRONMENTAL MANAGEMENT/SERVICES

3E CompanyAnachemAtrion InternationalBattery BrokerBowie EnvironmentalChemical SafetyCIAL GroupEarthguardECOLOG Info ResourcesEnvironmental Support Solutions, Inc.

(ESS)EQGOwenHazcoJacques WhitfordManagement HorizonsNetwork EnviroPhotech EnvironmentalPilot Performance Resources ISO

ManagementPinchin EnvironmentalProcyon ConsultRochester MidlandStantec ConsultingSustaiNet Software SolutionsTerratechnikTorys LLPTrow GlobalURS CanadaWESA Envir-EauWillms & Shier Env LawyersWorleyParsons

FILTRATION EQUIPMENT/SYSTEMS

AC CarboneAcme Engineering ProdCircul-AireClear Edge FiltrationEMRP Environmental Marine &

Response ProductsENV TreatmentFabco Plastics WesternFabco WholesaleFilter InnovationsJLM SystemsLakeview Eng’dMandel ScientificMarkland SpecialtyMinuteman IntlRGF Environmental Group Inc.TIGG CorporationTreatment Products

FIRE & EXPLOSION TOXIC DISPERSION

Team-1

FUME ELIMINATOR

Sarva Bio Remed

GAS DETECTION SYSTEMS

Chlorinators IncMil-Ram TechnologyWestech Ind’l

GENERAL CONTRACTING/DEMOLITION

Aim Environmental GroupGreenspoon Specialty ContractingQuantum Murray LP – Demolition

DivisionSonic Soil – Concord

GEOTECHNICAL

Jacques Whitford

GROUNDWATER MONITORING/REMEDIATION

Activation LabAeromixAGAT LaboratoriesAim Environmental GroupAiMS EnvironmentalALTECH ConsultingAnalytical MeasurementsAqua Terre Solutions Inc.Aqua TerreAtlas DewateringBriggs CdaConestoga-RoversForestry SuppliersGeneqGeonics LimitedGolden Environmental ServicesGOwenGroundTech SolutionsHeron InstrumentsINFICONInsitu ContractorsInstrument NWJacques WhitfordJagger HimsKeystone EnvironmentalMalroz EngineeringMTE Consultants Inc./Frontline

EnvironmentalPurifics ESRJ BurnsideRocky Mountain Soil SamplingSNC-Lavalin Inc.Sanexen Environmental ServicesSensaphone Inc.Skelly and Loy,Sonic Soil – ConcordStantec ConsultingTankTekTerrapexTrow GlobalUniversal FabricWESA Envir-EauWaterloo BarrierWESA Inc.WorleyParsonsXCG Consultants

HAZARDOUS/NON-HAZARDOUS RECYCLING SERVICES

PCB ContainmentAnachemBattery BrokerClean Harbors Canada,

Network EnviroNewaltaNorditradeOpta MineralsQuantum Murray LP – Metals DivisionRaw Materials Company Inc.RPR EnvironmentalTri-ArrowUniversal Fabric

HAZARDOUS/NON-HAZARDOUS WASTE TREATMENT

PCB ContainmentAnachemBennett EnviroCircul-AireClean Harbors Canada,EQFanchemHazcoHydroclaveJacques WhitfordNewaltaRCL Plasma,Quantum Murray LP – Hazardous

Materials AbatementQuantum Murray LP – Remediation

DivisionSolution Soil Treatment FacilityTri-Arrow

HAZMAT RESCUE EQUIPMENT

Skedco

HAZMAT STORAGE/CHEMICAL LOCKERS

A & A Sheet Metal Products/SecurallEagle MfgEnviro ProductsFisher SafetyFPILevitt-SafetyQuatrex EnvironmentalSEI Industries Ltd.TankSafeLaden Steel

HEALTH & SAFETY PROGRAMS & SERVICES

Academy SavantActio CorporationEnviro Mgmt Svcs

HEPA VACUUM SYSTEMS

cr/x environmental services, incPentek,

INCINERATION/THERMAL DESTRUCTION

Bennett EnviroEco WasteHydro-ThermalIncinerator ConsultantsNelson Remediation

INDUSTRIAL CLEANING & DECONTAMINATION

EQOptimum Sciences Inc.



Spill MgmtT HarrisThomas Lift Truck ServiceTorys LLPVisual PlanYow Canada

ODOR/VOC CONTROL

AeromixMEGTECRusmar IncTIGG Corporation

OIL WELL ABANDONMENT/OIL FIELD WASTES

Clean Earth SolutionsKapejo Inc.Nelson Remediation

OIL/WATER SEPARATION & RECOVERY

ACG TechAnachemAqua-Guard SpillArbortechCentury Environmental ServsCrimtech SvcsCrucialFilter InnovationsKapejo Inc.Monroe EnvironmentalOilskimmersPAP Eng’gPol-E-MarTreatment ProductsZCL Composites

PCB SERVICES/RECLAMATION/DESTRUCTION

PCB ContainmentIvey International Inc.PCB DisposalQuantum Murray LP – Remediation

DivisionSanexen Environmental ServicesTerratechnik

POLLUTION PREVENTION/WASTE REDUCTION SYSTEMS

ACG TechAir & Water Solutions,American CompactorArbortechCIAL GroupEnviro-StewardsFabco Plastics WesternFabricated PlasticsHydroclaveImbibitive Technologies Canada,IndumarkEnvironmental ProdJacques WhitfordLord & PartnersMarkland SpecialtyNett TechNexGen Enviro Systems,RCL Plasma,Rochester MidlandTrans Enviro

Provincial SvcsTeam-1Young’s Cleanup

INDUSTRY ASSOCIATIONS

AESACBattery CouncilCoast WasteONEIASafety InstituteSEIMASolid Waste & Recycling Mag

INDUSTRY INFORMATION/TECHNICAL RESOURCES/

PUBLISHERS, ETC.

Aqua TerreDonleyECO CanadaECOLOG Info ResourcesHazardous Material InfoIndumarkGovernment PublishingRegscanSolid Waste & Recycling Mag

INORGANIC LABPACK DISPOSAL

RPR Environmental

INSTRUMENTATION/CONTROL/SAMPLING/MONITORING

EQUIPMENT

ACRScott SpecialtyAlaron InstrumentsAlpha ControlsAnalytical MeasurementsAncal,Hazco CanadaArmstrong MonitoringAshtead TechAvensys Inc.Belart ProdBGICancoppasCDS AnalyticalCEAClean AirCoastal EnvironmentalControl InstrumentsDemesaDraeger Safety CanadaGeneqGeonics LimitedGrayWolfHazmastersHeron InstrumentsHetekIndl ScientificINFICONInstrument NWLevitt-SafetyMandel ScientificMarkland SpecialtyMarsh-McBirney, Inc.Mil-Ram TechnologyMTSNovaLynxOpsisOrbeco AnalyticalPhotovac

RAE Systems Inc.Response BiomedicalWaterloo HydrogeologicSensaphone Inc.Servomex Company Inc.ShimadzuSierra MonitorSmiths Detection – DanburySpez-Tech Engineered Fluid Power

TechnologyStaplexSystems PlusThermo Scientific Nitron AnalyzersWilks Ent

INSURANCE AND RISK ASSESSMENT

ALPHuroniaJacques WhitfordWallace, Van Egmond SpankieZurich Insurance Company Ltd.

ISO 14000 TRAINING/CONSULTING

Amadeus – Div. of DECIMALCEMS Chemical Emission Management

ServicesIBS America, Inc.Jacques WhitfordManagement HorizonsPilot Performance Resources ISO

ManagementProcyon ConsultWillms & Shier Env Lawyers

LABELS/SIGNS/PLACARDS/MSDS

3E CompanyAV SystemsActio CorporationAtrion InternationalBelart ProdWH BradyChemical SafetyCompliance Signs,HazmastersJ.J. KellerVisual Plan

LABORATORY TESTING SERVICES

Activation LabAGAT LaboratoriesAlpha ControlsBecquerelEMC ScientificExovaInvestigative ScienceInvitor IntlLineman’s LabsR&R LabSafety InstituteSGS Environmental Services

(Laboratory)

LEAK DETECTION/TANK TESTING

CEAForestry SuppliersHetekMil-Ram TechnologyMTS

PhotovacSierra MonitorTankTekLeybold CdaWaterline EnvironmentalWestMor

LINERS/GEOTEXTILES

Century Environmental ServsCETCOLayfield GeosyntheticPerma-TechRam LiningSeamanSolmax IntlTerrafix Environmental

LIQUID WASTE VACUUM TRUCK HAULAGE

AnachemRPR EnvironmentalTeam-1

MANUFACTURER (DREDGES)

Ellicott Dredges – Div. of Baltimore Dredges, LLC

MEDICAL WASTE STERILIZATION

Hydroclave

NON-GOVERNMENT ORGANIZATIONS

Coast WasteFCM’s Green Municipal FundOHAOSafety InstituteSEIMA

OCCUPATIONAL HEALTH & SAFETY

AV SystemsAbacon Environmental ConsultantsALARAALPAmadeus – Div. of DECIMALBOMA Environmental & SafetyCdn Centre for OH&SCEMS Chemical Emission Management

ServicesChurch & TroughtDanatec EducationalECOH ManagementECOLOG Info ResourcesEducation SafetyEMC ScientificEnvironmental Support Solutions, Inc.

(ESS)Etcos EnvironmentalHazardous Material InfoIBS America, Inc.ICCImageWaveJacques WhitfordJordan DavidMil-Ram TechnologyOHAOPinchin EnvironmentalRAE Systems Inc.SENES ConsultSpecialty Tech




EarthguardECOLOG Info ResourcesEducation SafetyEmerGeo SolutionsEnvironmental Support Solutions, Inc.

(ESS)IBS America, Inc.ImageWaveJ.J. KellerLakes SoftwareRegscanSustaiNet Software SolutionsVisual Plan

SOIL SAMPLING EQUIPMENT

Clements AssocForestry SuppliersSystems Plus

SOLVENT RECOVERY SYSTEMS

MEGTECNexGen Enviro Systems,PAP Eng’g

SPILL & TRAINING

Rocky Mountain Environmental & Safety Equipment

Team-1

SPILL CONTROL PRODUCTS

Aqua-Guard SpillArcusCan-RossCdn Safety EquipCartier ChemicalsCentury GroupCrucialDevconDQE,E.S. Systems, Inc.Eagle MfgEMRP Environmental Marine &

Response ProductsEnviro-SolEnviro ProductsEnviroSan ProductsFisher SafetyGator CdaHazmastersImbibitive Technologies Canada,Loraday EnviroMTSOilskimmersPol-E-MarQuatrex EnvironmentalRocky Mountain EnviroSeamanTankSafeTeam-1Terrafix EnvironmentalTrans EnviroUltraTech InternationalWest Coast Spill Supplies

SPILL RESPONSE/CLEANUP

3E CompanyClean Harbors Canada,EmerGeo SolutionsGolden Environmental ServicesGOwenHannay Reels

Briggs CdaBrown BearC TechThe Cannington Group Inc.Clean Earth SolutionsClements AssocCompreVacConestoga-RoversDEG EnvironmentalECOLOG Info ResourcesEgmond Associates Ltd.Gator CdaGolden Environmental ServicesGOwenGreen-TechGreenspoon Specialty ContractingGroundTech SolutionsHazcoEnvironmental ProdJacques WhitfordKodiakLayfield GeosyntheticMTE Consultants Inc./Frontline

EnvironmentalNelson RemediationOpta MineralsParacel LaboratoriesPCB DisposalQuantum Murray LP – Demolition

DivisionQuantum Murray LP – Remediation

DivisionRam LiningSGS Geostat Ltd.SNC-Lavalin Inc.Sanexen Environmental ServicesSarva Bio RemedScience Applications International

Corporation -SendexSkelly and Loy,Solution Soil Treatment FacilityStrata SoilTankTekTerrapexTerratechnikUniversal FabricWardrop Engineering Inc.Waterline EnvironmentalWaterloo BarrierWilks Ent

SLUDGE FILTRATION/DEWATERING/DREDGING

Brown BearCompreVacENV TreatmentGardner Denver, Inc.Liquid Waste TechParksonWessuc

SOFTWARE/CD-ROM/INTERNET

3E CompanyAV SystemsAcademy SavantActio CorporationAmadeus – Div. of DECIMALAtrion InternationalCdn Centre for OH&SConformance CheckDonleyEagle Technology,

RENTAL EQUIPMENT

Hazco CanadaAshtead TechAtlas DewateringCancoppasClean AirDraeger Safety CanadaGrayWolfHazmastersInstrument NWITT Water & WastewaterTIGG CorporationThomas Lift Truck Service

SAMPLE CONTAINERS, GLASS/PLASTIC

Systems Plus

SECONDARY CONTAINMENT

A & A Sheet Metal Products/SecurallArcusCan-RossCentury GroupE.S. Systems, Inc.Ecologic WasteEnviro-SolEnviro ProductsFPIGemite ProductsHassco IndustriesHazmastersJP SpecialtiesLayfield GeosyntheticLoraday EnviroPol-E-MarQuatrex EnvironmentalRam LiningSEI Industries Ltd.SeamanSolmax IntlTankSafeUltraTech InternationalWest Coast Spill SuppliesWesteel Storage SystemsLaden SteelZCL Composites

SHELTER MANUFACTURER

Weatherhaven

SHREDDERS/CRUSHERS/COMPACTORS/SCREENS

Allu GroupAmerican CompactorTee MarkVoghel Enviroquip IncWizard Drum

SITE & SOIL REMEDIATION

AECOMPCB ContainmentAim Environmental GroupAir Earth WaterAllen VanguardAllu GroupALTECH ConsultingAqua Terre Solutions Inc.Aqua TerreAVARBennett Enviro

Treatment ProductsTurboSonicWizard Drum

PROTECTIVE CLOTHING/EQUIPMENT

Allen VanguardAnsell CanadaHazco CanadaBest GloveCdn Safety EquipComm-AppliedDQE,Fisher SafetyGemtorHazmastersJordan DavidLakelandLevitt-SafetyLineman’s LabsMAPA ProfessionalOptimum Sciences Inc.RoncoSafety ExpressSafety HouseStandard Safety

PUMPS/VALVES/METERS

Alaron InstrumentsCrimtech SvcsEcologic WasteFabco Plastics WesternFabco WholesaleGardner Denver, Inc.Gorman-RuppHassco IndustriesInsitu ContractorsITT Water & WastewaterLiquid Waste TechPerformance Fluid EquipmentRocky Mountain EnviroSpez-Tech Engineered Fluid Power

TechnologyLeybold CdaWestMor

RADIOLOGICAL DECONTAMINATION AND

DEMOLITION

Pentek,Team-1

RAILROAD SPILL CONTAINMENT

Century Group

RECYCLING EQUIPMENT/SERVICES

AnachemArbortechNexGen Enviro Systems,NorditradePAP Eng’gQuantum Murray LP – Metals DivisionTee MarkVoghel Enviroquip IncWizard Drum

RELOCATABLE BUILDINGS

Gemite ProductsRubb



Harold MarcusEnvironmental ProdInterra Hazmat EmergencyJacques WhitfordMinuteman IntlPCB DisposalRocky Mountain Environmental & Safety

EquipmentSarva Bio RemedStandard SafetyTeam-1Wardrop Engineering Inc.WessucYoung’s Cleanup

STORAGE SYSTEMS (USTS, ASTS, ETC.)

A & A Sheet Metal Products/SecurallConVaultEcologic WasteFabricated PlasticsHassco IndustriesWallace, Van Egmond SpankieWaterline EnvironmentalWesteel Storage SystemsWestMorLaden SteelZCL Composites

SURFACE DECONTAMINATION TECHNOLOGIES

Allen VanguardClean Earth SolutionsHydro-ThermalOptimum Sciences Inc.Pentek,Science Applications International

Corporation -

SUSTAINABLE DEVELOPMENT

CETCOEagle Technology,Green-TechJacques WhitfordOCETA

SustaiNet Software SolutionsWeston Solutions

TANKS (PLASTIC)

Crimtech Svcs

TRADESHOWS/CONFERENCES/SEMINARS

Aqua TerreBattery CouncilWH BradyFalcon Ridge GroupCoast WasteECOLOG Info ResourcesEducation SafetyGOwenMPSI – Marketing & Product Services

Inc.Munich Trade Fairs

TRAINING

Achieve TechnologiesCAESEcoBecGlobal Hazmat,LEHDER EnvironmentalPhotech EnvironmentalQuantum Murray LP – Training Division

TRAINING & CONTINUING EDUCATION

Aqua TerreAcademy SavantALARAAESACBowie EnvironmentalFalcon Ridge GroupDanatec EducationalECO CanadaECOLOG Info ResourcesEmergency FilmGOwenHazmastersICC

Incinerator ConsultantsInterra Hazmat EmergencyJ.J. KellerJacques WhitfordKosteckyMPSI – Marketing & Product Services

Inc.OCETAQuantum Murray LP – Training DivisionSEIMASpill MgmtTDG WHMIS

TRANSPORTATION & TDG PRODUCTS/SERVICES

3E CompanyAchieve TechnologiesWH BradyDanatec EducationalFanchemGlobal Hazmat,Harold MarcusINCOM ManufacturingRaw Materials Company Inc.RegscanTDG WHMISYow Canada

VACUUM TANK PRODUCTS & SERVICES

Gardner Denver, Inc.INCOM ManufacturingProvincial SvcsRaw Materials Company Inc.Rocky Mountain Soil SamplingLeybold CdaWesteel Storage Systems

WATER/WASTEWATER TREATMENT SYSTEMS

ACG TechAcme Engineering ProdAeromixAir & Water Solutions,Analytical Measurements

The Cannington Group Inc.Century Environmental ServsChlorinators IncClear Edge FiltrationCompreVacEgmond Associates Ltd.EMRP Environmental Marine &

Response ProductsENV TreatmentFabco WholesaleFilter InnovationsHydro-ThermalIndumarkInsitu ContractorsJP SpecialtiesKPR Adcor VCILakeview Eng’dMonroe EnvironmentalOilskimmersParksonPerformance Fluid EquipmentPurifics ESRGF Environmental Group Inc.EcoWerksSanexen Environmental ServicesTIGG CorporationTerratechnikWaterloo BiofilterXCG Consultants

WEAPONS DEMILITARIZATION/DESTRUCTION (CHEMICAL/

BIOLOGICAL)

CDS AnalyticalComm-Applied

WHMIS/ONLINE OHS TRAINING

Achieve TechnologiesCdn Centre for OH&SGlobal Hazmat,Yow Canada

WILDLIFE SURVEYS

Jacques Whitford




2cg Inc.451 Ferndale AveLondon ON N6C 2Z2519 645-7733Pres/Owner Paul van der Werf

3E Company1905 Aston AveCarlsbad CA 92008760 602-8700 Fax: 760 602-8852.Toll-Free: 800 360-32203E Company is the trusted global provider of chemical, regulatory and compliance information services. 3E’s services offer a cost effective program for regulatory compliance management by alleviating the burdensome aspects of compliance and allowing environ-mental, health and safety (EH&S) professionals to focus on more strategic functions related to providing a safe place to work and live.

A & A Sheet Metal Products/Securall5122 N State Rd 39La Porte IN 46350219 326-7890 Fax: 219 324-3780.Toll-Free: 888 326-7890Toll-Free Fax: 888 324-3780Sls Mgr Randall G Veatch

A.C. Carbone Canada Inc.300 rue BrosseauSt-Jean-Richelieu QC J3B 2E9450 348-1807 Fax: 450 348-3311.Gen Mgr Karl Mertn Jr

A V Systems, Inc. – MIRS4657 Platt RdAnn Arbor MI 48108-7913734 973-3000Dir-Mktg Julie Lasko

Abacon Environmental Consultants Inc.62 Ventana WayWoodbridge ON L4H 1L8905 893-9609 Fax: 905 893-4020.Mgr Mark Jakubczyk

aboutREMEDIATION.com2070 Hadwen Rd, Unit 201AMississauga ON L5K 2C9905 822-4133 Fax: 905 822-3558.Project Mgr Wayne Coutinho

Academy Savant Inc.PO Box 3670Fullerton CA 92834714 870-7880 Fax: 714 526-7400.Toll-Free: 800 472-8268Pres Rabin D Lai

ACG Technology Ltd.131 Whitmore Rd, Unit 13Woodbridge ON L4L 6E4905 856-1414 Fax: 905 856-6401.Pres R Gregory Jackson

Achieve Technologies Ltd.130-8191 Westminster HwyRichmond BC V6X 1A7604 272-9840Toll-Free: 888 833-7233Mgr Norm Kerray

Acme Engineering Prod Ltd.2330 State Rte 11, PMB 10Mooers NY 12958518 236-5659 Fax: 518 236-6941.

ACR Systems Inc.210-12960 84 AveSurrey BC V3W 1K7604 591-1128 Fax: 604 591-2252.Toll-Free: 800 663-7845Mktg Coord Tove Schulz

Actio Corporation30 Internation DrSuite 201Portsmouth NH 03801603 433-2300 Fax: 603 433-2302.Pres Russell McCann

Activation Laboratories Ltd.1336 Sandhill DrAncaster ON L9G 4V5905 648-9611 Fax: 905 648-9613.Toll-Free: 888 288-5227Gen Mgr Eric Hoffman

AECOM300 Water St, Unit 1Whitby ON L1N 9J2905 668-9363 Ext. 2207 Fax: 905 668-0221.Mgr-Waste Servs/Env Kelly Murphy

Aeromix Systems Inc.7135 Madison Ave WMinneapolis MN 55427763 746-8400 Fax: 763 746-8408.Pres Peter Gross

Aevitas Inc.75 Wanless CrtAyr ON N0B 1E0519 740-1333 Fax: 519 740-2320.Toll-Free: 800 324-8997Sls Mgr Tom MaxwellAevitas Inc is an industry leader in providing environmentally responsible and cost effective solutions for unique waste treatment and disposal streams. It is our company objective to provide safe and permanent treatment of a wide range of PCB materials; the only com mercial mercury waste treatment system in Canada; transformer oil draini ng, removal, treatment and re cycling; pioneered mobile treatment of PCB ballasts; drummed waste packaging and removal; and an in-house analytical laboratory testing service with trace organic capabilities.

AGAT Laboratories Ltd.2910 12 St NECalgary AB T2E 7P7403 735-2005 Fax: 403 735-2771.Toll-Free: 866 764-7554Branches:AGAT Laboratories Ltd – British Columbia Region Main Office3104 Beta AveBurnaby BC V5G 4K4778 328-8787 Fax: 778 328-8795AGAT Laboratories Ltd – Alberta Region Main Office2910 12 St NECalgary AB T2E 7P7866 764-7554AGAT Laboratories Ltd – Saskatchewan

Main Office315 Kensington AveEstevan SK S4A 2A6306 636-2347AGAT Laboratories Ltd-Ontario Region Main Office5835 Coopers AveMississauga ON L4Z 1Y2905 712-5100 Fax: 905 712-5122AGAT Laboratories Ltd-Quebec Region Main Office9770 Rte TranscanadienneSaint-Laurent QC H4S 1V9866 417-5227AGAT Laboratories Ltd – Nova Scotia Region Main Office11 Morris Dr, Unit 122Dartmouth NS B3B 1M2888 468-8718AGAT Laboratories is a highly diversified analytical laboratory, specializing in 12 specific divisions: (1) Environmental, (2) Ultra Trace, (3) Agriculture, (4) Air Quality Monitoring, (5) Food Testing, (6) Mining Geochemistry, (7) Routine Core, (8) Geolo gy and Petrology, (9) Reservoir Engineering, (10) Oilsands, (11) Oil and Gas, and (12) Tribology. AGAT’s En viron mental Division provides com prehensive services to environment al consultants, industry and governments including contaminated site testing, de tailed soil and water analysis, com pound identification, research and development.

Aim Environmental Group400 Jones RdStoney Creek ON L8E 5P4905 560-0090 Fax: 905 560-0099.

AiMS Environmental1020 Denison St, Unit 111Markham ON L3R 3W5905 474-0058 Ext. 103 Fax: 905 474-0601.Pres Mohamed Jagani

Air & Water Solutions, Inc.PO Box 627Nutley NJ 07110973 661-5192 Fax: 973 661-3713.Toll-Free: 877 661-5192Mktg Dir Debra Troy

Air Earth & Water Environmental Consultants Ltd.423 Ireland RdSimcoe ON N3Y 5J1519 426-7019 Fax: 519 426-5035.Pres Robert Lovegrove

Air Liquide America Specialty Gases LLCPO Box 310, Plumsteadville PA 18949Location: 6141 Easton Rd215 766-8860 Fax: 215 766-2476.Toll-Free: 800 217-2688Pres Guy Rowland

Aird & Berlis LLP181 Bay St, Brookfield Place, Box 754Toronto ON M5J 2T9Location: BCE Place181 Bay St, Suite 1800416 863-1500 Fax: 416 863-1515.Lawyer Scott Stoll

ALARA Industrial Hygiene Services Limited103 Parkview Hill CresToronto ON M4B 1R5416 759-9579 Fax: 416 759-0372.Pres Charles Pilger

Alaron Instruments2722 Bur Oak Ave, Suite 2Markham ON L6B 1K5905 294-4575 Fax: 905 294-5741.Toll-Free: 800 559-6238Toll-Free Fax: 800 576-7886Mgr John Whittaker

Allen Vanguard2400 St Laurent BlvdOttawa ON K1G 6C4613 739-9646 Fax: 613 739-4536.Toll-Free: 800 644-9078

Allu Group700 Huyler StTeterboro NJ 07608201 288-2236 Fax: 201 288-4479.Pres Mardi Ohanessian

Alp & Associates Incorporated87 Topham CresRichmond Hill ON L4C 9E9905 508-2595 Fax: 905 508-2679.Principal Ertugrul Alp

Alpha Controls & Instrumentation361 Steelcase Rd W, Suite 6Markham ON L3R 3V8905 477-2133 Fax: 905 477-4219.Toll-Free: 800 567-8686Sls Mgr Marc Brand

ALTECH Environmental Consulting Ltd.12 Banigan DrToronto ON M4H 1E9416 467-5555 Fax: 416 467-9824.Toll-Free: 800 323-4937Pres Brian Bobbie

Amadeus – Div. of DECIMAL400 boul Jean-Lesage, bureau 500Québec QC G1K 8W1418 525-0606 Fax: 418 525-0909.Toll-Free: 888 842-9989VP-Sls Anil Joshi

Ambio Biofiltration Ltd.PO Box 644 Stn MainRockland ON K4K 1L4Location: 224 Montee OutaouaisRockland ON K4K 1G2613 446-0274 Fax: 613 446-0275.Pres Calvin Pride

American Compactor, Inc.PO Box 1303Mansfield OH 44901419 522-9550 Fax: 419 522-1807.CEO David Shook

Anachem Ltd.255 rue NormanLachine QC H8R 1A3514 481-8010 Fax: 514 481-6340.Pres Richard Zieba

Analytical Measurements100 Hoffman PlHillside NJ 07205973 399-1444 Fax: 973 399-1446.Toll-Free: 800 635-5580Pres W Richard Adey

2010 Annual Buyers’ Guide


Ancal, Inc.PO Box 530100Henderson NV 89053-0100702 434-1501 Fax: 602 532-7018.Pres Bud Wood

Ansell Canada Inc.105 rue LauderCowansville QC J2K 2K8450 266-1850 Fax: 450 266-6150.Toll-Free: 800 363-8340Toll-Free Fax: 888 267-3551Mktg Asst Irène Guilbault

Aqua-Guard Spill Response Inc.100-1055 14th St WNorth Vancouver BC V7P 3P2604 980-4899 Fax: 604 980-9560.

Aqua Terre Solutions Inc.1100 Sheppard Ave W, Suite 200Toronto ON M3K 2B3416 635-5882 Ext. 118 Fax: 416 635-5353.Toll-Free: 877 635-5882Sr Hydrogeologist Thom Kewen

Aqua Terre Solutions Inc.20 Colonnade Rd, Suite 110Ottawa ON K2E 7M6613 226-2456 Fax: 613 226-9980.Sr Geoscientist Austin Sweezey

Arbortech Corporation3607 Chapel Hill RdJohnsburg IL 60051-2515815 385-0001 Fax: 815 385-0089.Pres Raymond J Graffia Jr

Arcus Absorbents Inc.800 Arrow Rd, Unit 21Toronto ON M9M 2Z8416 745-7947 Fax: 416 745-1174.Toll-Free: 877 227-6727Pres Michael Arcus

Argus-Hazco6541 Mississauga Rd N, Unit AMississauga ON L5N 1A6905 858-3215 Fax: 905 858-3192.Toll-Free: 800 361-3201Gen Mgr Rose Calabrese

Armstrong Insurance Brokers Ltd.PO Box 880, Barrie ON L4M 4Y6Location: 65 Cedar Pointe Dr, Suite 803ABarrie ON L4N 5R7705 722-8377 Fax: 705 722-8896.Toll-Free: 800 461-4286Principal Todd Armstrong

Armstrong Monitoring Corp.215 Colonnade Rd SOttawa ON K2E 7K3613 225-9531 Fax: 613 225-6965.Toll-Free: 800 465-5777Sls/Mktg Mgr Robert Kealey

Ashtead Technology Rentals3505 Laird Rd, Unit 18Mississauga ON L5L 5Y7905 607-9639 Fax: 905 607-8592.Toll-Free: 800 242-3910Key Accts Mgr Christian Lavell

Associated Environmental Site Assessors of Canada Inc. (AESAC)PO Box 490Fenelon Falls ON K0M 1N0 Fax: 705 887-2213.Toll-Free: 877 512-3722Pres Bruno Luzak

Atlas Dewatering111 Ortona CrtConcord ON L4K 3M3905 669-6825 Fax: 905 669-4036.Toll-Free: 877 669-6825Ops Mgr Patrick Maher

Atrion International4777 rue LevySaint-Laurent QC H4R 2P9514 337-2114 Fax: 514 337-9917.Toll-Free: 888 828-7466Event Coord Marie DuvernoyBranches:Location: NijmegenLocation: Montreal, QCAtrion Intl Inc founded in 1989, delivers the most reliable product compliance solutions for multinational ‘formula-based’ companies. By integrating the largest set of Managed Regulatory Content into a prepackaged automated solution and connecting to key ERP systems, Atrion’s Product Compliance Solution ensures that products will reach customers with minimal risks to brand image and shareholder value.

AVAR Environmental Inc.12 Baldwin StDundas ON L9H 1A6289 238-9098Pres Justin Lewis

Avensys Inc.422 Consumers RdToronto ON M2J 1P8416 499-4421 Fax: 416 499-0816.Toll-Free: 888 965-4700VP-Sls/Mktg Pierre Michaud

Barenco Inc.PO Box 295Gormley ON L0H 1G0Location: 2561 Stouffville Rd, Suite 202905 887-6661 Fax: 905 887-1999.Pres Jim Phimister

Battery Broker Environmental Services Inc.11 Tupper AveToronto ON M8Z 5H5416 255-3321 Fax: 416 255-7707.

Battery Council International (BCI)401 N Michigan AveChicago IL 60611-4267312 644-6610 Fax: 312 527-6640.Exec VP Maurice A Desmarais

Becquerel Laboratories Inc.6790 Kitimat Rd, Unit 4Mississauga ON L5N 5L9905 826-3080 Fax: 905 826-4151.Mgr Steven Simpson

Bel-Art Products6 Industrial RdPequannock NJ 07440973 694-0500 Fax: 973 694-7199.Toll-Free: 800 423-5278Pres David Landsberger

Bennett Environmental Inc.1540 Cornwall Rd, Unit 208Oakville ON L6J 7W5

905 339-1540 Fax: 905 339-0016.Toll-Free: 800 386-1388CEO Jack Shaw

Best Glove Manufacturing Limited253 rue MichaudCoaticook QC J1A 1A9819 849-6381 Fax: 819 849-6120.Pres Michael Everett

BGI Incorporated58 Guinan StWaltham MA 02451781 891-9380 Fax: 781 891-8151.Sls Rep T McEachern

BOMA Environmental & Safety Inc.203-2621 Portage AveWinnipeg MB R3J 0P7204 889-5275 Fax: 204 889-2348.P Eng/Dir Dinko Tuhtar

Bowie Environmental Edge Management & Assessment Ltd.PO Box 592Brockville ON K6V 5V7613 345-4337 Fax: 613 345-0358.Pres James S Bowie

Brady Canada355 Apple Creek BlvdMarkham ON L3R 9X7905 764-4236 Fax: 905 764-3670.Toll-Free: 800 263-6179Toll-Free Fax: 800 387-4935Cust Ops Mgr Jamie Button

Braun Intertec Corporation11001 Hampshire Ave SMinneapolis MN 55438952 995-2000 Fax: 952 995-2020.Comm/Traffic Mgr Kathy Stock

Briggs Canada Limited60 Centurian Dr, Suite 104Markham ON L3R 9R2905 479-1277 Fax: 905 479-1318.Pres Rick Greenly

Brown Bear CorporationPO Box 29Corning IA 50841Location: 2248 Avenue of Industries641 322-4220 Fax: 641 322-3527.Pres Stan Brown

C Tech Development CorporationPO Box 971Laie HI 96762-0971808 447-9751 Fax: 714 844-9255.Toll-Free: 800 669-4387Pres Reed D Copsey Sr

CAES Career Advancement Employment Services Inc.522 Burlington Ave, Suite 200Burlington ON L7S 1R8905 681-8240 Fax: 905 639-4601.Pres Jim Gilchrist

Can-Ross Environmental Services Ltd.2270 South Service Rd WOakville ON L6L 5M9905 847-7190 Fax: 905 847-7175.Toll-Free: 888 847-7190Pres Ted Edgar; Mktg Coord Stephanie Coulen

Canadian Centre for Occupational Health and Safety (CCOHS)135 Hunter St EHamilton ON L8N 1M5

905 572-2981 Ext. 4554 Fax: 905 572-2206.Toll-Free: 800 668-4284Comm Mgr Eleanor Westwood

Canadian Industrial Emergency Conference & ExpoPO Box 398Sundre AB T0M 1X0403 638-4410 Fax: 403 638-4413.Toll-Free: 877 534-7285Pres Arnie Gess

Canadian Safety Equipment Inc.2465 Cawthra Rd, Suite 114Mississauga ON L5A 3P2905 949-2741 Fax: 905 272-1866.Toll-Free: 800 265-0182Mgr Ross Humphry

Cancoppas Limited2595 Dunwin Dr, Unit 2Mississauga ON L5L 3N9905 569-6246 Fax: 905 569-6244.Toll-Free: 800 595-0514Pres Jake Alaica

The Cannington Group Inc.4 Fortecon Dr, RR 1 Unit 4Gormley ON L0H 1G0905 841-1848 Fax: 905 841-1062.VP Frank Apollinaro

Cartier Chemicals Ltd.445 21e AvLachine QC H8S 3T8514 637-4631 Fax: 514 637-8804.Toll-Free: 800 361-9432Pres E W Robins

Cassels Brock & Blackwell LLPScotia Plaza40 King St W, Suite 2100Toronto ON M5H 3C2416 869-5300 Fax: 416 360-8877.Partner James Ayres

CDS Analytical, Inc.465 Limestone RdOxford PA 19034610 932-3636 Fax: 610 932-4158.Mktg Gary Deger

CEA Instruments Inc.160 Tillman StWestwood NJ 07675201 967-5660 Fax: 201 967-8450.Toll-Free: 888 893-9640VP-Sls/Mktg Steven Adelman

CEMS Chemical Emission Management Services5211 Preservation CirMississauga ON L5M 7T3905 820-6126 Fax: 905 820-1245.VP Tahir Khan

Century Environmental Services – a Wolseley CompanyPO Box 76 Grp 200RR2 Stn MainWinnipeg MB R3C 2E6Location: 34 Roy Roche Dr204 633-7213 Fax: 204 694-7228.Toll-Free: 888 466-6658Gen Mgr Glen Cotton

Century Group Inc.PO Box 228Sulphur LA 70664-0228Toll-Free: 800 527-5232 Ext. 118Toll-Free Fax: 800 887-2153




Pres/CEO Railroad Prod Div Jon Russ Vincent

CETCO1001 S Linwood AveSanta Ana CA 92705714 384-0111Natl Sls Mgr James Wang

Chem SolvPO Box 608Sutton West ON L0E 1R0Location: 20848 Dalton Rd905 722-6035 Fax: 905 722-5195.Chemist Peter Robertson

CHEMetrics, Inc.4295 Catlett RdCalverton VA 20138540 788-9026 Fax: 540 788-4856.Toll-Free: 800 356-3072VP-Mktg Henry Castameda

Chemical Safety Software5901 Christie AveSuite 502Emeryville CA 94608510 594-1000 Fax: 510 594-1100.Sls/Mktg Mgr Robert Dunn

Chlorinators Incorporated1044 SE Dixie Cutoff RdStuart FL 34994-3436772 288-4854 Fax: 772 287-3238.Owner Diane Haskett

Church & Trought Inc.885 Don Mills Rd, Suite 106Toronto ON M3C 1V9416 391-2527 Fax: 416 391-1931.Partner John Trought

CIAL Group119 Concession 6 RdFisherville ON N0A 1G0416 410-0432 Fax: 416 362-5231.Pres Colin Isaacs

Circul-Aire Inc.3999 boul de la Cote-VertuSaint-Laurent QC H4R 1R2514 336-3330 Fax: 514 337-3336.Toll-Free: 800 800-1868VP-Bus Dev Harry Topikian

Clean Air Instrument Rental500 W Wood StPalatine IL 60067847 991-3300 Fax: 847 934-8260.Toll-Free: 800 553-5511VP-Mktg Steve Rees

Clean Earth Solutions Ltd.178 Pennsylvania Ave, Unit 4Concord ON L4K 4B1905 482-2149 Fax: 416 913-1610.Toll-Free: 866 885-2706Pres Kevin SharfeComplete and continuous enhanced deep in situ aerobic hydrocarbon bioremediation solutions without chemical release or mechanical aeration. Soil and groundwater. Prudent response. Ecologically responsible.

Clean Harbors Canada, Inc.4090 Telfer Rd, RR 1Corunna ON N0N 1G0

519 864-3894 Fax: 519 864-3866.Toll-Free: 800 444-4244VP-Sls Michael La Rocque

Clear Edge Filtration16779 boul HymusKirkland QC H9H 3L4514 694-1132 Fax: 514 694-3828.Toll-Free: 800 363-6612Office Mgr Debbie Gale

Clements Assoc. Inc.1992 Hunter AveNewton IA 50208641 792-8285 Fax: 641 792-1361.Pres James M Clements

Coast Waste Management Association1185 Rolmar CresCobble Hill BC V0R 1L4250 733-2213 Fax: 250 733-2214.Toll-Free: 866 386-2962Exec Dir Will Burrows

Coastal Environmental Systems, Inc.820 First Ave SSeattle WA 98134206 682-6048 Ext. 133 Fax: 206 682-5658.Toll-Free: 800 488-8291 Ext. 133Product Mgr Jim McGregor

Communications-Applied Technology11250 14 Roger Bacon DrReston VA 20190 Fax: 703 471-4428.Toll-Free: 800 229-3925Pres Seth G Leyman

Compliance Signs, Inc.56 South Main StChadwick IL 61014800 578-1245 Fax: 800 578-1246.E-Mktg Coord David Anderson

CompreVac Inc.3067 Jarrow AveMississauga ON L4X 2C6905 624-4096 Fax: 905 624-4099.Toll-Free: 888 603-6172Gen Mgr Jonathan Snook

Conestoga-Rovers & Associates651 Colby DrWaterloo ON N2V 1C2519 884-0510 Fax: 519 884-0525.Toll-Free: 800 265-6102Bus Dev Mgr Bruce McConnellBranches:110-3851 Shell RdRichmond BC V6X 2W2604 214-0510 Fax: 604 214-05255920 1A St SW, Suite 601Calgary AB T2H 0G3403 271-2000 Fax: 403 271-3013111 Brunel Rd, Suite 200Mississauga ON L4Z 1X3905 712-0510 Fax: 905 712-0515179 Colonnade Rd, Suite 400Ottawa ON K2E 7J4613 727-0510 Fax: 613 727-07044610 boul de la Côte-VertuSaint-Laurent QC H4S 1C7514 336-0510 Fax: 514 336-943445 Akerley BlvdDartmouth NS B3B 1J7

902 468-1248 Fax: 902 468-2207CRA provides comprehensive engineering, environmental consulting, construction, and information technology (IT) services. CRA employs more than 3,000 people in over 90 offices across North America, Argentina, Brazil and England. Since 1976 CRA has provided clients with responsive, high quality, practical, and effective solutions in such areas as environmental site assessment and remediation, solid and hazardous waste management, regulatory compliance, air quality management, municipal infrastructure planning and design, and many others.

Conformance Check Inc.52 Harrop AveEtobicoke ON M9B 2G9416 620-0846 Fax: 866 306-5084.COO Robert Kolanko

Control Instruments Corp.25 Law DrFairfield NJ 07004973 575-9114 Fax: 973 575-0013.Mktg Mgr Patty Gardner

ConVault, Inc.4109 E Zeering RdDenair CA 95316209 632-7571 Fax: 209 632-4711.Toll-Free: 800 222-7099VP-Mktg David P Harris

Crimtech Services Ltd.45-27429 Township Road 374Red Deer County AB T4S 2H4403 342-7579 Fax: 403 342-6929.Toll-Free: 800 993-9958

Crucial, Inc.142 Enterprise DrGretna LA 70056504 347-9292 Fax: 504 347-8900.Gen Mgr Wally Landry

cr/x environmental services, inc.1026 Fourth AveCoraopolis PA 15108412 262-0730 Fax: 412 262-0731.Sls Rep Tim Benedict

Danatec Educational Services Ltd.201-11450 29 St SECalgary AB T2V 3V5403 232-6950 Fax: 403 232-6952.Toll-Free: 800 465-3366Pres Ronald Martin

DEG Environmental Ltd.PO Box 3024Brighton ON K0K 1H0613 475-1996 Fax: 613 475-5249.Site Mgr John Crowe

Demesa, Inc.458 Morden RdOakville ON L6K 3W4905 842-6985 Fax: 905 842-0226.Toll-Free: 866 333-6372Dir-Tech Servs Martin J Hurtubise; Credit Dept Mgr Diana Kovacevic

Devcon3421 Fairview CrtWestbank BC V4T 1C1250 768-4851 Fax: 250 768-5969.Intl Bus Mgr Ian Goodland

Donley TechnologyPO Box 152

Colonial Beach VA 22443Location: 220 Garfield Ave804 224-9427Pres Elizabeth Donley

DQE, Inc.8112 Woodland DrIndianapolis IN 46278317 295-9770 Fax: 317 295-9822.Toll-Free: 800 355-4628Pres Howard Levitin

Draeger Safety Canada Ltd.7555 Danbro CresMississauga ON L5N 6P9905 821-8988 Fax: 905 821-2565.Toll-Free: 877 372-4371Toll-Free Fax: 800 329-8823Mktg Asst Lynn Scharfe

E.S. Systems, Inc.151 Kalmus Dr, Suite A202Costa Mesa CA 92626-5999714 513-2117 Fax: 714 513-2118.Natl Sls Mgr Mikel Bills

Eagle Manufacturing Company2400 Charles StWellsburg WV 26070304 737-3171 Fax: 304 737-1752.VP/Sls Mgr John Mitchell

Eagle Technology, Inc.11019 North Towne Square RdMeguon WI 53092262 241-3845 Fax: 262 241-5248.Toll-Free: 800 388-3268Pres Harshad Shah

Earthguard Environmental Group Inc.178 Main StUnionville ON L3R 2G9905 415-1200 Fax: 905 477-4745.Chairman/CEO Joseph Pilarski

ECO Canada200-308 11 Ave SECalgary AB T2G 0Y2403 233-0748 Fax: 403 269-9544.Client Relations Mgr Janelle Leonard

Eco Waste Solutions5195 Harvester Rd, Unit 14Burlington ON L7L 6E9905 634-7022 Fax: 905 634-0831.Toll-Free: 866 326-2876CEO Steve Meldrum

EcoBec 200017952 ch Sainte-MarieKirkland QC H9J 2L5514 697-9888 Fax: 514 697-5508.Pres Richard Masterton

ECOH Management Inc.6130 Tomken RdMississauga ON L5T 1X7905 795-2800 Fax: 905 795-2870.Toll-Free: 866 231-6855Pres Mark Lai

EcoLog Environmental Resources Group12 Concorde Pl, Suite 800North York ON M3C 4J2416 510-5197 Fax: 416 510-5133.Toll-Free: 888 702-1111 Ext. 5Gen Mgr Carol Bell-LeNouryThe EcoLog Group includes HazMat Management and Solid Waste & Re cycling magazines as well as



Jackson MS 39201-6126 Fax: 601 355-5126.Toll-Free: 800 360-7788Toll-Free Fax: 800 543-4203

FPI151 Kalmus Dr, Suite A202Costa Mesa CA 92626-5999714 513-2100 Fax: 714 513-2111.Pres Stephen VanValkenburgh

Gardner Denver, Inc.1800 Gardner ExpyQuincy IL 62305217 222-5400 Fax: 217 228-8243.Toll-Free: 800 682-9868Mktg Coord/Serv Coord Linda Paul

Gator Canada439-8840 210 StLangley BC V1M 2Y2604 857-9048 Fax: 604 857-9049.Toll-Free: 866 444-9048CEO Ron Van Luven

Gemite Products Inc.3840 E Robinson Rd, Suite 160Amherst NY 14228 Fax: 905 672-6780.Toll-Free: 888 443-6483Mktg Mgr Igor Nikolajev

Gemtor, Inc.1 Johnson AveMatawan NJ 07747-2595732 583-6200 Fax: 732 290-9391.Toll-Free: 800 405-9048

Geneq Inc.8047 rue Jarry EAnjou QC H1J 1H6514 354-2511 Fax: 514 354-6948.Toll-Free: 800 463-4363Pres Maurice Parise

Geonics Limited1745 Meyerside Dr, Unit 8Mississauga ON L5T 1C6905 670-9580 Fax: 905 670-9204.Tech Sls Rep Mike Catalano

Global Hazmat, Inc.423 505-8840 210th StLangley BC V1M 2Y2604 882-4999 Fax: 604 882-4980.Toll-Free: 877 744-4999Toll-Free Fax: 888 882-4980Pres Kevin Swinden

GlobalTox367 Woodlawn Rd W, Unit 6Guelph ON N1H 7K9519 766-1000 Fax: 519 766-1100.Principal Mark Goldberg

Golden Environmental Services2207 Simcoe Road 93, RR 1Barrie ON L4M 4Y8705 726-3921 Fax: 705 721-1599.Toll-Free: 800 414-2404Dir-Sls/Mktg Chad TrivettBranches:726 Hopkins AvePeterborough ON K9J 4Y5705 313-3830Soil and Groundwater Remediation Specialists. In-situ and Ex-situ

Etcos Environmental96 Terrosa RdMarkham ON L3S 2N1905 471-9890 Fax: 905 471-6439.Project Mgr Ravi Sharma

Exova2395 Speakman DrMississauga ON L5K 1B3866 263-9268 Fax: 905 823-1446.Cust Care Liz Summerfield

Fabco Plastics Western Ltd.12938 148 St NWEdmonton AB T5L 2H8780 451-0238 Fax: 780 455-4816.Sls Mgr John Shrum

Fabco Plastics Wholesale (Ontario) Limited2175A Teston RdMaple ON L6A 1T3905 832-0600 Fax: 905 832-0992.Toll-Free: 800 565-6189Toll-Free Fax: 800 668-8415Sls Mgr Mike Fallis

Fabricated Plastics Limited2175 Teston RdMaple ON L6A 1T3905 832-8161 Fax: 905 832-2111.VP-Sls G Landry

Fanchem Ltd.3228 South Service Rd, Suite 207Burlington ON L7N 3H8905 637-7034 Fax: 905 637-7037.Sls Mgr Brian Malcolm

FCM’s Green Municipal Fund24 Clarence StOttawa ON K1N 5P3613 214-5221 Fax: 613 244-1515.Comm Mgr Lorie BoucherFCM’s Green Municipal Fund (GMF) offers a range of resources and services that specifically address the sustainable community development needs of municipal governments. The Fund provides financing and knowledge to support the development of commun-ities that are more environmentally, socially and economically sustainable.

Filter Innovations Inc.744 Gordon Baker RdNorth York ON M2H 3B4416 490-7848 Fax: 416 490-0974.Toll-Free: 877 803-0878Pres/CEO John Dragasevich

Fisher Environmental400 Esna Park Dr, Unit 15Markham ON L3R 3K2905 475-7755 Fax: 905 475-7718.Pres Dave Fisher

Fisher Safety112 Colonnade RdOttawa ON K2E 7L6613 228-6259 Fax: 613 226-8639.Toll-Free: 877 676-3639Toll-Free Fax: 866 228-4615Mktg Mgr Julie Blackburn

Forestry Suppliers, Inc.PO Box 8397Jackson MS 39284-8397Location: 205 W Rankin St

Oakville ON L6K 3W9 Fax: 905 844-6953.Toll-Free: 888 767-2268Admin Don Wright

Enviro-Stewards Inc.1 Union StElmira ON N3B 3J9519 578-5100 Fax: 519 669-5002.Pres Bruce Taylor

Environmental Business Consultants33 Wanita RoadMississauga ON L5G 1B3905 271-2845Pres James Sbrolla

Environmental Management Services, Inc.1688 E Gude Dr, Suite 301Rockville MD 20850301 309-0475 Fax: 301 309-9052.Corp Bus Dir Angela Sharma

Environmental Products Inc.5350 Evergreen PkySheffield Village OH 44054440 934-2180 Fax: 440 934-4052.Sls Mgr Laurie Benko

Environmental Support Solutions, Inc (ESS)1620 W Fountainhead Pky, Suite 100Tempe AZ 85282480 346-5500 Fax: 480 346-5599.Toll-Free: 800 289-6116Toll-Free Fax: 800 743-9423Acct Exec Sales.

EnviroSan Products / SOLUTION 2000 International170 Alexandra BlvdToronto ON M4R 1M4416 483-5580 Fax: 416 483-5539.Pres Paul Marks

EQ-The Environmental Quality Company36255 Michigan AveWayne MI 48184734 329-8000 Fax: 734 329-8140.Toll-Free: 800 592-5489Toll-Free Fax: 800 592-5329Bus Dev Mgr Nanette Myers

ERIS (Environmental Risk Information Service)12 Concorde Pl, Suite 800North York ON M3C 4J2416 510-5204 Fax: 416 510-5133.Toll-Free: 866 517-5204Res/Dev Mgr Mark MatteiERIS can provide you with site and neighbourhood specific environmental information from over 440 different government and private databases! This allows you to focus environmental site assessments, maintain company records and/or address liability issues prior to property tansactions. ERIS provides high quality and reliable environmental reports and additional services for historical records review in a fast, accurate and convenient manner.

environmental and safety legislation services, newsletters and websites for the busy EHS professional. We are Canada’s largest publisher of business information for environment and occupational health & safety. EcoLog also produces the annual Environmental Compliance Conference each November. EcoLog’s ERIS division provides environmental risk information and property data from over 440 different government and private databases in a fast, accurate and convenient manner. For more information, visit EcoLog and it’s group of websites: www.ecolog.com, www.hazmatmag.com, www.solidwastemag.com, www.eris.ca.

Ecologic Waste Systems Corporation20 Steckle Pl, Unit 4Kitchener ON N2E 2C3519 893-2200 Fax: 519 893-3010.Toll-Free: 800 268-5082Pres Gerry O’Connor

The Education Safety Association of Ontario4950 Yonge St, Suite 902Toronto ON M2N 6K1416 250-8005 Fax: 416 250-9190.Toll-Free: 877 732-3726Dir-Prog Dev Jim Bell

Egmond Associates Ltd27 Hall RdGeorgetown ON L7G 0A4416 782-7227Toll-Free: 877 755-7227Toll-Free Fax: 877 755-7227Principal John VanEgmond

Ellicott Dredges, LLC1425 Wicomico StBaltimore MD 21230410 545-0232 Fax: 410 545-0293.Dir-Sls Paul P Quinn

EMC Scientific Inc.5800 Ambler Dr, Suite 100Mississauga ON L4W 4J4905 629-9247 Fax: 905 629-2607.Man Dir Alister Haddad

Emergency Film GroupPO Box 1928Edgartown MA 02539508 627-8844 Fax: 508 627-8863.Pres Gordon Massingham

EmerGeo Solutions Inc.1001-1166 Alberni StVancouver BC V6E 3Z3604 681-0989Toll-Free: 888 577-0911CTO Timothy Webb

EMRP Environmental Marine & Response Products Inc.23 Craig St, Unit 3Brantford ON N3R 7H8519 751-3405 Fax: 519 751-3443.Pres John Theurer

ENV Treatment Systems Inc.70 High StToronto ON M8Y 3N9416 503-7639 Fax: 416 503-8925.Water Mgr Robert Rainford

Enviro-Sol Plus466 Speers Rd, Floor 3



http://www.ecolog.com


http://www.solidwastemag.com

http://www.solidwastemag.com

http://www.eris.ca


International Products Corp.201 Connecticut DrBurlington NJ 08016609 386-8770 Fax: 609 386-8438.

Interra Hazmat Emergency Response – Div. of Interra Environmental Inc.Bay 12-2180 Pegasus Way NECalgary AB T2E 8M5403 236-4901 Fax: 403 236-1759.Toll-Free: 866 249-7583Pres Barry Lesiuk

Intrinsik Environmental Sciences Inc.6605 Hurontario St, Suite 500Mississauga ON L5T 0A3905 364-7800 Fax: 905 364-7816.Contact Glenn FergusonBranches:Calgary AB; Guelph ON; Ottawa ON; Halifax NSIntrinsik Environmental Sciences Inc. is a leading science-based consulting firm, providing expert advice on toxi cology, human health and ecological risk assessment, risk communication, public consultation and regulatory affairs. With five offices in Canada and more than 40 highly qualified professionals, we are uniquely positioned to apply our diverse expertise and experience in the fields of biology, toxicology, aquatic toxicology, environmental toxicology and environmental studies to help our clients manage their diverse environmental issues and challenges.

Investigative Science Incorporated1050 Cooke Blvd, Unit 2Burlington ON L7T 4A8905 634-4200 Fax: 905 634-1966.Principal James Ford

InVitro International17751 Sky Park E, Suite GIrvine CA 92614949 851-8356 Fax: 949 851-4985.Toll-Free: 800 246-8487Pres/CEO W Richard Ulmer

ITT Water & Wastewater300 av LabrossePointe-Claire QC H9R 4V5514 695-0100 Fax: 514 697-0602.Comm Mgr Raymond Simond

Ivey International Inc.PO Box 706Campbell River BC V9W 6J3250 923-6326 Fax: 250 923-0718.Toll-Free: 800 246-2744

J.J. Keller & Associates, Inc.PO Box 368Neenah WI 54957-0368Location: 3003 W Breezewood LaneNeenah WI 54956920 722-2848 Fax: 920 727-7516.Toll-Free: 800 327-6868Toll-Free Fax: 800 727-7516Dir-Bus Dev David Ellis

IBS America, Inc.125 Hartwell AveLexington MA 02421781 862-9002 Fax: 781 862-9003.VP-Sls Dan Riordan

ICC The Compliance Center Inc.205 Matheson Blvd E, Unit 7Mississauga ON L4Z 1X8905 890-7228 Fax: 905 890-7070.Toll-Free: 888 977-4834Toll-Free Fax: 888 821-0735Acct Mgr Greg Monette

ImageWave CorporationPO Box 4504Lago Vista TX 78645512 267-9705 Fax: 512 267-9703.

Imbibitive Technologies Canada, Inc.8 Hiscott St, Suite 1St Catharines ON L2R 1C6905 641-2323 Fax: 905 641-3601.Toll-Free: 888 843-2323Toll-Free Fax: 877 439-2323Pres John S Brinkman

Incinerator Consultants Incorporated20755 Crescent Point PlAshburn VA 20147703 437-1790 Fax: 703 891-9350.Pres Charles Brunner

INCOM Manufacturing Group1259 Sandhill DrAncaster ON L9G 4V5 Fax: 905 648-7188.Toll-Free: 800 263-6238Toll-Free Fax: 800 263-2945VP Cy Dicks

Indumark16 N Franklin St, Suite 201ADoylestown PA 18901215 348-5105Owner Clifford Lebowitz

Industrial Scientific Corporation14845 Yonge St, Suite 197Aurora ON L4G 6H8905 727-5595 Fax: 905 727-1594.Toll-Free: 800 338-3287Reg AB/Cdn Mgr Scott Hayzelden

INFICONTwo Technology PlEast Syracuse NY 13057-9714315 434-1100 Fax: 315 437-3803.Mktg Comm Supvr Naomi Kissel-Johns

Insitu Contractors Inc.150 Stevenson St SGuelph ON N1E 5N7519 763-0700 Fax: 519 763-6684.CEO Harry Oussoren

Instrumentation Northwest, Inc.8902 122nd Ave NEKirkland WA 98033425 822-4434 Fax: 425 822-8384.Toll-Free: 800 776-9355Sls Rep Romey Gilbert

International Environmental Products2 Villanova Center795 E Lancaster Ave Suite 280Villanova PA 19085610 520-7665 Fax: 610 520-7663.VP-Sls Joe Dougherty

416 410-3130 Fax: 416 410-1249.Toll-Free: 877 877-1862VP-Sls/Mktg Sven DeanGroundTech Solutions is the exclusive distributor of Geoprobe direct push machines and technologies in Canada. With locations in Toronto, Ontario and in Red Deer, Alberta we provide Genuine Geoprobe equipment, service, training, and field demonstrations of the very latest Geoprobe Models specially designed for the tougher soil conditions found throughout Canada.

Hannay Reels Inc.553 State Route 143Westerlo NY 12193518 797-3791 Fax: 518 797-3259.Toll-Free: 877 467-3357Toll-Free Fax: 800 733-5464Dir-Adv/Pub Rel Edward Rash

Harold Marcus Limited15124 Longwoods RdBothwell ON N0P 1C0519 695-3734 Fax: 519 695-2249.Pres Denis Marcus

Hassco Industries Inc.223 Ashland AveLondon ON N5W 4E3519 451-3100 Fax: 519 451-3102.Toll-Free: 800 668-0814Pres David Hassan

Hazardous Materials Information Review Commission427 Laurier Ave W, Floor 7Ottawa ON K1A 1M3613 993-4331 Fax: 613 993-4686.Mgr Danile Goulet

HAZCO Environmental Services103-3355 114th Ave SECalgary AB T2Z 0K7403 297-0444 Fax: 403 253-3188.Toll-Free: 800 667-0444Pres David Mattinson

Hazmasters1915 Clements Rd, Units 1-2Pickering ON L1W 3V1905 427-0220 Fax: 905 427-9901.Toll-Free: 877 747-7117Pres Randy Myers; Mktg Mgr Jan Beattie

Heron Instruments Inc.2031 James StBurlington ON L7R 1H2905 634-4449 Fax: 905 634-9657.Toll-Free: 800 331-2032VP-Sls/Mktg Victoria Toon

Hetek Solutions, Inc.2085 Piper LaneLondon ON N5V 3S5519 659-1144 Fax: 519 453-2182.Toll-Free: 888 432-8422CEO Wayne Hennigar; VP/Gen Mgr Andy Pauley

Hydro-Thermal Corp.400 Pilot CrtWaukesha WI 53188262 548-8900 Fax: 262 548-8908.Toll-Free: (Canada) 800 952-0121

Hydroclave Systems Corp.662 Norris CrtKingston ON K7P 2R9613 389-8373 Fax: 613 389-8554.Pres/CEO Richard Vanderwal

programs. Bio-Augmented Chemical Oxidation, Bio-Remediation, Chemical Oxidation, Metal Stabilization, Horizontal Injection Pathways, Emergency Spill Response Bio-Applications.

Gorman – Rupp of Canada Limited70 Burwell RdSt Thomas ON N5P 3R7519 631-2870 Fax: 519 631-4624.Mktg Mgr Mark Neal

GOwen Environmental Limited1 Palace Pier Crt, Suite 3901Toronto ON M8V 3W9416 259-6911 Fax: 416 606-1656.Pres Gareth Owen

Gowling Lafleur Henderson LLPPO Box 121 Stn 1st Can PlaceToronto ON M5X 1G5Location: 1 First Canadian Place100 King St W, Suite 1600416 862-4300 Fax: 416 863-3410.

Grayling Industries, Inc.1008 Branch DrAlpharetta GA 30004770 751-9095 Fax: 770 751-3710.Toll-Free: 800 635-1551Mktg Mgr Ben Greene

GrayWolf Sensing Solutions LLC6 Research DrShelton CT 06484203 402-0477 Fax: 203 402-0478.Toll-Free: 800 218-7997Mktg Admin Laura Lee

Green-Tech Environmental Engineering Ltd.250 Consumers Rd, Suite 307Toronto ON M2J 4V6416 364-1760 Fax: 416 253-8901.Toll-Free: 519 913-0696Toll-Free Fax: 519 913-0787Pres/Eng Thomas W Davis P Eng

Greenspoon Specialty Contracting42 Stafford DrBrampton ON L6W 1L4905 458-1005 Fax: 905 458-4149.VP-Enviro Servs JP MariniGreenspoon Specialty Contracting has been actively engaged in the Demolition and Environmental Remediation industry for over 50 years. Spanning across the commercial, industrial and government sectors, GSC is proficient in all areas of demolition (implosion and dismantlement), asbestos, mould and lead abatement, soil/groundwater remediation and site decomissioning. Proficient in LEED projects. Offices in Toronto, Winnipeg, Buffalo.

GroundTech SolutionsPO Box 1271 Stn KToronto ON M4P 3E5



heat recovery technology for process optimization, dryer/oxidizer refurbishing, plant and process energy optimization, heat exchanger replacements, and catalyst sales/testing services, and industrial ovens for coating and painting processes.

Mil-Ram Technology, Inc.4135 Business Center DrFremont CA 94538510 656-2001 Fax: 510 656-2004.Toll-Free: 888 464-5726Pres Carlos B Ramirez

Miller Thomson LLPPO Box 1011Toronto ON M5H 3S1Location: 40 King St W, Suite 5800416 595-8500 Fax: 416 595-8695.Toll-Free: 888 762-5559Sr Mgr-Mktg/Bus Dev Martha HartwickBranches:Robson Crt, 1000 840 Howe StVancouver BC V6Z 2M1800 794-6866 Fax: 604 643-1200E-mail: [email protected]. Web: www.millerthomson.com3000-700 9th AveCalgary AB T2P 3V4888 298-2400 Fax: 403 262-0007E-mail: [email protected]. Web: www.millerthomson.com2700 Commerce Pl10155 102 StEdmonton AB T5J 4G8800 215-1016 Fax: 780 424-5866E-mail: [email protected]. Web: www.millerthomson.comOntario AGRI Centre100 Stone Rd, Suite 301Guelph ON N1G 5L3866 658-0092 Fax: 519 822-1583E-mail: [email protected]. Web: www.millerthomson.comOne London Pl255 Queens Ave, Suite 2010London ON N6A 5R8877 319-3500 Fax: 519 858-8511E-mail: [email protected]. Web: www.millerthomson.com60 Columbia Way, Suite 600Markham ON L3R 0C9866 348-2432 Fax: 905 415-6777E-mail: [email protected]. Web: www.millerthomson.comAccelerator Bldg295 Hagey Blvd, Suite 300Waterloo ON N2L 6R5866 658-0091 Fax: 519 743-2540E-mail: [email protected]. Web: www.millerthomson.comMiller Thomson PouliotCIBC Tower1155 boul René-Lévesque O, étage 31Montréal QC H3B 3S6888 875-5210 Fax: 514 875-4308E-mail: [email protected]. Web: www.millerthomsonpouliot.com

Minuteman International, Inc.14N845 US Route 20Pingree Grove IL 60140630 570-2371 Fax: 847 683-5207.

Liquid Waste Technology, LLC1750 Madison AveNew Richmond WI 54017715 246-2888 Fax: 715 246-2573.Sls Mgr Steven Panasuk

Loraday Environmental Products142 Commerce Park Rd, Unit 1Barrie ON L4N 8W8705 733-3342 Fax: 705 733-3352.Toll-Free: 888 853-6600Pres Peter Lorimer

Lord & Partners Ltd.741 Muskoka Rd 3 N, Unit 9Huntsville ON P1H 2L3705 788-1966 Fax: 705 788-1969.Toll-Free: 877 490-6660Pres/CEO Barry Young

MPSI – Marketing & Product Services Inc.4223 Rundlehorn Dr NECalgary AB T1Y 2K3403 285-9809 Fax: 403 280-0384.Pres Jack M Qually

Malroz Engineering Inc.308 Wellington St, Floor 2Kingston ON K7K 7A8613 548-3446 Fax: 613 548-7975.Pres David Malcolm

Management Horizons2779 Herald RdSharon ON L0G 1V0905 853-4775 Fax: 905 836-5306.Toll-Free Fax: 866 578-4617

Mandel Scientific Co Inc.2 Admiral PlGuelph ON N1G 4N4519 763-9292 Fax: 519 763-2005.Toll-Free: 888 883-3636

MAPA Professional100 Spontex DrColumbia TN 38401Toll-Free: 800 537-2897Toll-Free Fax: 800 537-3299Mktg Mgr Carmen A Castro

Markland Specialty Engineering Ltd.305 Armstrong Ave, Unit 9Georgetown ON L7G 4X6905 873-7791 Fax: 905 873-6012.Gen Mgr Scott Langstaff

Marsh-McBirney, Inc. – A Hach Company Brand4539 Metropolitan CrtFrederick MD 21704301 874-5599 Fax: 240 358-0243.Hach Flow Sales Customer Support Group

MEGTEC Systems830 Prosper RdDe Pere WI 54115920 337-1579 Fax: 920 339-2793.Toll-Free: 800 862-6943Mktg/Admv Asst Heidi TaylorManufacturer of regenerative thermal, recuperative and catalytic oxidizers,

Toll-Free: 866 577-2326Pres Rick G Kozuch

Lakeland Protective Wear Inc.59 Bury CrtBrantford ON N3S 0A9519 757-0700 Fax: 519 757-0799.Toll-Free: 800 489-9131Gen Mgr Peter Brasseur

Lakes Environmental Software419 Phillip St., Unit 3Waterloo ON N2L 3X2519 746-5995 Fax: 519 746-0793.Pres Jesse Thé

Lakeview Engineered Products Inc.2500 W Jefferson BlvdFort Wayne IN 46802260 432-3479 Fax: 260 432-6239.Ops Mgr Jim Woolf

Layfield Geosynthetics & Industrial Fabrics Ltd.11603 180 St NWEdmonton AB T5S 2H6780 453-6731 Fax: 780 455-5218.Toll-Free: 800 840-2884Mktg Coord Tim Starchuk

LEHDER Environmental Services Limited704 Mara St, Suite 210Point Edward ON N7V 1X4519 336-4101 Fax: 519 336-4311.Principal Mark RoehlerBranches:9954 67th AveEdmonton AB T6E 0P5780 462-4099 Fax: 780 462-4392Principal Daryl ZanderLEHDER is one of the largest Air Quality Management companies in Canada. At LEHDER we recognize our client’s need to make decisions that provide for operational flexibility while meeting regulatory economic and social requirements. All Air Quality aspects – source testing, emission inventories, air dispersion modeling, data interpretation and approval applications – are managed internally without outsourcing and partnering. LEHDER Environmental Services provides totally integrated solutions to industrial clients throughout North America.

Levitt-Safety Limited2872 Bristol CirOakville ON L6H 5T5905 829-3299 Fax: 905 829-2919.Toll-Free: 888 453-8488Inside Sls Mgr Lynn Peca-Chmara

LEX Scientific Inc.2 Quebec St Suite 204Guelph ON N1H 2T3519 824-7082 Fax: 519 824-5784.Toll-Free: 800 824-7082Dir Michael Hoffbauer

Lineman’s Testing Laboratories of Canada Limited41 Rivalda RdNorth York ON M9M 2M4416 742-6911 Fax: 416 748-0290.Toll-Free: 800 299-9769Gen Mgr Robby Borda

Jacques Whitford Limited7271 Warden AveMarkham ON L3R 5X5905 474-7700 Fax: 905 479-9326.VP Bill Stiebel

Jagger Hims Limited1091 Gorham St, Suite 301Newmarket ON L3Y 8X7905 853-3303 Fax: 905 853-1759.Toll-Free: 800 263-7419

JLM Systems Ltd.23091 Westminster HwyRichmond BC V6V 1B9604 521-3248 Fax: 604 521-1244.Toll-Free: 888 736-8645Pres Dick Gangnon

Jordan David400 Babylon RdHorsham PA 19044215 441-9595 Fax: 215 441-9642.Toll-Free: 888 667-5477Pres/CEO Jonathan Bell

JP Specialties, Inc.551 Birch StLake Elsinore CA 92530951 674-6869 Fax: 951 674-1315.Toll-Free: 800 821-3859Pres/Owner David R Poole

Kam Biotechnology Ltd.101-9710 187th StSurrey BC V4N 3N6604 888-4336 Fax: 604 888-6623.Pres Aline Ferchichi

Kapejo Inc.PO Box 649New Castle DE 19720-0649302 322-4222 Fax: 302 322-6062.Pres/CEO Peter C Martinez

Keystone Environmental Ltd.320-4400 Dominion StBurnaby BC V5G 4G3604 430-0671 Fax: 604 430-0672.Principal William R Donald

Kidde Canada Inc.340 Four Valley DrConcord ON L4K 5Z1905 695-6060 Fax: 905 660-4670.Toll-Free: 800 667-0423Toll-Free Fax: 877 545-6555VP Joe Di Filippo

Kilmer Brownfield Equity Fund L.P.Scotia Plaza40 King St W, Suite 2700 Box 127Toronto ON M5H 3Y2416 814-3437 Fax: 416 635-7697.Dev Mgr Pamela Kraft

Kodiak Environmental Limited871 Equestrian Crt, Unit 1AOakville ON L6L 6L7905 825-2943 Fax: 905 825-8743.Env Geologist Doug Ritcey

Kostecky Environmental Ltd.PO Box 7 Site 7 RR 2Cochrane AB T4C 1A2403 932-3243 Fax: 403 932-7374.Principal Morley M Kostecky

KPR Adcor VCI Inc.PO Box 57130 RPO Jackson SqHamilton ON L8P 4W9Location: 2 King St W905 628-3232 Fax: 905 628-2529.




http://www.millerthomson.com














http://www.millerthomsonpouliot.com


Procyon Consulting Inc.238 Hickling TrBarrie ON L4M 5W5705 739-9738 Fax: 705 739-8448.Mgr Doreen Chamberlin

Provincial Environmental Services IncPO Box 843Hamilton ON L8N 3N9Location: 505 Kenora Ave NHamilton ON L8E 3P2905 577-0575 Fax: 905 577-0842.Toll-Free: 800 263-9762Gen Mgr John Daneliuk

Publishing and Depository Services, Public Works and Government Services Canada350 Albert St, Floor 5Ottawa ON K1A 0S5Toll-Free: 800 635-7943Toll-Free Fax: 800 565-7757

Purifics ES Inc.340 Sovereign RdLondon ON N6M 1A8519 473-5788 Fax: 519 473-0934.Pres Brian Butters

Quantum Murray LP – Demolition Division345 Horner Ave, Suite 300Toronto ON M8W 1Z6416 253-6000 Fax: 416 253-6699.Toll-Free: 800 565-7054Pres Demolition Karim El-Khatib

Quantum Murray LP – Hazardous Materials Abatement Division100-3600 Viking WayRichmond BC V6V 1N6604 270-7388 Fax: 604 270-7389.Toll-Free: 800 251-7773Pres Haz Mat Division Doug Wynn

Quantum Murray LP – Metals Division961 Zelco DrBurlington ON L7L 4Y2905 681-8832 Fax: 905 637-6267.Toll-Free: 800 932-6232Pres Metals Gary Thomson

Quantum Murray LP – Remediation Division1749 Woodward DrOttawa ON K2C 0P9613 820-9622 Fax: 613 820-9623.Toll-Free: 800 251-7773Pres Remediation Brian Stuckert

Quantum Murray LP – Training Division10 Kenmore Ave, Unit 4Stoney Creek ON L8E 5N1905 388-4444 Fax: 905 643-3106.Toll-Free: 877 378-7745 Mark Jasper

Quatrex Environmental Inc.1011 Haultain Crt, Unit 16Mississauga ON L4W 1W1905 848-1039 Fax: 905 848-9323.Toll-Free: 866 782-8739Pres Patrick Paradis

R & R Laboratories Ltd.1557 Fair AvePeterborough ON K9K 1T1705 748-9564 Fax: 705 748-9564.Pres Ramesh Makhija

Parkson Corporation1000 boul Saint-Jeanbureau 205Pointe-Claire QC H9R 5P1514 636-8712 Fax: 514 636-9718.Reg Mgr Jean Grenier

PCB Disposal Inc.72 Lake Drwy WAjax ON L1S 3X1905 428-6480 Fax: 905 428-6481.Toll-Free: 800 563-7227Pres Eric A H Smith

Pentek, Inc.1026 Fourth AveCoraopolls PA 15108412 262-0725 Fax: 412 262-0731.Sls Rep Tim Benedict

Perma-Tech Industrial Coatings23100 Miles RdCleveland OH 44128 Fax: 216 663-7202.Toll-Free: 888 885-4637

PFE Pumps Inc.5 Progress DrOrillia ON L3V 6H1705 327-6550 Fax: 705 327-6551.Toll-Free: 866 683-7867Adv/Mktg Mgr Diane Balcerczyk

Photech Environmental Solutions Inc.600 Read RdSt. Catharines ON L2R 7K6905 938-9465 Fax: 905 938-8978.Toll-Free: 877 938-9465Toll-Free Fax: 877 938-8978

Photovac, Inc.300 Second AveWaltham MA 02451781 290-0777 Fax: 781 290-4884.VP-Sls/Mktg Lon Loken

Pilot Performance Resources ISO ManagementPO Box 68584Brampton ON L6R 0J8Location: 25 Great Lakes Dr905 792-3130Pres Jayne Pilot

Pinchin Environmental2470 Milltower CrtMississauga ON L5N 7W5905 363-0678 Fax: 905 363-0681.Toll-Free: 888 767-3330Mktg Mgr Robin Connelly

Plasco Energy Group Inc.1145 Innovation DrSuite 100Ottawa ON K2K 3G8613 591-9438 Fax: 613 591-9441.Exec VP Christopher Gay

Pol-E-Mar Inc.617 WindmillDartmouth NS B3B 1B6902 466-2151 Fax: 902 466-2264.Toll-Free: 800 250-9224VP/Gen Mgr John McKim

NovaLynx CorporationPO Box 240Grass Valley CA 95945530 823-7185 Fax: 530 823-8997.Toll-Free: 800 321-3577Pres Joseph R Andre

Occupational Hygiene Association of Ontario (OHAO)6519B Mississauga RdMississauga ON L5N 1A6905 567-7196 Fax: 905 567-7191.Exec Mgr Peter Fletcher

OCETA – Ontario Centre for Environmental Technology Advancement2070 Hadwen Rd, Unit 201AMississauga ON L5K 2C9905 822-4133 Fax: 905 822-3558.Pres/CEO Kevin Jones

OilSkimmers Inc.PO Box 33092Cleveland OH 44133-0092Location: 12800 York Rd440 237-4600 Fax: 440 582-2759.Toll-Free: 800 200-4603Pres Mike Guandiani

Ontario Environment Industry Association330 Adelaide St W, Suite 218Toronto ON M5V 1R4416 531-7884Exec Dir Alex Gill

Opsis Inc.1165 Linda Vista Dr, Suite 113San Marcos CA 92078760 752-3005 Fax: 760 752-3007.Pres Paul Stenberg

Opta Minerals Inc.407 Parkside Dr EWaterdown ON L0R 2H0905 689-6661 Fax: 905 689-3989.QC Mgr John Papaioannou

Optimum Sciences Inc.1874 Hwy 206, Unit 2Fonthill ON L0S 1E6905 892-1800 Fax: 905 892-4359.Pres Paul Couture

Orbeco-Hellige, Inc.6456 Parkland DrSarasota FL 34243941 756-6410 Fax: 941 727-9654.Toll-Free: 800 922-5242Mktg Rep Kaylie Boland

Osler, Hoskin & Harcourt LLPPO Box 50Toronto ON M5X 1B8Location: 1 First Canadian Pl416 362-2111 Fax: 416 862-6666.Partner Daniel Kirby

PAP Engineering Services34 Jasmine RdToronto ON M9M 2P9416 743-9601 Fax: 416 747-9058.Design Eng Pat Priorello

Paracel Laboratories Ltd.2319 St. Laurent Blvd, Suite 300Ottawa ON K1G 4J8613 731-9577Toll-Free: 800 749-1947Sls Mgr Dan Barton

Toll-Free: 800 323-9420 Ext. 2371Dir-Hazmat Div Ed Hribar

Monalt Environmental Inc.73 Railside Rd, Unit 4North York ON M3A 1B2416 391-3241 Fax: 416 391-3815.Pres Cornel Monaru

Monroe Environmental Corp.PO Box 806Monroe MI 48161Location: 810 West Front St734 242-7654 Fax: 734 242-5275.Toll-Free: 800 992-7707Pres Gary Pashaian

MTE Consultants Inc.520 Bingemans Centre DrKitchener ON N2B 3X9519 743-6500 Fax: 519 743-6513.Vice President / Sr Hydrogeologist Peter Gray

MTS Sensors3001 Sheldon DrCary NC 27513919 677-0100 Fax: 919 677-0200.Product Mktg Mgr Lee Aiken

Munich Trade Fairs Canada IFAT2842 Bloor St WToronto ON M8X 1B1416 237-9939 Fax: 416 237-9920.Pres Brigitte Mertens

My green workplace159 Ridout St SLondon ON N6C 3X7519 645-7733 Fax: 519 317-7733.Pres Paul van der Werf

Nelson Environmental Remediation Ltd.52520A Range Rd 271Spruce Grove AB T7X 3M8780 960-3660 Fax: 780 962-6885.Toll-Free: 888 960-8222Pres Darryl Nelson

Nett Technologies Inc.6707 Goreway Dr, Unit 2Mississauga ON L4V 1P7905 672-5453 Fax: 905 672-5949.Toll-Free: 800 361-6388Tech Exec Abhinav Dhingra

Network Environmental Services Inc.31 Golden Gate CrtScarborough ON M1P 3A4416 299-0116 Fax: 416 299-9649.Toll-Free: 800 272-6118Pres Mike Aston

Newalta Corporation211 11 Ave SWCalgary AB T2R 0C6403 806-7000 Fax: 403 806-7348.Exec Dir Corp Comm Stephen Lewis

NexGen Enviro Systems, Inc.190 E Hoffman AveLindenhurst NY 11757631 226-2930 Fax: 631 236-3125.Toll-Free: 800 842-1630Pres Michael N Robbins

Norditrade Inc.132 Banff RdToronto ON M4P 2P5416 469-8438 Fax: 416 489-4168.Pres Lars Henriksson



SEIMA113-2505 11th AveRegina SK S4P 0K6306 543-1567 Fax: 306 543-1568.COO Kathleen Livingston

Sendex Environmental Corp.417 Exeter RdLondon ON N6E 2Z3519 680-3868 Fax: 519 680-3870.Pres Marc B Trudell

SENES Consultants Limited121 Granton Dr, Unit 12Richmond Hill ON L4B 3N4905 764-9380 Fax: 905 764-9386.Pres Don Gorber

Sensaphone Inc.901 Tryens RdAston PA 19014610 558-2700 Fax: 610 558-0222.Toll-Free: 877 373-2700VP-Sls/Mktg Robert Douglass

Servomex Company Inc.525 Julie Rivers Dr, Suite 185Sugar Land TX 77478281 295-5800 Fax: 281 295-2834.Toll-Free: 800 862-0200Mktg Specialist Tina Igunbor

SGS Environmental Services (Laboratory)185 Concession StLakefield ON K0L 2H0705 652-2111 Fax: 705 652-6365.Toll-Free: 877 747-7658Sr Project Specialist Chris Sullivan

Shimadzu Scientific Instruments7102 Riverwood DrColumbia MD 21046410 381-1227 Fax: 410 381-1222.Pres Takeshi Kawami

Sierra Monitor Corporation1991 Tarob CrtMilpitas CA 95035408 262-6611 Fax: 408 262-9042.VP-Mktg Steve Ferree

Skedco, Inc.PO Box 3390Tualatin OR 97062Location: 10505 SW ManRasset Dr503 691-7909 Fax: 503 691-7973.VP/Gen Mgr Bud Calkin

Skelly and Loy, Inc.449 Eisenhower BlvdSuite 300Harrisburg PA 17111-2302717 232-0593 Fax: 717 232-1799.Toll-Free: 800 892-6532Pres John Gunnett

Smiths Detection – Danbury21 Commerce DrDanbury CT 06810203 207-9700 Fax: 203 207-9780.Toll-Free Fax: 888 473-6747Mgr Dana Knox-Gower

SNC-Lavalin Inc.2200 Lake Shore Blvd WToronto ON M8V 1A4416 679-6116 Fax: 416 231-5356.VP-Environment Douglas B Hodgins

Safety Equipment Institute1307 Dolley Madison Blvd, Suite 3AMcLean VA 20170703 442-5732 Fax: 703 442-5756.Pres Pat Gleason

Safety Express Ltd.4190 Sladeview Cres, Unit 1Mississauga ON L5L 0A1905 608-0111 Fax: 905 608-0091.Toll-Free: 800 465-3898Toll-Free Fax: 888 608-0091Pres Nak Tsounis

Safety House267 North Rivermede RdConcord ON L4K 3N7605 660-8794 Fax: 905 660-6903.Toll-Free: 877 663-7735

Sanexen Environmental Services Inc.1471 boul Lionel-Boulet, bureau 32Varennes QC J3X 1P7450 652-9990 Fax: 450 652-2290.Toll-Free: 800 263-7870Sanexen is a Canadian Service and technology company specialising in fully integrated PCB waste manage-ment, site remediation, biotreatment, water treatment, risk assessment, as well as rehabilitation of underground watermains using trenchless technologies. Sanexen’s team of experienced professionals can provide turnkey solutions to a wide range of environmental problems. Over the last ten years, Sanexen has also developed a significant expertise in environmental work in the arctic.

Sarva Bio Remed, LLC11 North Willow StTrenton NJ 08608609 695-4922 Fax: 419 710-5831.Toll-Free: 877 717-2782 Ext. 1Pres/CEO Satya Ganti

Schlumberger Water Services460 Phillip St, Suite 101Waterloo ON N2L 5J2519 746-1798 Fax: 519 885-5262.Mktg Mgr Martin Draeger

Science Applications International Corporation – SAIC Canada60 Queen St, Suite 1516Ottawa ON K1P 5Y7613 563-7242 Fax: 613 563-3399.VP/Div Mgr SAIC Canada Kenneth F Donovan

Seaman Corporation1000 Venture BlvdWooster OH 44691704 987-0055 Fax: 704 987-0140.Toll-Free: 800 927-8578Toll-Free Fax: 800 649-2737Specialist-in-Charge Bill Shehane

our staff has had over 980,000 hours on-site experience and completed over 9,000 projects from emergency service and maintenance calls to multi-million dollar projects. REC Staff has CPIC Security Clearance. 1-800-894-4924 Canada/USA.

Rivercourt Engineering Inc.250 Merton St, Suite 502Toronto ON M4S 1B1416 481-5474Pres Andrew Hellebust

Rochester Midland Limited851 Progress CrtOakville ON L6J 5A8905 847-3000 Fax: 905 847-1675.Toll-Free: 800 387-7174Serv/Support Mgr Annette Kieft

Rocky Mountain Environmental & Safety Equipment Ltd.3155-21331 Gordon WayRichmond BC V6W 1J9604 275-1346 Fax: 604 241-0995.Toll-Free: 888 677-4556Gen Mgr Ron MacMillan

Rocky Mountain Environmental Ltd.3155-21331 Gordon WayRichmond BC V6W 1J9604 275-1346 Fax: 604 241-0995.Toll-Free: 888 677-4556Pres Ron MacMillan

Rocky Mountain Soil Sampling Inc.PO Box C-23Bowen Island BC V0N 1G0Location: North Vancouver BC V7J 1G1604 947-7677Pres Andrew Thompson

Ronco267 North Rivermede RdConcord ON L4K 3N7905 660-6700 Fax: 905 660-6903.Toll-Free: 877 663-7735

RPR Environmental Inc.164 South Service RdStoney Creek ON L8E 3H6905 662-0062 Fax: 905 662-9607.Toll-Free: 800 667-5217Sls Mgr Patrick Whitty

Rubb Inc.1 Rubb LaneSanford ME 04073207 324-2877 Fax: 207 324-2347.Toll-Free: 800 289-7822Dir-Mktg Gordon Collins

Rusmar Incorporated216 Garfield AveWest Chester PA 19380800 733-3626 Fax: 610 436-8436.Sls/Mktg Mgr Rebekah Gormish

SEI Industries Ltd.7400 Wilson AveDelta BC V4G 1E5604 946-3131 Fax: 604 940-9566.Div Mgr Paul Reichard

SGS Geostat Ltd.10 boul de la Seigneurie E, bureau 203Blainville QC J7C 3V5450 433-1050 Fax: 450 433-1048.Toll-Free: 800 474-6561Mgr Claude Duplessis

RAE Systems Inc.3775 N 1st StSan Jose CA 95134408 952-8200 Fax: 408 952-8400.Toll-Free Fax: 877 723-2878

RGF Environmental Group Inc.3875 Fiscal CrtWest Palm Beach FL 33404561 848-1826 Fax: 561 848-9454.VP Walter Ellis

R.J. Burnside & Associates Limited15 TownlineOrangeville ON L9W 3R4519 941-5331 Fax: 519 941-8120.

Ram Lining Systems Inc.RR 1 Bayfield ON N0M 1G0519 524-1904 Fax: 519 524-6721.Pres Frank Kunc

Raw Materials Company Inc.PO Box 6Port Colborne ON L3K 5V7Location: 17 Invertose Dr905 835-1203 Fax: 905 835-6824.Dir Richard Unyi

RegScan, Inc.800 W Fourth StWilliamsport PA 17701570 323-1010 Ext. 1415 Fax: 570 323-8082.Toll-Free: 800 734-7226Coord Glenda Rutherford

Response Biomedical Corporation1781 75th Ave WVancouver BC V6P 6P2604 456-6010 Fax: 604 456-6083.Acct Mgr Biodefense Michael Bayliss

Restoration Environmental Contractors – REC Demolition-REC Disaster RecoveryPO Box 746, Gormley ON L0H 1G0Location: 10 Stalwart Industrial Dr, Unit 5905 888-0066 Fax: 905 888-0071.Toll-Free: 800 894-4924Pres/CEO Don BremnerBranches:Restoration Environmental Contractors – REC Demolition124 Garden AveBrantford ON N3S 7W4519 757-1126 Fax: 519 756-8721Restoration Environmental Contractors – REC Demolition240 McLeod StOttawa ON K1P 6P4613 567-1173 Fax: 613 567-4853Restoration Environmental REC Disaster Response106-1st St E 109Tierra Verde FL 33715We’re the Abatement, Demolition and Remediation Experts: Specializing in Disaster and Emergency Response, Structural Building Demolition, Removal of all Hazardous Materials; including Asbestos, Mould-Mold Remediation (Microbial Decontamination), Fire Flood Water Damage Restoration, Lead Paint, Lead and Heavy Metal Dust, Industrial Plant Decommissioning, PCB’s and Infectious Disease Control. Since 1989,




Since 1989, Terrafix has successfully supplied and installed more than 50,000,000 ft2 of Geosynthetics worldwide. Worldwide services include: Supply/Installation of all types of Geomembrane & Geosynthetic Clay Liners; Spray-on Seam less Membranes, Asphaltic-rubber, Poly-urea and Poly urethane; Fusion welding of PE pipe; Supply and installation of Geotextiles, Geonets, Geocomposites and Geogrids, as well as many other Geo synthetics.

Terrapex Environmental Ltd.49 Coldwater RdToronto ON M3B 1Y8416 245-0011Contact Jennifer O’GradyBranches:Location: Burlington ON905 632-5939Contact George KosztyoLocation: Ottawa ON613 745-6471Contact Paul HubleyOur Values: Integrity – Technical Excellence – Personal Service – Prac-tical Approach Our Vision: Terrapex will be the preferred provider of environ-mental consulting services, and the preferred employer of environmental practitioners. Terrapex will set the standard to which our competition aspires.

Terratechnik Environmental2355 Royal Windsor Dr, Unit 12Mississauga ON L5J 4S8905 855-4943 Fax: 905 855-4936.Pres Barry Harris

Thermo Scientific Niton Analyzers900 Middlesex Turnpike, Bldg 8Billerica MA 01821978 670-7460 Fax: 978 670-7430.Toll-Free: 800 875-1578Mktg Mgr Jonathan Shein

Thomas Lift Truck Service Ltd.30 Devon RdBrampton ON L6T 5B5905 791-0007 Fax: 905 791-0282.Toll-Free: 800 651-5850Gen Mgr John Gowland

Torys LLPTD CentrePO Box 270 Stn Toronto DominionToronto ON M5K 1N2Location: 79 Wellington St W, Suite 3000416 865-0040 Fax: 416 865-7380.Toll-Free: 800 505-8679Partner Dennis Mahony

TIGG Corporation1 Willow AveOakdale PA 15071724 703-3020 Fax: 724 703-3026.Toll-Free: 800 925-0011Bus Dev Mgr Jeff MarmarelliBranches:Location: Houston TXLocation: Herber Springs ARTIGG Corporation designs and fabricates systems to remove trace contaminants from air and water. We manufacture more than 60 standard modular adsorbers, which can be filled with a media to meet your specific needs. Our scope of supply can include pumps and blowers, pre-filters and mist eliminators and ductwork and piping modules. Combined with our ability to create rental and exchange programs we have created a one-stop shopping resource for your purification challenge.

TankSafe Inc.208-3112 11 St NECalgary AB T2E 7J1403 291-3937 Fax: 403 291-5125.Mktg Mgr Jon Johnston

TankTek Environmental Services Ltd.970 Third Concession Rd, RR 1Pickering ON L1V 2P8905 839-4400 Fax: 905 839-6600.Toll-Free: 877 789-6224Gen Mgr Thomas Burt

TDG – WHMIS Compliance Centre Inc.9320 49 St NWEdmonton AB T6B 2L7 Fax: 780 469-0485.Toll-Free: 888 860-2068Mgr Michael Burke

TEAM HAZCO Emergency Services1650 Upper Ottawa StHamilton ON L8W 3P2905 383-5550 Fax: 905 574-0492.Toll-Free: 800 327-7455National Director of Emergency Services Mitchell Gibbs

Tee Mark Corporation1132 Air Park DrAitkin MN 56431218 927-2200 Fax: 218 927-2333.Toll-Free: 800 428-9900Sls/Mktg Mgr Denny Rach

Terrafix Environmental Technology Inc.178 Bethridge RdToronto ON M9W 1N3416 674-0363 Fax: 416 674-7346.Gen Mgr John Mooney

Staplex Air Sampler Division777 Fifth AveBrooklyn NY 11232-1626718 768-3333 Fax: 718 965-0750.Toll-Free: 800 221-0822Sls Mgr Doug Butler

Strata Soil Sampling Inc.147 West Beaver Creek Rd, Unit 2Richmond Hill ON L4B 1C6905 764-9304 Fax: 905 764-1124.Toll-Free: 866 778-7282Ops Mgr Johan FeneliusStrata Provides environmental drilling services using the latest machines from Geoprobe Systems, the world leader in direct push technologies. Strata uses reliable and cost efficient sampling methods with modern machines that are specifically designed to meet the needs of Canada’s unique soil conditions. Strata also installs up to 2’ diameter monitor well installations, provides SPT and CP services.

SustaiNet Software Solutions Inc.910-1111 Melville StVancouver BC V6E 3V6604 717-4327 Fax: 604 736-9531.Pres Howard Adam

Systems PlusPO Box 839New Hamburg ON N0B 2G0Location: 1451 Gingerich RdBaden ON N3A 3J7519 634-5708 Fax: 519 634-5779.Toll-Free: 800 604-2645Pres Garry Ruttan

T. Harris Environmental Management Inc.93 Skyway AveSuite 101, Toronto ON M9W 6N6416 679-8914 Fax: 416 679-8915.Toll-Free: 888 275-8436Pres/COO John C FisherBranches:Location: 931 Commissioners Rd ESuite 100, London ON N5Z 3H9Location: 19 Fairmont AveSuite 305, Ottawa ON K1Y 1X4Location: 5 Place du Commercebureau 100, Brossard QC J4W 3E7T. Harris Environmental Management Inc. (THEM) Is a diverse group of engineering, scientific, technical and industrial hygiene professionals providing consulting services to a variety of industrial, commercial, and institutional clients since 1979. THEM is committed to providing our clients with high quality services at cost effective prices, and in a time-efficient manner.

Solid Waste & Recycling Magazine12 Concorde Pl, Suite 800Toronto ON M3C 4J2416 510-6798 Fax: 416 510-5133.Toll-Free: 888 702-1111Editor Guy CrittendenSolid Waste & Recycling magazine is published six times a year by the Business Information Group. The magazine provides strategic information and perspectives on all aspects of Canadian solid waste collection, hauling, processing and disposal. Readers include municipal waste managers, recycling coordinators and haulers, as well as waste managers from the industrial, commercial and institutional sectors, consultants and operators of landfills, transfer stations, MRFs, incinerators, composting and other facilities.

Solmax International Inc.2801 boul Marie-VictorinVarennes AB J3X 1P7450 929-1234 Fax: 450 929-2547.Toll-Free: 800 571-3904NA Sales Mgr Michael Winterbourne

Solution Soil Treatment Facility236 Glasgow St NGuelph ON N1H 4X2519 763-2227 Fax: 519 763-9887.Dir-Bus Dev Neil Ryan

Sonic Soil Sampling Inc.668 Millway AveUnits 15-16Concord ON L4K 3V2905 660-0501 Fax: 905 660-7143.Toll-Free: 877 897-6642

Specialty Technical Publishers306-267 Esplanade WNorth Vancouver BC V7M 1A5604 983-3434 Fax: 604 983-3445.Toll-Free: 800 251-0381Pres Chris Heming

Spez-Tech Engineered Fluid Power Technology2144 Burbank DrMississauga ON L5L 2T8905 828-5579 Fax: 905 828-8189.Sls/Tech Mgr Lou Speziale

Spill Management Inc.45 Upper Mount Albion RdStoney Creek ON L8J 2R9905 578-9666 Fax: 905 578-6644.Pres/Owner Cliff Holland

Standard Safety Equipment CompanyPO Box 189, McHenry IL 60051Location: 1407 Ridgeview DrMcHenry IL 60050815 363-8565 Fax: 815 363-8633.Pres/CEO Scott R Olson

Stantec Consulting Ltd.49 Frederick StKitchener ON N2H 6M7519 579-4410 Fax: 519 579-6733.Eng David Flynn



XCG Consultants Ltd.2620 Bristol CirSuite 300Oakville ON L6H 6Z7905 829-8880 Fax: 905 829-8890.Branches:Edmonton AB; Kingston ON; Kitchener ON; Cincinnati OHExpert People. Better Decisions. XCG Consultants Ltd. is an environmental engineering firm that has earned a reputation for excellence. Our staff is committed to delivering innovative, practical and sustainable solutions. XCG offers comprehensive services in water and wastewater treatment, infrastruc-ture management, water resources, site assessment and remediation, risk assessment, solid waste, and training and operations.

Young’s Environmental Cleanup, Inc.G-5305 N Dort HwyFlint MI 48505810 789-7155 Fax: 810 789-3606.Toll-Free: 800 496-8647Pres R S Young

YOW Canada Inc.1306 Algoma RdOttawa ON K1B 3W8613 688-2845 Fax: 613 248-0711.Toll-Free: 866 688-2845Sls/Mktg Coord Marie-Chantale PerronBranch: Ottawa ONProvides easy-to-use, OH&S ONLINE TRAINING & materials, including:– WHMIS Online (French/English)– TDG Online– Confined Spaces Online– Fall Protection Online– WHMIS DVD Training– Posters, Pocket Guides, Regulation

Binders– Safety Meeting Kits and more!Website: www.yowcanada.comEmail: [email protected]: 1 (866) 688-2845.

ZCL Composites Inc.6907 36 St NWEdmonton AB T6B 2Z6780 466-6648 Fax: 780 466-6126.Toll-Free: 800 661-8265Mktg Asst Kirsten Hamilton

Zurich Insurance Company Ltd.400 University AveToronto ON M5G 1S7416 586-2953 Fax: 416 586-2703.Toll-Free: 800 387-5454

West Coast Spill Supplies Ltd.1570 Kersey RdBrentwood Bay BC V8M 1J5250 652-4549 Fax: 250 652-5052.Toll-Free: 888 548-3800VP D’arcy Anderson

Westech Industrial Ltd.240 Matheson Blvd EMississauga ON L4Z 1X1905 890-5265 Ext. 225 Fax: 905 890-6213.Mktg Mgr Nansi Conceicao

Westeel Storage Systems5812 48th AveOlds AB T4H 1V1403 556-9497 Fax: 403 556-9487.Toll-Free: 800 665-2099

WestMor Industries, LLC.PO Box 683Morris MN 56267-0683Location: 3 Development Dr320 589-2100 Fax: 320 589-2206.Toll-Free: 800 992-8981

Weston Solutions, Inc.1400 Weston WayWest Chester PA 19380610 701-3000 Fax: 610 701-5104.Pres/COO Patrick McCann

Wilks Enterprise, Inc.140 Water StSouth Norwalk CT 06854203 855-9136 Fax: 203 838-9868.Pres Sandra Rintoul

Willms & Shier Environmental Lawyers LLP4 King St W, Suite 900Toronto ON M5H 1B6416 863-0711 Fax: 416 863-1938.Partner John Willms

Wizard Drum Tool Company400 Pilot CrtWaukesha WI 53188262 548-8910 Fax: 262 548-8915.Toll-Free: 800 628-8628

WorleyParsons4500 16 Ave NWCalgary AB T3B 0M6403 247-0200 Fax: 403 247-4811.Toll-Free: 800 668-6772

X-treme Energy GroupPO Box 6239 Stn MainInnisfail AB T4G 1S9Location: 3600 61 Ave403 227-5400 Fax: 403 227-4073.Toll-Free: 800 661-3747Mgr Tony Smethurst

Voghel Enviroquip Inc5250 Satellite Dr, Unit 8Mississauga ON L4W 5G5416 444-1358 Fax: 905 209-1142.Contact Munish Sood

WESA Envir-Eau160 boul de l’Hôpital, bureau 204Gatineau QC J8T 8J1819 243-7555 Fax: 819 243-0167.Pres Andre D’Astous

Wallace, Van Egmond Spankie Inc.27 Hall RdGeorgetown ON L7G 0A4Toll-Free: 877 755-7227Toll-Free Fax: 877 755-7227Pres John Van Van Egmond

Wardrop Engineering Inc.250 Shields Crt, Unit 15Markham ON L3R 9W7905 470-6570 Ext. 140 Fax: 905 470-0958.Pres Harry Kim

Waterline Environmental Inc.4151 Morris Dr, Unit 4Burlington ON L7L 5L5905 333-6604 Fax: 905 333-0368.Pres Stu A Ferguson

Waterloo Barrier Inc.PO Box 385Rockwood ON N0B 2K0519 856-1352 Fax: 519 856-0759.Mgr Robin Jowett

Waterloo Biofilter Systems Inc.PO Box 400, Rockwood ON N0B 2K0Location: 143 Dennis St519 856-0757 Fax: 519 856-0759.Pres Craig Jowett

Weatherhaven8355 Riverbend CrtBurnaby BC V3N 5E7604 451-8900 Fax: 604 451-8999.Sector Acct Mgr Sweena Chatha

Wells Cargo Inc.PO Box 728Elkhart IN 46515-0728Location: 1503 McNaughton AveElkhart IN 46514-0728574 264-9661 Fax: 574 264-5938.Toll-Free: 800 348-7553Adv Mgr Scott Samuels

WESA Inc.4 Kern Rd, Suite 1Toronto ON M3B 1T1416 383-0957 Fax: 416 383-0956.Principal David Hopper

Wessuc Inc.1693 Colborne St. EBrantford ON N3T 5L4519 752-0837 Fax: 519 752-0840.Toll-Free: 866 493-7782VP Hank Van Veen

Trans Environmental Systems, Inc.PO Box 8001Charlottesville VA 22906434 975-2872 Fax: 434 975-2972.Toll-Free: 800 220-2466Pres Merrill E Bishop

Treatment Products CorporationPO Box 72444Thorndale PA 19372610 384-6279 Fax: 610 384-6239.Pres/Owner Donald R Zimmerman

Tri-Arrow Industrial Recovery Inc.13364 Comber WaySurrey BC V3W 5V9604 597-7334 Fax: 604 597-7382.Toll-Free: 877 579-9988Gen Mgr Herb Locke

Trow Global Inc.56 Queen St E, Suite 701Brampton ON L6V 4M8905 796-3200 Fax: 905 793-5533.Toll-Free: 866 989-8769Contact Janet Atkins-Dauphirais

TSL Response Technologies Ltd.15724 Hurontario StCaledon ON L7C 2C4905 838-3156 Fax: 905 838-2039.Pres Wes Armstrong

TurboSonic Inc.550 Parkside Dr, Unit A-14Waterloo ON N2L 5V4519 885-5513 Fax: 519 885-6992.Pres Egbert vanEverdingen

UltraTech International Inc.11542 Davis Creek CrtJacksonville FL 32256904 292-1611 Fax: 904 292-1325.Toll-Free: 800 353-1611Mktg Mgr Mario Cruz

Universal Fabric Structures, Inc.2200 Kumry RdQuakertown PA 18951215 529-9921 Fax: 215 529-9936.Toll-Free: 800 634-8368Business Dir Tom Nesfeder

URS Canada Inc.75 Commerce Valley Dr EMarkham ON L3T 7N9905 882-4401 Fax: 905 882-4399.VP-Enviro Serv Mahmood Ghinani

Vacuum Products Canada Inc.7050 Telford Way, Unit 5Mississauga ON L5S 1V7905 672-7704 Fax: 905 672-2249.Toll-Free: 800 269-6030Mgr Christina Carere

Visual Planning Corporation6805 boul DécarieMontréal QC H3W 3E4514 739-3116 Fax: 514 739-0085.Toll-Free: 800 361-1192Toll-Free Fax: 888 563-8730Man Dir Joseph P Josephson



http://www.yowcanada.com




data, thus enabling the determination of the uncertainty linked to the analytical process. These quality control data are compared to and must meet established acceptability criteria before transmission to the client. Internal lab quality control procedures also exist within the lab in regards to unacceptable results. In general, quality control results are included in the final analytical report.

The understanding and application of laboratory qual-ity control results is the first important step in evaluating uncertainty and interpreting analytical data. In essence, knowing the uncertainty allows for a better understanding of the data as well as its impact on the decisions that must be taken, especially when reported concentrations fall close to applicable environmental regulations.

Notably, the analytical data must be consistent with the site history, potential contamination sources, the nature of the samples, the applied sampling method, evidence of contamination on the site, and more. To take it one step further, the detection of certain chemical compounds can be linked to specific sources of contamination. For example,

Canadian Brownfields Network

Working onBrownfields?Canada's Voice for Brownfield

RedevelopmentBuilding CapacityAdvocacy

Think TankForum

LinkagesExpertise

CommunicationConnectivity

CommunitySustainability

Revitalization

www.CanadianBrownfieldsNetwork.ca

CBN new version 9/3/08 9:22 AM Page 1

CleanEARTH Solutions Ltd.178 Pennsylvania Ave. Unit 4, Concord, ON L4K 4B1 Canada

Tel: (905) 482-2149 Toll Free: 1-866-885-2706Fax: (416) 913-1610Email: [email protected]

Complete and continuous enhanceddeep in situ aerobic hydrocarbonbioremediation solutionswithout chemical release or mechanical aeration.

Soil and groundwater.Prudent response.Ecologically responsible.

www.cleanearthltd.com

Clean Earth 1/4 ad 4/21/09 10:20 AM Page 1

gasoline contamination will result in the finding of volatile organic compounds (BTEX) and light polycyclic aromatic hydrocarbons (PAHs) upon chemical analysis. Also, the interpretation of chromatograms obtained with petroleum hydrocarbon analyses is a very interesting tool in the deter-mination of the source of a contamination.

Overall, there are many tools available for evaluating the uncertainty linked to the analytical process. The proper use of these tools allows for an optimal interpretation of data as long as all other information associated with the environ-mental project is taken into consideration as well. It’s there-fore the responsibility of the project manager leading the environmental study to determine whether the analytical data is representative and consistent with all other findings in regards to potential contamination at a site.

Marc Paquet, M.Sc., is a chemist and Business Development Manager for Maxxam Analytical Services in Québec City. Contact Marc at [email protected]

... continued from pg 37

http://www.CanadianBrownfieldsNetwork.ca


http://www.cleanearthltd.com




Remediation activities are undertaken to improve environmental conditions. That’s obvious. But what “environment” is being considered when deciding how to improve conditions? At a larger scale, it’s becoming apparent that some of the

remediation efforts expected from and undertaken by the environmental industry have adverse impacts beyond the site boundaries. Those impacts are often not well under-stood nor are they always considered when contemplating remedial action.

Clearly, proper remediation of a site results in an improvement in local conditions. But what is happening off site? All remediation activities have some impacts: the installation of in situ remediation systems disrupts the sur-face of the site and may disturb neighbours; operation and maintenance of remediation systems consume electricity, natural gas, propane, maintenance chemicals, etc.; noise or odours affect neighbours during operation of remediation systems; surface disruption, traffic, noise and dust occur during excavation activities; safety and environmental issues arise from hundreds of additional hours of truckers on highways hauling contaminated soil; additional wear and tear takes place on roadways due to thousands of tonnes of soil being trucked back and forth; fuel consumption and associated greenhouse gases rise due to excavator and truck operation; landfills (a non-renewable resource) are loaded with soil; greenfields are stripped back to obtain clean backfill material; and additional costs are incurred by future development on top of backfilled soil.

This is just a partial list of “adverse impacts” that may be realized for active remediation projects. Knowing all this, the question has to be asked — are these efforts sustainable?

If they’re not sustainable — and I feel they often are not — then what can be done to take what we know and build a more sustainable approach to remediation?

We begin by taking a risk management or risk assess-ment approach to the situation, with reduction being a key target. Risk-based approaches may allow you to select measures to reduce the amount of active remediation required and allow you to develop cleanup criteria that real-

istically protect the necessary re-ceptors, but do not force overly conservative actions. Therefore,

by Gary Millard

the amount of work required can be reduced as well as the impacts associated with that work while, at the same time, achieving the remediation goals of protecting human health and the environment. In some instances, site-specific risk assessment can even achieve project closure without having to undertake any active remediation, which avoids those impacts identified above.

It stands to follow that after reducing the amount of effort required to meet that remediation end point, the remaining measures to be undertaken now need to work more efficiently. At this time, this effort requires some innovative thinking. You may be required to excavate a site, but this doesn’t mean you need to haul the soil to the landfill if it can be treated onsite. If you can’t treat it onsite, perhaps offsite treatment is possible so that you can re-use the treated soil as backfill. For in situ work, remediation sys-tems should be designed so that you can modify as many aspects of injection or extraction as possible to always keep the energy directed toward the wells or treatment areas that will yield the greatest results at that time.

Currently, the regulatory models used to assess risks from contamination generally allow for a certain amount of flex-ibility or site-specific modification, which can help remediate a site more efficiently and with less overall environmental impact. However, many stakeholders (e.g., municipal authorities, lending institutions, etc.) aren’t comfortable with the concept of leaving any contamination exceeding generic criteria on-site, regardless of how well managed it may be. It’s easier to take all the contamination away and call the site clean, but we have to accept that the contam-ination has been moved elsewhere and we should be asking ourselves, “At what cost?” The analogy of a splinter in your finger comes to mind. If you have removed the splinter, you’ve been successful. But how you went about remov-ing the splinter (amputating your finger vs. a small incision) makes a big difference!

By educating stakeholders about the difference between active remediation and risk management options and by un-derstanding the long-term benefits of using the reduction and efficiency efforts outlined above, we will begin to move toward a more sustainable approach to environmental remediation.

In short, I look at more widely accepted risk manage-ment as the next layer of the onion; our next step on the path of continuous improvement. We have learned to do active remediation well and have seen some excellent results through these methods. Because of these successes, we are now in a place to ask how current processes can be improved to make these methods even better, to make them sustainable, and to see the results of an even stronger model of environmental remediation.

Gary Millard, P.Geo., is an Environmental Geologist with Shell Canada Products in Calgary, Alberta. Contact Gary at [email protected]

THE TRUE COST OF REMEDIATION

“You may be re

quir ed to excavate a

site, but this doesn’t

mean you need to

haul the soil to the

landfill if it can be

treated onsite.”





The Environmental Risk Information Service (ERIS) is Canada’s best source of historical and current environmental risk information for any property in Canada. Celebrating its 10th year in business, with demand for its products and services increasing year

over year, ERIS is launching two new products and improv-ing product delivery times.

The first new product is called the ERIS Risk Check Report.

“We’ve been listening to many new client groups and who have asked for a basic interpretation of the raw data an ERIS report provides,” states Mark Mattei, ERIS Research and Development Manager. For the first time, clients will re-ceive a report summary along with the data presented in an ERIS report. This is evaluated by a qualified environmental professional with more than 20 years industry experience.

The report indicates whether a specific property is con-sidered a “low” risk or “elevated” risk in terms of environ-mental conditions and/or hazards.

The report is supported by a $5 million errors and omis-sions insurance.

A standard ERIS report (250m search area) is evaluated by a qualified environmental professional along with fire insurance maps, a city directory search and a topographical map in order to ascertain the property’s recorded environ-mental condition and status. The report indicates and com-ments on enforcement actions, infractions, historical uses, known contamination and environmental investigations,

ERIS LAUNCHES NEW SITE REPORT SERVICES

FASTER, BETTER, MORE

by Carol Bell-LeNoury

“ERIS now receives

information from

over 440 data

bases from federal,

provincial and

private sources.”



records and databases that have been publicly registered, as well as an assessment of the overall activities that have taken place on the site.

ERIS has collaborated with Lender Consulting Services Inc. (LCS) to provide the Risk Check Report. LCS, Inc. has been providing this type of report in the United States for the past 20 years.

“Banks, mortgage companies, credit unions, regulators and commercial realtors really appreciate this type of report — especially as a low cost alternative solution to expensive due diligence reports. A property determined to have an elevated risk will indicate whether further investigation — a Phase I or some intrusive (Phase II) environmental study — is recommended to determine the extent of remediation that may be required on a property,” remarks Mark LiPuma, CEO of LCS.

The inclusive report is available for $750 CDN.

BC Site Registry Report

ERIS hasn’t stopped with launching just one new report; it’s also launching the B.C. Site Registry Report. This report will provide clients with a 500m search area providing all information on potentially contaminated sites registered with the site registry, including all detailed reports for each record found within that 500m radius. Information pro-vided includes: general site information (including location, status, file number), all notations (registration date, class, type, etc.), site participants, all documents for each site, all associated sites, suspected land use and parcel descriptions. A search of the site registry is a requirement of a Stage 1 Preliminary Site Investigation (PSI) in British Columbia The cost of the report is $199.

The B.C. Standard Plus Report also remains and searches all 440 databases within 250 metre radius and includes a

search of contaminated sites within a 500 metre radius, including all detail reports. This report is available for only $395.

“Clients from British Columbia have been asking for this report for the past two years says Mattei. “We were able to finally access the data this fall, and can now provide our customers with what they need.”

ERIS now receives information from over 440 data bases from federal, provincial and private sources. The environ-mental history provided in an ERIS report can reduce your risk of liability, potential cleanup and remediation costs.

In addition to the reports, ERIS also provides additional products and services such as fire insurance maps, city direc-tory searches, property title searches, aerial photographs, inspection reports and topographical maps. ERIS reports are delivered within seven business days with rush services ranging from four days to “panic” two-day service on all other reports.

“The ERIS report analysts try to be accommodating and deliver reports before the due date whenever possible,” says Matt Thompson, ERIS Production Manager.

An ERIS site report will now be available with next busi-ness day service, rather than the two-day service previously required.

The new Risk Check Report and B.C. Site Registry Report launched on November 1, 2009. For more informa-tion, please visit the website at www.eris.ca or call Isabel Pereira, Regional Manager or Mark Mattei, Research and Development Manager at 1-866-517-5204.

Carol Bell-LeNoury is General Manager, Environment and Events, for the EcoLog Group in Toronto, Ontario. Contact Carol at [email protected]

For further information about Davis LLP or theEnvironmental Law Group, please contact:

EdmontonRobert A. Seidel, [email protected]

WhitehorseRodney A. [email protected]

VancouverBrian F. [email protected]

TorontoDavid I. [email protected]

MontréalDavid W. [email protected]

Davis/AB/Brownfields 9/17/08 2:04 PM Page 1

Providing award-winning planning, design, and implementation services for redevelopment programs

Environmental Site Assessments

Environmental Planning and Assessment

Brownfield Redevelopment

Brownfield GIS

Communities

transportation

Buildings

infrastruCture

100 Commerce Valley Dr. W., Thornhill, ON L3T 0A1t: 905.882.1100 | f: 905.882.0055

For further information or to contact any of our other offices, please visit our website:

www.mmm.ca


http://www.eris.ca







http://www.mmm.ca


facility-profile

Located just 30 kilometers east of Montreal, the Safety-Kleen Chambly Operations Centre is a multi-functional facility designed to meet the full

range of industrial and hazardous waste and recycled material management needs of the region’s industrial, commercial and institutional (IC&I) sectors.

“If you need a waste stream managed or recycled, we’re the people to call,” says David Flahaut, Safety-Kleen’s Chambly facility manager. “We’ll first evaluate a waste to see if it can be reused or recycled, and we’ll also suggest alternative products for use in future that can be reused or recycled, or that can reduce the impact on the environment if disposal is determined to be the best management method.”

Situated in an industrial park two kilometres south of historic Fort Chambly, the facility was officially opened in April 2007, and is the result of amalgamating three other Safety-Kleen facilities in the Montreal area (Boucherville Branch, St. Constant Recycle Centre and the Beloeil Regional Offices & Machine Refurbishing Centre).

The new facility includes an 1,800-square-metre warehouse, a 750,000-litre-capacity tank farm, a solids processing pit, a full laboratory and offices. The ware-house building is divided: into a fuel blending process-

ing room; a parts-washer solvent return and fill room; a reactive materials storage room; and, a container-ized waste/recyclables storage room. The warehouse was designed with a state-of-the-art fire suppression and ventilation systems, which ensure a safe working environment for company personnel handling flam-mable and toxic materials.

“We’re very careful about making sure that we’re operating not only in conformance with the Operating Permit issued to us by the Quebec Ministry of the Environment, relevant federal, provincial, local laws and regulations, but also in strict compliance with company policies and procedures that ensure the safety of our employees and the local community,” Flahaut says.

Safety-Kleen leased the Chambly facility in 2006, investing more than $3.5 million to renovate the former clothing manufacturing operation and upgrading it to meet Safety-Kleen’s processing and customer service needs in Canada. The operation currently employs 32 people and operates 24 hours a day, five days per week.

MAIN OPERATIONSafety-Kleen’s main process operation at Chambly is the consolidation or “bulking” of containerized flammable

Bulking UpA look at Safety-Kleen’s Chambly Operations Centre

by Frank Wagner

“Waste can

come from any

customer site or

from any one of

Safety-Kleen’s 12

locations across

Canada.”

The Safety-Kleen Chambly Operations Center tank farm where bulk liquids are stored, including oily and antifreeze wastes, as well as lean and rich fuel.


more sophisticated automatic cleaners with heaters and rinse cycles that can accommodate large parts requiring cleaning or degreasing. The company also offers sol-vent and aqueous spray gun cleaners for the automotive refinishing sector.

Once used, the petroleum-based solvents supplied by Safety-Kleen are collected at customer locations and returned to Chambly for storage before being shipped to Safety-Kleen recycling centers in Dolton, Illinois and Linden, New Jersey where they’re recycled into new products.

The collection of bulk used oil and antifreeze is also a core activity at the Chambly facility, where dedicated trucks collect used oil lubricants and used antifreeze for reshipment to recycling operations. Used oil is shipped to the Safety-Kleen used oil facility in Breslau, Ontario, where it’s re-refined into high quality lubricants, while the antifreeze is shipped to a separate recycling facility to produce new antifreeze or ethylene glycol-based products.

Rounding out its complement of waste management services, the Safety-Kleen Chambly Operations Center also manages other hazardous and non-hazardous waste streams for either bulking or temporary storage prior to disposal (when recycling is not feasible).

The collection of waste for reuse or recycling not only provides environmentally sound management, but also helps reduce greenhouse gas (GhG) emissions, accord-ing to Jean Brunet, Chambly Branch general manager for Safety-Kleen.

Based on life-cycle studies that include emissions from transporting the waste oil, Brunet says the volume of used oil and solvent collected and recycled through the Chambly facility results in annual GhG savings of more than 3,300 tonnes of carbon dioxide emissions. Those assessments are supported by analysis conducted by the U.S. EPA, the U.S. Department of Energy, the European Union, EPA and the State of California, Brunet notes. HMM

Frank Wagner is Director of Environmental, Health and Safety for Safety-Kleen Canada Inc. in Breslau, Ontario. Contact Frank at [email protected]

liquid wastes into fuel blends for the cement industry, allowing what would otherwise be waste to be used as fuel and recovering its energy value.

The process involves sampling prequalified waste streams received at the facility, analyzing the samples to confirm the material composition and, based on the lab results, transferring container contents to the appropri-ate storage tanks. The tanks are equipped with mixers to produce a homogenous fuel blend that meets the specifi-cation required by cement kiln clients.

All containers received at the facility are tracked using descriptive labels with bar codes that are applied at the customer/generator locations. When the containers are collected, the Safety-Kleen sales and service representa-tive applies and then scans the label with a hand-held unit, beginning the process of tracking the material through the company’s network.

Upon receipt at Chambly, the receiving operator scans the label with another hand-held unit and logs the container into the facility’s electronic inventory system. The log tracks customer information, dates, manifest and bill of lading information, waste information, stor-age location and eventual processing location. Waste can come from any customer site or from any one of Safety-Kleen’s 12 locations across Canada, which oper-ate transfer facilities and send containers to the Chambly facility. All waste is tracked on the same scanning system, through to Chambly, regardless of origin.

OTHER OPERATIONSSafety-Kleen also processes sludges and solids at Chambly, which are stored, mixed and solidified into solid fuels for energy recovery.

The Chambly Operation Center also serves as Safety-Kleen’s “branch” for Eastern Quebec, providing supplies and services for the company’s solvent- and aqueous-based parts cleaning and degreasing machines, as well as providing solutions to various customers in its area. The company supplies a variety of parts cleaning machines to area businesses, from the basic “sink on a drum” design to

facility-profile

Left: The Chambly lab where all incoming wastes are tested to determine acceptability and the proper waste disposal route.Above: The site and front offices.




waste-management

In February 2010, the commitment to environmental stewardship by Canada’s plant science industry will be highlighted with the launch of CleanFARMS™ Inc.

CleanFARMS™ will step out from under the CropLife Canada umbrella and re-launch its highly successful empty container and obsolete-product management programs as an independent, not-for-profit organization.

The reason for the move is simple: A changing regulatory climate coupled with the public’s desire for industry responsibility requires all industries to address stewardship. For CropLife Canada that means making its well established “secret” public.

But the new direction means even more. Clean-FARMS™ encourage higher recycling rates by bringing in new members and stakeholders that may not cur-rently belong to CropLife Canada. It’ll use this launch to increase participation and improve transparency. By doing so, CleanFARMS™ will also be in a position to manage other stewardship programs, should opportunities arise.

Up to now, the company has operated two separate programs: Empty Container Management and Obsolete Product Management.

On a national basis the empty container management program has collected and recycled over 78 million con-tainers. It boasts a recovery rate of 61 per cent — a rate few other programs have achieved. Still, the organization hopes to see this number jump even higher under its new identity. With commitment by industry, farmers and other stakeholders, it aims for an 80 per cent return rate.

While the program will no longer be run by CropLife Canada, CleanFARMS™ will still share the same core values, including a commitment to safety, innovation, stewardship and sustainability.

PESTICIDE CONTAINERSThe Container Management Program encourages farmers, horticultural operations and golf courses that use commer-

cial pesticides to return all empty commercial pesticide containers less than 23 litres in size. The containers can be taken to any one of more than 1,150 designated sites across Canada. In seven of the nine provinces where the pro-gram operates, those designated locations are dealers. In Manitoba and Alberta, locations are regional management sites operated by local municipalities. CleanFARMS™’ contractors collect the containers and shred them to the appropriate size. The plastic shreds are sent to various cus-tomers who manufacture them into various products, the most common being farm drainage tile. There’s no cost to the farmer or to the collection sites.

The reason for the size limitation of 23 litres is that these types of containers are designed for single use only. Containers over 23 litres are often multi-use containers that are of a different molecular weight than the smaller containers. For the larger containers it’s the responsibility of the manufacturer to manage their return and shred-ding. Once shredded, they must either be safely disposed or be given back to CleanFARMS™ to be safely recycled.

Because of the nature of the material processed, attention to environment, health and safety (EHS) is paramount. Strict EHS procedures must be followed by all contractors and processors. Empty containers are tested for cleanliness. Plastic shreds undergo testing to ensure that no product residue remains that could leach off the recycled material. Even the end product is exten-sively tested to ensure no unsafe levels of pesticides are present. End products are restricted so that only very specific products can be made from the containers.

But, to the user of the pesticide products, the request is simple: rinse, remove, return.Rinse: All containers must be either triple-rinsed or pressure-rinsed before they’re returned. The rinse-water is then simply placed back in the user’s spray tank, thus ensuring all of the products are safely used up, while creating a safer and easier-to-recycle container.Remove: The second step for returning containers is to remove the container caps and the booklets. Booklets are required, by law, to be attached to every container. Removing the booklet before use allows it to be placed in a paper recycling stream (where facilities exist) while elimi-nating a contaminant in the plastic recycling process. Since caps are made of a different material than the container itself, removing the caps also helps boost the recyclability of the container. One of the opportunities CleanFARMS™ will be looking at will be to find the most appropriate end-of-life-management for both caps and booklets.Return: For a list of recycling sites near them, farmers can visit www.cleanfarms.ca

Clean FarmsPesticide container program aims for 80 per cent recycling rate

by Barry Friesen, P.Eng.

“The containers

can be taken to any

one of more than

1,150 designated

sites across

Canada.”

http://www.cleanfarms.ca


THE FUTUREA key challenge that CleanFARMS™ and its members face is that provinces have begun developing regulations that sometimes focus more on process and administra-tion than on actual performance. CleanFARMS™’ con-cern is that with a track record that exceeds that of most regulated programs, additional regulatory burden would be tantamount to “fixing what isn’t broken.”

To address this issue, CleanFARMS™ has asked the Pesticide Management Regulatory Agency to develop national requirements that require every registrant of pesticides to have a container management program. By building on CleanFARMS™ success, government and industry could achieve easy wins for the environment.

CleanFARMS™ will also be looking at other products that could compliment its already successful programs.

In the end, CleanFARMS™ success is shared by all, thanks to vision and leadership of CropLife Canada and its members together with our real stewards of the earth — our farmers and food producers. HMM

Barry Friesen, P.Eng. is General Manager of CleanFARMS™ Inc. Barry can be reached at friesenb@cleanfarms.ca

OBSOLETE-PRODUCT MANAGEMENTThe second program CleanFARMS™ operates is called the Obsolete Product Management Program. Launched in 1998, this program gives farmers a safe way to dispose of obsolete or unwanted products, ensuring no chemicals are released back into the environment.

Since 1998 more than 2.5 million kilograms of unwanted and obsolete product have been disposed of safely. In fact, the program received the Alberta Premier’s Award of Excellence in 2003.

Along with obsolete pesticides, CleanFARMS™ has looked further. This year in Ontario, the organization partnered with other companies to dispose of animal health products and sharps in addition to obsolete pesticides.

waste-management

Insitu Remediation Services

Your Advantageis a Performance Based

Fixed Cost Contractat a Competitive Price

Bioremediation or Chemical Oxidation

• No cost overrun• Considerable cost savings compared

to traditional methods

400 Jones Road, Stoney Creek, ON L8E 5P4Head Office: 905-560-0090 • Fax: 905-560-0099

Email: [email protected] • www.biosoil.com

1471, Lionel-Boulet Boulevard, Suite 32, Varennes, Québec Canada J3X 1P7Tel: 450 652-9990 - 1 800 263-7870 - Fax: 450 [email protected]

FOR MORE THAN TWENTY YEARS

WW

W.S

AN

EXEN

.CO

M

SOLUTION PROVIDER

WATER MAIN REHABILITATION

SITE REMEDIATIONBUILDING DECONTAMINATIONWATER TREATMENTRISK ASSESSMENTPCB DISPOSALHAZARDOUS WASTEMANAGEMENT

Pub-Sanexen4x6 1/26/09 10:47 PM Page 1




http://www.aimgroup.ca

http://www.biosoil.com



emergency-response

So it’s the 20th anniversary of the publication of HazMat Management magazine. My how things have changed in the past two decades. In 1989

the price of a pint of Guinness was three dollars yet my cell phone cost me $3,000 and weighed nearly a kilo. Fax machines were in their infancy, enormous in size and cost upwards of $2,000.

Since then, things have changed and, in most instan-ces, for the better. Although my pint of Guinness has doubled, my cell phone and fax machines now cost a frac-tion of their original price tag; not only are they cheaper, they’re now more utile and readily available to most of the population. (And faxes are being supplanted by email, which is virtually free.)

In the environmental services industry, many things have changed as well. Significant events in our his-tory have certainly influenced the path of emergency response, preparedness and prevention. The stranding and subsequent massive environmental damage associ-ated with the Exxon Valdez is one such example. So too is the release of Methyl Isocyanate gas at Bhopal in India. Both events had horrific consequences and spurned the need for real change.

Communication is one area that has undergone exponential improvements. Clearly the evolution in electronics has dramatically affected the devices avail-able for communication at emergency response scenes. While this includes field portable cellular and satellite phones, of more importance is the advent of hand-held web-based technologies. Twenty years ago if one needed to know more about a chemical we either got the MSDS book out or ‘phoned CANUTEC. Today, all you need to do is use your iPhone to Google a material by name, UN number, CAS number, colour or odour and a plethora of information immediately becomes available.

Respiratory protective equipment has also seen change in its range, use and application, never more so than in Self-Contained Breathing Apparatus (SCBA). Initiatives by organizations such as the National Fire Protection Association (NFPA) in equipment enhancement and the development of an excellent usage benchmark in

by John Hosty

Guinness: The Benchmark of Emergency ResponseTwenty years of changes and equipment evolution

“Soon hand-held,

cost effective

Mass Spectrometry

Gas and Liquid

Chromatography

will be a reality.”

the Canadian Standards Association’s (CSA) Guidelines for the Selection Care and Use of Respirators are two primary reasons. While in some ways the additional enhancements to SCBA mandated by NFPA for fire-fighting applications has increased costs significantly, the manufacturers of this type of equipment have made a major cost reduction by developing and selling “non-NFPA” compliant or “industrial use” units. Today, these can be had for as little as $1,000. At this price point, there should never be a reason for a responder not to have the safety afforded by SCBA readily available. Furthermore, manufacturers have moved to develop even lighter units with longer use durations.

Twenty years ago the marketplace was dominated by heavy, expensive, complex chemical protective cloth-ing that was most often designed to be decontaminated after use and then stored for the next incident. Most people were never comfortable with this approach: You never really knew if the decontamination had been done properly or had been effective. The NFPA’s 1991 and 1992 protective clothing standards gave manufacturers an agreed goal to aim for in terms of what constitutes adequate protection for vapor and liquid protective ensembles. From this we have seen a move to clothing that offers very high levels of protection, is designed to be disposed of at the end of an incident, and is priced at manageable levels. It’s possible to buy a good quality, “industrial” Level A suit for around $1,000 compared to $6,000 for the units used in years gone by.

Air monitoring equipment has become immensely cheaper, more readily available and offers a broad range of hand-held, field portable electronic based units. Twenty years ago, most portable equipment was confined to the detection and measurement of oxygen and combustible gases. Today, with the advances made in electrochemical and other sensors, a wide range of materials can be assessed in real-time. This includes sub-stances such as chlorine, ammonia, hydrogen sulphide. The list is endless and constantly expanding. Recent key developments are of units that include oxygen/LEL/two electrochemical and/or a photo-ionization chan-


and enhance their capabilities. Managed properly, they will not need to re-invent the wheel. The lessons learned in Europe, Australia and North America over the last twenty years will save them many growing pains.

I wish to extend my congratulations to HazMat Management magazine on its 20th anniversary. 1989 was also the year I opened my first training and hazard-ous materials emergency response company. The then named “Hazardous Materials Management” magazine was the publication in which we bought our first advertising space. Many years later, when my partner related this to Guy Crittenden and his erstwhile colleagues, it became apparent that we were their first ad sale! The beginning of a great relationship! HMM

John Hosty is Director, Environmental Preparedness for Environmental Solutions® based in Mississauga, Ontario. Contact John at [email protected]

emergency-response

nel for less than $1,000. While still not here yet, it will only be a matter of time before hand-held, cost effective Mass Spectrometry Gas and Liquid Chromatography is a reality.

It’s both exciting and curious to imagine what the next twenty years will bring. (With any luck I will be living on a large sail-boat down south enjoying my $12 pint of Guiness.) Evolving technologies and research will inevitably have made further headway in terms of educa-tion and safety of emergency response, preparedness and prevention.

There are many developing countries building heavy industry manufacturing bases that have begun to recog-nize the need for effective hazardous materials emergency response and environmental protection. It’s encouraging to see workshops and trade shows such as Lee Baker’s India Industrial Emergency Expo, slated for Hyderabad in March of 2010, developing in areas outside of North America. Clearly, these societies see the need to develop

Visit the Workshop website at www.rpic-ibic.ca for program details and to register.

Special thanks to our Workshop partners:

The 2010 program will feature: • Professional Development training sessions • Over 75 technical presentations • Industry site tours • Poster displays • 48 booth tradeshow • Award and Scholarship presentations

The 2010 Real Property Institute of Canada Federal Contaminated Sites National Workshop is the leading professional development event for environmental professionals involved in the management and remediation of federal contaminated sites.

May 10-13, 2010 • Montreal, Quebec

2010 RPICFederal Contaminated Sites National Workshop



http://www.rpic-ibic.ca


personal-protection

to all of our clients, we have gained significant experience in this area, and as a result, we have increased the safety of their staff and contract workers.”

Currently, Z462’s guidelines and requirements are not mandated by law and, as a result, companies are not legally required to follow them. However, industry across Canada has recognized the value of proactively imple-menting practices that are consistent with Z462. If an electrical incident were to occur, provincial, territorial or federal occupational health and safety jurisdictions may assess whether the company demonstrated due diligence using industry-accepted best practices and the tools avail-able in CSA Z462.

Terry Becker, P.Eng., Senior Management Con sul-tant with ESPS, concentrates his efforts in the area of electrical safety. He led an Alberta Electrical Arc Hazard Committee in 2005-2006 and was appointed as the first Vice-Chair of the CSA Z462 Workplace Electrical Safety Standard Technical Committee in 2006.

“Over 7,000 copies of CSA Z462 have sold as of September 1, 2009,” Becker says, which means that many Canadian companies are listening.

According to Dallas Wilm, Project Manager at Enertia Engineering Ltd., “We have received a large number of inquiries regarding arc flash hazard analysis. It’s hard to determine how many of the companies mak-ing the inquiries have proceeded to act on them. Many options are available; they may have performed the cal-culations internally, hired a consultant to look after the process, or contracted an engineering firm to proceed.”

Minimizing the risk of arc flash through their servi-ces is one way that Enertia Engineering Ltd. and ESPS are increasing the safety of electrical and non-electrical workers in industry. For more information on these com-panies and how their services are making a difference in protecting workers from arc flash, visit their websites at www.enertiaengineering.com and www.esps.ca

Stuart Whitbread, B.Sc., is Principal, Enertia Engineering Ltd. in Sherwood Park, Alberta. Contact Stuart at [email protected]

Electrical workers face risks every day in their job. One of these risks is injury from an electric arc flash. Arc flashes are sudden and highly unstable

energy discharges that often occur due to improper work techniques and abnormal conditions in ener-gized electrical equipment. Enertia Engineering Ltd., with the support of ESPS Electrical Safety Program Solutions INC. (ESPS), has made it their mission to increase the safety of electrical and non-electrical workers. Through ESPS’s Electrical Safety Services Consulting (e.g., Electrical Safety Auditing, Electrical Safety Program development, and Workplace Electrical Safety Training) and Enertia Engineering Ltd.’s engin-eering-based Arc Flash Hazard Analysis and Mitigation services, employers are able to mitigate or minimize the risk of electrical hazard exposure to their workers.

RISKS AND STANDARDSAccording to research conducted by CapSchell, arc flash incidents hospitalize five to seven workers per day in North America. One factor contributing to this high-incident rate is the lack of consistent electrical equipment maintenance practices across the industry. Aging electri-cal systems in workplaces also contribute to an increased probability of arc flash incidents.

To address this risk, the Canadian Standards Asso-ciation released CSA Z462, a standard on “Workplace Electrical Safety,” in December 2008. This standard seeks to minimize the general dangers associated with electrical systems in the workplace, including specific risks such as arc flash. Based on the United States’ electrical standard NFPA 70E, Z462 outlines require-ments for training, safe work procedures, arc flash and shock hazard analysis, use of an Energized Electrical Work Permit, Electrical Specific Personal Protective Equipment (PPE), creating safe work conditions, and individual qualifications that collectively minimize the risk of incident. It also provides a measure for companies to demonstrate due diligence in protecting their workers.

The launch of this Canadian standard was driven by industry in supporting its development with CSA, which also included participation of Provincial Occupational Health and Safety representatives.

“We began performing arc flash analysis for clients before it became a requirement in Canada, and our staff has been actively involved in this type of analysis and reporting since the 2004 edition of the NFPA 70E stan-dard in the United States,” says Darcy Braun, a principal at Enertia Engineering Ltd. “By providing it as an option

by Stuart Whitbread, B.Sc.

Shocking TruthsArc flash hazard analysis and mitigation

“Arc flash incidents

hospitalize five

to seven workers

per day in North

America.”

HaxMat suit to deal with electrical shock scenarios.

http://www.enertiaengineering.com

http://www.esps.ca



John Nicholson

“Consulting remains

the cornerstone

of the Canadian

environmental

industry.”

The launch of HazMat Management magazine in 1989 corresponded with my first full time job as at an environmental consulting firm. In July

1989, I started at Acres International Ltd.At the recent Environmental Compliance Conference

sponsored by of HazMat Management, I met my old boss from Acres. He’s still at Acres basically doing the same job but the company is now called Hatch (having been bought out in 2004).

A LOOK BACKWhen I first started at Acres in 1989, it had already been around since 1924. Founded by Dr. Henry Acres, the company’s growth paralleled the growth in hydroelectric power development in Canada. I was hired in a move to capitalize on the growth in environmental consulting services.

In 1989, the predominant consulting firms in Canada included Gore & Storrie (established in 1919), Proctor & Redfern (founded in 1911), and SNC Lavalin (founded in 1936).

In 1989, the field of environmental consulting was just beginning to take root. Companies that started up the year HazMat was launched include Restoration Environmental Consultants (Ontario), Green Plan Environmental Consultants (Alberta), D&G Enviro-Group (Quebec), and ACM Environmental Corporation (British Columbia).

In 1989, much of the focus of environmental con-sulting was on end-of-pipe solutions. Phase I, II and III environmental site assessments (ESAs) were rising in popularity, driven by developments in the United States and concerns by lenders as was purchasers about the lia-bility of being associated with contaminated properties.

THE EVOLUTIONSince 1989, the story of environmental consulting in Canada has been one of growth and consolidation.

As mentioned, Acres is no longer; acquired by Hatch. Gore & Storrie merged with CH2M-Hill in 1995 and for a short time had an unwieldy name of “CH2M-Hill Gore & Storrie.” Proctor and Redfern was acquired by Earth Tech, which was subsequently acquired by AECON.

Other major consulting firms have also been gobbled up include AGRA (now AMEC), Jacques Whitford (now part of Stantec), and MacViro (acquired by GENIVAR).

Although acquisitions and mergers of large Canadian

The Evolution of ConsultingWhere it’s been and where it’s going

John Nicholson, M.Sc., P.Eng.

environmental firms makes headlines, the fact remains that over 90 per cent of environmental service firms in Canada are considered small and medium-sized enter-prises (i.e., less than 100 employees). If anything, mergers and acquisitions of large Canadian firms has succeeded in creating a playing field where clients can be served by large firms with multi-national presence or small spe-cialty firms, with little in-between.

Based on 2004 data provided by Statistics Canada, there were 8,500 environmental firms in Canada. Ontario remains the leader in terms of concentration of firms, with 43 per cent of firms calling having their headquar-ters in the Trillium province. The western provinces are second with 33 per cent. Consulting remains the corner-stone of the Canadian environmental industry.

Although end-of-pipe solutions and ESAs are still part of the solution package offered by environmental firms, the new buzzwords that sell services include “eco footprint” and “sustainable business practices.”

WHERE IT’S GOINGWith the investors, governments, and the public inter-ested in clean tech and renewed interest in infrastructure, the future for professionals in the environmental sector appears bright.

As Charles Darwin taught us, external forces can have a profound effect on evolution. In the case of the Canadian environmental sector, those forces include the maturation of domestic market and the need for new methods and technologies to address increasing complex problems.

One place the environmental sector needs to be in the future is somewhere else other than Canada. Export of environmental goods and services will be a driver for growth. Although federal stimulus spending and a renewed emphasis on infrastructure, including water and sewage, the real money is in securing work outside of Canada’s borders.

The United States remains the favourite export des-tination. However, with the trade protectionist fervor in the U.S. exhibited by the “buy America” provisions in various stimulus packages, Canadian companies are look-ing elsewhere for opportunities. HMM

John Nicholson, M.Sc., P.Eng. is based in Toronto, Ontario. Contact John at [email protected]

environmental-business




hazmat-products

Sullair compressorsSullair Corporation is pleased to announce the redesign of its 200 HP compressors that combine the inherent reliability of Sullair’s single-stage rotary screw air end with today’s most innovative technology. These versatile compressors are offered with a choice of constant speed drive models, LS-200S, or constant speed drive with variable capacity control, VCC-200S and VCC-250S. These 200 HP compressors have capacities ranging from 457 to 980 acfm, and pressure ranges of 100 to 175 psig. The Variable Speed Drive (VSD) model V-200S, with capacities of 576 to 967 acfm, completes the compressor offering. These compres-

sors have flange-mounted motors and air ends to provide posi-tive alignment and extend bearing life in both.

Variable Capacity Control, achieved with Sullair’s spiral valve technology, allows the compressor to match pressure and capacity with system demand. Part load capacity and efficiency can produce energy savings up to 17-30 percent. Providing the highest power factor over the entire frequency range, the V-200S compressor with a Variable Speed Drive (VSD) achieves further part load and full load energy savings.

These Sullair compressors are available with or without sound attenuating enclosures and with a choice of water-cooled or air-cooled models. Designed to meet modern industry’s most stringent requirements for performance and reliability, all models feature Sullair’s Multi-Stage Air Fluid Separation with a dual nested Optimizer(tm) separator element to minimize fluid carry-over. The Optimalair(tm) heavy-duty air intake filter provides the finest inlet filtration in the industry while reducing pressure drop for additional energy savings throughout its operating life. The Sullair compressors also feature the most advanced upgrade of Sullair’s Supervisor(tm) Controller. This computer-compatible microprocessor control unit provides critical operating informa-tion using simple graphics of monitored functions and easy-to-use stop/start, sequencing and activation controls.Visit www.sullair.com

tharris_half_pg.pdf 1tharris_half_pg.pdf 1 2/16/07 9:24:30 AM2/16/07 9:24:30 AM

http://www.sullair.com

http://www.tharris.ca



hazmat-products

Temperature & humidity loggerTandD Corporation has introduced its NEW TR-77Ui Data Logger. This versatile unit features a wide range from 0 to 99% Relative Humidity along with an expanded Temperature range from -30° to +80°C. This compact, lightweight unit is approximately 2 x 3 inches and operates on one AA battery. The Relative Humidity accuracy is ±2.5%, uncalibrated. and pro-vides a fast response of 20s Humidity Time Constant. The sturdy Probe has a one-metre cable which can be increased up to 10 metres from the Logger with optional extensions. The TR-77Ui has a large data capacity which can store up to 8,000 readings times two channels for a total of 16,000 readings in One-Time or Endless recording mode. Simply by con-necting to a computer via a USB port, the recorded data can be quickly downloaded with the easy-to-use software. The TR-77Ui also features an IrDA Port for Wireless Downloading of data. A unique feature is the Built-In Adjustment Function which allows the user to enter calibration factors directly into the Logger eliminating the need to adjust readings after they are downloaded.Visit www.tandd.com

Demolition Association online safety trainingThe newly revamped National Demolition Association website www.demolitionassociation.com now offers a full arsenal of online safety training and certification courses that allow for in-house training, orientation, and personnel management. The members-only feature provides more than 7,000 training courses on topics that range from fall protection and excavator safety training to Microsoft Excel and safe driving. The courses are designed to improve safety, compliance, and risk management initiatives by providing OSHA standardized content, which is validated by industry experts. The interactive courses include instant grading and online certificates, as well. Members can pay just once for each course, but can view the course as many times as they want for up to one year. Upcoming, the National Demolition Association is developing a demolition-specific safety training course that will be web-based and available on the newly upgraded website.Visit www.demolitionassociation.com

Multipurpose borescope snakes anywhereSpectronics Corporation has recently intro-duced the CB-400 COBRA-4(tm), part of the COBRA(tm) series of multi-purpose borescopes. The scope features a dual-head blue and white light LED flashlight that enables technicians to inspect and leak check hard-to-see compon-ents without expensive disassembly. The blue-light LED is ideal for fluorescent leak detection, while the white-light LED is great for compon-ent inspection. A press-fit coupler allows quick and easy attachment of the flashlight to the borescope. The COBRA-4(tm) has a super-thin

4mm, 36” shaft to get into crammed areas.Included with the scope is a clip-on, angled

inspection mirror, which provides the added capability to detect flaws normally hidden from view. Three “AAA” alkaline batteries (included) power the flashlight. Fluorescence-enhancing glasses, for use with the blue light flashlight and fluorescent leak detection dyes, are also included. Dyes are sold separately. All com-ponents are packed in a sturdy plastic carrying case with a foam insert.Visit www.spectroline.com


http://www.tandd.com



http://www.spectroline.com


hazmat-products

Protect operators from fumes & particlesThe Purair 20 Ductless Fume Hood has been designed to provide oper-ator protection when using hazardous substances. A face velocity at 100 fpm ensures containment of fumes and an alarm will alert the oper-ator when the airflow falls to an unacceptable level. All mechanisms in the head section of the Purair 20 are on the clean side of the filter, thus preventing contamination. Switches and electrical components are totally isolated from the dirty airflow and away from any contamina-tion. The work area has a removable spillage tray which can be easily cleaned. Optional integral lighting is available.

The Purair 20 is 49” wide by 27.5” deep by 47.5” high. Other sizes are available up to 96” wide. The main filter can be chosen from 14 different types of carbon, which include specialty media for vapors of organics, solvents, acids, mercury and formaldehyde. HEPA filters for particulate filtration are also available to suit the application needs. In addition, the Purair can be equipped with a secondary back-up filter for added pro-tection. This filter is required by US standard ANSI Z9.5 section 4.12 4.2.Visit www.air-science.com

Real-time online X-Ray product testingEriez®, an authority in magnetic, vibra-tory and inspection applications, now offers a way for customers to view the performance of an Eriez X-Ray machine live online. This eliminates the need for an onsite facility visit, saving time and money.

Customers will “virtually” attend the material test in real time with Eriez’ inter-active online X-Ray testing via a pass-word-protected website. Participants will see their products passing through an Tec® X-Ray Inspection System to determine its performance for foreign object detection, mass, fill level or mis-

sing items. Multiple viewers can watch from different locations and ask ques-tions live to Eriez’ test personnel.

“We receive products sent from all over the world, along with contamin-ants the customers want tested,” says Ray Spurgeon, Eriez Product Manager, Inspection Systems. “The online testing precludes the need for our prospects to be physically present at our facility to see actual tests. The resolution on the computer screen as we conduct the live testing has the same clarity as if you were actually at the Eriez testing facility.”Visit www.eriez.com

Upgraded orange peel grappleBuiltrite has announced several key changes to its four-tine Orange Peel Grapple line-up. These changes are being implemented to improve overall performance and durabil-ity. These changes include that the upper head and connecting link have been re-designed, allowing the hoses to be re-routed to come over the top of the material handler jib, allowing for a cleaner hose joint and less likelihood of hoses becoming torn off in scrap handling applications. Bolt-on cylinder cov-ers are now standard on all models, 1/2 yard and larger. The covers and bolt-heads are recessed to prevent them from getting caught on materials. Bolt-on access plates on the

sides of the tines to prevent materials from entering, yet allowing easy access for servi-cing when required. High torque, heavy duty rotation motors do not require a case drain line. Internal tooth, rotation bearing allows motor to be mounted inside the rotation head to ensure maximum protection. 1 yard and larger models use dual rotation motors. All grapples still come with AR 500, abrasion resistant steel on the tine tips, use hardened and oversized pins and bushings, the tines employ a boxed design for maximum strength and finally, all come with a magnet hook in the bottom center of the grapple.Visit www.builtritehandlers.com

http://www.air-science.com

http://www.eriez.com

http://www.builtritehandlers.com


news

ONTARIO TOXICS REGULATION TAKES EFFECTAccording to the Ontario Waste Management Association (OWMA) beginning Janu ary 1, 2010, regulated facilities will be required to track, report and develop plans to reduce the toxic substances they use, create and release. This applies only to facilities currently reporting on emissions to the National Pollutant Release Inventory (NPRI).

These toxics reduction plans will be available to the public as part of the gov ernment’s commitment to inform Ontarians about toxics. The implementation of the plans will be voluntary.

Ontario has also committed funding to help facilities meet the requirements of the Toxics Reduction Act. The government will hold provincewide information sessions early next year to explain the new requirements, will provide information guides to help facilities meet the requirements and will consult on an enhanced toxics reduction

planning process that builds on the expertise and experience found in the workplace.

The regulation under Ontario’s Toxics Reduction Act, 2009 sets out the requirements that owners and operators of facilities covered by the act must meet beginning January 1, 2010 to:

• Track and quantify the toxic substances they use, create and release

• Develop plans, including options to reduce their use of toxic substances

• Make summaries of their plans available to the public

• Report to the ministry on their progress in reducing toxic substances and make certain information available to the public.

The regulation adds a new approach to environmental protection by focusing on reducing the use and creation of toxic substances at the front end of industrial processes. The Act applies to facilities in the manufacturing and mineral processing sectors (excluding physical extraction, crushing or grinding)

that are required to report to the National Pollutant Release Inventory (NPRI) and to the ministry under O.Reg. 127/01 for acetone.A copy of the Regulation is available on the OWMA website under “Members Only” at www.owma.org

INDUSTRY SURVEY SHOWS CHEMICAL SAVINGSProving that less really can be more, Chemical Management Services (CMS) providers saw over 30 per cent revenue growth per year from 20062008 by helping their customers significantly reduce their chemical use, waste, and emissions. According to the CMS Industry Report 2009, the third in a series, the CMS industry not only reported revenue growth, but projections indicate the global market will more than triple in the next five to 10 years. The estimated current market in the NAFTA region is approximately $1 to $1.2 billion.

“The CMS approach is in line with the trend towards a more servicebased economy in the US,” says Jill Kauffman Johnson, Executive Director of the nonprofit Chemical Strategies Partnership. “Under the CMS concept, chemical suppliers are no longer generating profit from selling more chemicals, but rather by providing high value services. CMS providers partner with customers to manage their entire chemical lifecycle and create savings by leveraging purchases, improving inventory management, reducing chemical use and waste, and enhancing IT infrastructure.”

“One key aspect of a CMS provider’s successful value proposition and longevity is devoting strategic leadership and focusing resources to drive cost out of the customer’s chemical supply chain, evolving from moving transactions to moving markets through the power of aggregated leverage,” says Scott Little, Global Commodity Manager for United Technologies Corporation.

According to the report survey data, customers have realized hard savings as high as 4050 per cent in the first year of their CMS program, and continue to see savings five to ten years into their program. The customers surveyed for the report represent diverse industries and companies. In the last five years, customer adoption of the CMS model has expanded from five to nine global regions, with the greatest international activity in Western Europe, Mexico, Canada and China. Support is growing among government agencies, including the US EPA as well as agencies in Korea and the United Kingdom.The 2009 Chemical Management Services Industry Report can be accessed at www.chem-icalstrategies.org/IR09press.htm

Alex MacWilliam403 268 7090

[email protected] www.fmc-law.com

FrAser Milner CAsgrAin llP BAnkers Court 15th Floor 850-2nd street sW CAlgAry AB t2P 0r8

735_FMC_AlexMacW_Ad_Sep09.indd 1 9/17/09 3:48:09 PM

For more information, contact: James AyresCertified by the Law Society of Upper Canada as a Specialist in Municipal and Environmental Law

416 869 5967 or [email protected]

Leaders in Municipal, Planning & Environmental Law

www.casselsbrock.com

CASSELS BROCK/MC7575/HMM.indd 1 1/22/09 11:30:21 AM

Kilmer Brownfield Equity Fund L.P.Canada’s leading fund dedicated to the redevelopment of brownfields

Putting Private Equity to Work

The Kilmer Brownfield Equity Fund is dedicated to creating value for stakeholders through the clean-up and revitalization of brownfield properties in Canada.

If you have a property for sale, please contactPamela Kraft, Development Manager at 416-814-3437

[email protected]

www.kilmergroup.com/brownfield

HMMsept08gm1307 Kilmer.qxd 9/12/08 4:27 PM Page 1


http://www.owma.org

http://www.chemicalstrategies.org/IR09press.htm


http://www.fmc-law.com



http://www.kilmergroup.com/brownfield

http://www.casselsbrock.com

WINTER 2010

ADVERTISER....................................................................... PG.#

AGRU.America................................................................. 2

AIM.Environmental....................................................... 45

Canadian.Brownfields.Network................................... 37

Canadian.Standards.Assoc.......................................... 10

Cassels.Brock.LLP.......................................................... 57

Clean.Earth.Solutions.Ltd............................................. 37

Davis.&.Company......................................................... 40

Federation.of.Canadian.Municipalities....................... 15

Fraser.Milner.Casgrain,.LLP......................................... 57

Hamilton.City.of............................................................. 58

T.Harris.Environmental................................................. 49

ADVERTISER....................................................................... PG.#

Intrinsik............................................................................ 11

Kilmer.Brownfield.Equity.Fund................................... 57

MMM.Group.................................................................. 40

Pinchin.Environmental.Ltd........................................... 17

Proeco............................................................................. 55

Quantum.Murray........................................................... 41

Real.Property.Institute.of.Canada............................... 47

Restoration.Environmental.Contractors..................... 56

Sanexen.......................................................................... 45

Team.Hazco.Services.Inc................................................ 5

TIGG................................................................................ 58

XCG.Consultants........................................................... 17

advertiser index


Total solutions for the removal of trace contaminants from air and water

Specializing in:• VOC removal

• Metals removal

• Emissions from coal tar sites

• PCB contact water

• Particulate filtration

• Tank and process vents

• Styrene emissions

TIGG has the, media, equipment and exchange services to provide you with a complete air or water treatment system on a sale or rental basis.

TIGG Corporation • 1 Willow Avenue • Oakdale, PA 15071800.925.0011 • www.tigg.com

Brownfield Redevelopment

Hamilton’s Brownfield Redevelopment Program has proven results.

Contact us to learn more.

Brian MorrisBusiness Development Consultant, City of Hamilton

tel: 905.546.2424 ext. 5602e-mail: [email protected]

investinhamilton.ca

Lands ofOpportunity

HAMILTON final.indd 1 4/30/09 1:33:39 PM

http://www.tigg.com



http://www.investinhamilton.ca

Congrats to HazMat Management on its 20th anni-versary! I haven’t missed a single edition writing this column since I the magazine was launched in

1989. Here’s a quick look at what’s better, what’s worse, and what hasn’t really changed in all those years.

La plus ça change, la plus c’est la même chose. Despite some exciting swings and roundabouts along the way, there’s much about 2009 that isn’t much different from 1989. In 1989 and the early 1990s, environmental ministries and environmental regulation were on an upswing of popularity and importance, and definitely feeling their oats. Disasters such as the tire fire in Hagersville and the PCB fire in St. Basil-le-Grand fuelled public demands for more and better command, control and enforcement. George Crowe was the first Canadian to go to jail for an environmental offence, and the successful prosecution of Bata Shoes and its direc-tors sent shock waves through corporate Canada.

The backlash came in the mid 1990s, when deficit fighting became the order of the day. Environmental ministries lost their momentum and up to half of their staff and budgets. Command and control regulation fell out of favour; surely “voluntary compliance” could do the job, now that government no longer had a monopoly on environmental expertise!

Even further cuts were threatened, when salvation came to Canadian environmental regulators from a tiny part of their mandates: drinking water tragedies in Walkerton and North Battleford. In the political firestorm that followed, environmental ministries were rebuilt and statutes and regulations multiplied.

We do have clear improvements in terms of environ-mental management. Canada now has a wealth of skilled and knowledgeable environmental professionals, both within and outside government. Most significant Canadian organizations now know quite a bit about their environmental impacts and how to manage them. Most make some effort to find out whether they are in compli-ance, and to achieve it. Some have documented environ-mental management systems, and strive for continuous improvement. The federal and provincial environmental commissioners help to keep governments honest and at least partially attentive to environmental values.

The process of decision-making is better. Public know-ledge about environmental rights, emissions and deci-sion-making is at an all time high, thanks to Freedom of Information laws, the Internet, and environmental regis-tries. Public consultation and participation has improved. Multi-stakeholder groups have become a common, and effective way for non-governmental organizations to negotiate directly with businesses, sometimes with excel-lent results. The courts have become more sophisticated about environmental issues, and more interested in them; no longer do judges groan out loud about “the frogs and


legal-perspective

Twenty Years of HazMat Managementby Dianne Saxe, D.Jur.

logs brigade.”Technology and the environmental industry have

improved, though we are not the world leaders we might have been. Aboriginal issues play a large and increasing role.

For most businesses, federal and international en -viron mental requirements are more meaningful than they were in 1989. The provinces have been churning out new environmental laws at a furious pace and muni-cipal governments are also taking a stronger role.

Regulations are a little more flexible than they used to be. Today, we use more market instruments such as emissions trading. Administrative penalties are quicker and surer than prosecution in responding to spills. The mere embarrassment of being named a “top pol-luter” under NPRI has provoked some companies to take action. Governments show more awareness of their limits by drawing on “voluntary” codes (such as CSA documents) when regulating highly technical areas.

In terms of environmental quality, progress has been decidedly mixed. Drinking water is protected more much aggressively than in 1989, though this did not have much effect on the actual quality of drinking water in most municipal systems.

Surface water is a little cleaner than it used to be. Municipal sewage treatment is improving, although less so on our coasts. Pulp and paper effluent regulations have reduced the filth flowing from paper plants. The Great Lakes are cleaner than they were a generation ago, though they now face major threats from invasive foreign species and climate change. Groundwater is starting to receive some long-overdue attention and protection, although the major result may be to push municipalities to surface water sources.

In terms of air, sulphur dioxide emissions are down, but nitous oxides aren’t. Benzene levels and mercury emissions have been slashed; but ground-level ozone is about the same. U.S.-driven auto emission laws have cut per-vehicle emissions by more than 75 per cent since 1971, but smog is about the same: we now buy more and bigger cars and drive them farther. Greenhouse gas emis-sions are up substantially.

Hazardous waste is better managed, but we make more waste than ever. We have created new parks, but more Crown land has been logged, settled or otherwise disturbed.

It’s worth noting that most of the successes of the last 20 years have been driven by good old-fashioned command and control regulation, backed up by vigorous enforcement. Let’s pay attention to what works, and do more of it in the next 20 years!. HMM

Dianne Saxe, Ph.D. in Law, is one of Canada’s leading en vironmental lawyers with her own practice in Toronto. Contact Dianne at [email protected]

“Most of the

successes of the

last 20 years have

been driven by

good old-fashioned

command and control

regulation.”



RESPONSIBLE SUBSTAINABLE SOLUTIONS FOR

PCB Time Has Run Out!Effective September 5, 2008, new federal PCB regulations oblige companiesto remove, dispose and destroy PCBs as early as December 2009!

We opened Canada's first fully licensed private sector PCB waste management facility in 1989. Field PCB services include: spill sampling, clean-up planning,collection, packaging, transportation, non destructiveremoval of PCB from cement and associated services; in addition, we have had the experience of cleaning up after five fires involving PCB electrical equipment.

WasteManagement

www.proeco.com1-800-661-5792

Proeco/AB/ 2/26/09 9:30 AM Page 1

http://www.proeco.com

DISASTER RECOVERYDISASTER RECOVERY

REC DISASTER RECOVERY CONTRACTORS EMERGENCY RESPONSE 1-800-894-4924 REC DISASTER RECOVERY CONTRACTORSEMERGENCY RESPONSE 1-800-894-4924

DISASTER RECOVERYDISASTER RECOVERY

08041-REC-HAZMAT MAG ad.indd 1 12/3/08 11:30:44 AM

http://www.recdisaster.com

http://www.environmentalhazards.com

http://www.recdemolition.com


http://www.thepassioncampaign.ca

http://www.thepassioncampaign.ca

HazMat Management Winter 2010

Documents

Transcript of HazMat Management Winter 2010