Cool BaRC Web Tools Prat Thiru. BaRC Web Tools We have.

21
Cool BaRC Web Tools Prat Thiru

Transcript of Cool BaRC Web Tools Prat Thiru. BaRC Web Tools We have.

Page 1: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

Cool BaRC Web Tools

Prat Thiru

Page 2: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

BaRC Web Toolshttp://iona.wi.mit.edu/bio/tools/bioc_tools.html

We have tools for:

•General Analysis and File Utilities•Genomics•EntrezGene/RefSeq/UniGene/SGD/GenBank annotation•Homology (Orthology)•Converting IDs between databases•Functional Analysis•Visualization

Page 3: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

General Analysis and File Utilities

Venn Diagram Generator

•Show the number of items shared and unique between two sets

http://jura.wi.mit.edu/bioc/tools/venn.html

Page 4: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

General Analysis and File Utilities

Compare Two Lists

•Find what is common and unique between two lists

NM_126167 NM_126167NM_126168 NM_322122XM_322082 NR_210999XM_322084 NR_001321NM_126168

http://iona.wi.mit.edu/bell/compare.html

Page 5: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

General Analysis and File Utilities

Redundant List Analysis

•Count the number of occurrences in a list

NM_126167 NM_126168 XM_322082 XM_322084 NR_001321NM_126168

http://iona/cedrone/redundant/

Page 6: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

General Analysis and File Utilities

Submatrix Selector

•Select specific rows and columns in a file

http://iona.wi.mit.edu/bell/submatrix_selector/

Page 7: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

Genomics

Genomic Sequence Extractor

•Retrieve sequence up/down stream for a list of genomic location(s)

http://iona.wi.mit.edu/bell/extract_custom.html

Page 8: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

Genomics

RefSeq Regulatory Extractor

•Retrieve regions around transcription start or end site

http://iona.wi.mit.edu/bell/refseq_extractor.html

Page 9: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

Genomics

Merge Overlapping Genome Regions

•Collapse overlapping regions into a single region

http://iona.wi.mit.edu/bell/merge_regions/merge_regions.html

Page 10: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

EntrezGene/RefSeq/UniGene/SGD/GenBank annotation

Entrez Gene IDs info

•Get information for a list of Entrez Gene IDs

http://iona.wi.mit.edu/walker/webtools/locuslink-db-0.html

Page 11: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

EntrezGene/RefSeq/UniGene/SGD/GenBank annotation

Extract UTRs and/or CDS regions from GenBank sequences

•Retrieve UTRs/CDS from GenBank flat file

http://iona.wi.mit.edu/bell/utrs/

Page 12: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

Homology (Orthology)

•Find orthologous Ensembl IDs

http://iona.wi.mit.edu/bell/homology/ensembl.htmlhttp://iona.wi.mit.edu/bell/comparative/

Page 13: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

Converting IDs between Databases

Entrez Gene IDs Ensembl IDs

•Convert gene ids from Entrez to Ensembl

http://iona.wi.mit.edu/bell/locuslink-db-7.html

Page 14: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

Functional AnalysisMap Genes to Pathways

http://iona.wi.mit.edu/yuan/gene2pathway/

•Determine which pathway genes might be involved from different databases.

Page 15: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

Functional AnalysisIdentify over-represented GO terms in a gene set

http://iona.wi.mit.edu/yuan/go_anno/

•Find out which GO categories are over-represented in the GO terms

Page 16: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

Functional AnalysisWalk up GO ontologies to get more general "induced" terms

http://iona.wi.mit.edu/bell/go/

•Find more general GO terms

Page 17: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

Functional AnalysisTabulate the number of codons in sequence data

http://iona.wi.mit.edu/gurdziel/CodonCounter/CodonCounter.html

•Determine codon usage in a sequence

Page 18: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

VisualizationProtein Sequence Visualization Tool

http://iona.wi.mit.edu/cgi-bin/walker/draw_enrichment.pl

•Color codes amino acids

Page 19: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

Visualization

Sequence Word Viewer

http://iona.wi.mit.edu/rodriguez/wordview/

•Display occurrences of a motif

Seq 55MTKVYANSIQQHLCLDSLTGPVRSVLTQGTTAEKERVVDRIALLERCLDPSNSLPPVRSVLTQGTTAEKVQLVVSCLGVVCSIICLALGIAAAAVTAKRLVAVAVATILAVALLVVAGLLFSGVLCSPVSVLAASLFFGVGAFLLGGALVGGVLTTEAVTRERLHRSQTLMWNNLCCKTAEVEQKISTASANAKSNDKTRKLGE

Seq 200MECVKQLCRNHLCLDSLTGPVRSVLTQGTTAEKVQLVVSCLGVVCSIICLALGIAAAAVGVSCSGFAIGLGVIAILLGIVLFAISALDVLEDHGLVGAASLFFGVGAFLLGGALVGGCPFKLPCKSSPANEPTVQFFKGKNGSADKVILVTQ

Page 20: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

TargetScan

http://www.targetscan.org/

•Find predicted targets of miRNA

Page 21: Cool BaRC Web Tools Prat Thiru. BaRC Web Tools   We have.

Need a tool?

Let us know!

[email protected]