City of Kamloops Winter Activity Guide
-
Upload
kamloopsthisweek -
Category
Documents
-
view
232 -
download
8
description
Transcript of City of Kamloops Winter Activity Guide
![Page 1: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/1.jpg)
WINTERACTIVITY GUIDE 2015
Kamloops Parks, Recreation & Cultural Services
AQUATICS REGISTRATION DECEMBER 9th AT 7:30 AM
GENERAL REGISTRATION DECEMBER 10th AT 7:30 AMCanada’s Tournament Capital
![Page 2: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/2.jpg)
• Check out your local library• Cuddle up with a good book• Write a letter to a friend, grandparent, or cousin
• Play a board game with your family
• Go hiking, toboganning, or for a walk
• Play a new card game• Help make supper or bake cookies
• Make a craft, play with clay, or paint a picture
• Read a newspaper or a magazine
Family Literacy WeekJanuary 20-27, 2014
presents
Thanks to our Partners
• City of Kamloops• PacificSport• School District No. 73• Kamloops Honda
• Boys & Girls Club of Kamloops• KELLI• Make Children First• TNRD Library System
Find a h
ealth
y balan
ce... Find a healthy balance... Find a healthy balance... Find a healthy balance... Find a healthy b
alance... Find a healthy balance... Fin
d a
health
y b
ala
nce
... Fin
d a
health
y b
ala
nce
... Find a healthy balance... Find a healthy balance...
Find a healthy balance... Find a healthy balance... Find a healthy b
al
ance
...
Fin
d a
hea
lthy balance...
January 3-31Heap the Honda-Children’s Book Drive
Bring a Children’s Book to the Blazers Game-Jan 17
Wednesday, January 28Play Again Documentary at
Paramount Theatre 7pm
Tuesday, January 27Celebrate National Family Literacy Day
Drop Everything and Read D.E.A.R.
Saturday, January 317th Annual ABC Family Literacy Day
Henry Grube Education Centre 9:00am - 12:30pm
Get Unplugged TodayBuild a Snowman / Enjoy a good book / Paint a picture / Bake cookies / Write a letter
Play a board game / Go tobogganing / Read a magazine / Check out the museum
January 24-31, 2015
Find a healthy balance
Full Event Details:www.literacyinkamloops.com
![Page 3: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/3.jpg)
1kamloops.ca/recreation 250.828.3500 1kamloops.ca/recreation 250.828.3500
Table of ConTenTsservices & InformationHow to Register 2Useful Contact Information 3Tournament Capital Centre 4
Community ResourcesAffordable Recreation 6Community Associations 7Community Committees 8Grants and Resources 9
ProgramsAccessible Recreation 10Aquatics 12 •SwimLessons 14 •Lifeguard&Swim
Instructor Training 17Family 20Early Years 24Children 28Youth 32Parks&TotLots 34Adult 36Schedules*Pull out section 45Adult 55+ 55PacificSport 60
There are many wonderful health benefits to being WinterActive.Spending timeoutdoors in thewinter sunand thecold&crispairis so beneficial to our body, spirit and overallwell being.Outdooractivitiesgivepeopleawonderfulsenseofconnectiontotheoutdoorenvironment.Thebenefitsofnaturallightandfreshairservetonotonly improve physical health, but also enhances our spiritual andemotionalhealth.Thereisaninnateconnectiontotheenvironmentthat begins to occur when the body is exposed to the elements Being outdoorsinthewinterissimplyinvigoratingandrevitalizing.
According toLauraineMyers, research indicateskey facts tobeingoutdoors in the winter:
Outdooractivitiesarede-stressingandcontributestoan overallhealthywellbeing.
Balances hormones and promotes weight loss
Raises metabolism to compensate for your body adjusting to temperature
Anexcellentwaytostrengthenyourheartyearround,as well as increase respiratory response
Exposuretonaturalareasincreasespositiveemotionswhile negativeemotionsdecrease-eventhosewinterblahs.
*adaptedfromTheExaminer,LauraineMyers.
Thewinteractivityguide featuresmany indoorprograms,butalsoincludesseveralideasonunpluggingandplayingoutside.Checkoutpages30-31foralistofparksandtotlotsinyourcommunity.
Get outside, be active, and be healthy!
This guide is published by
Be kind to our communityPlease recycle this guide!
WinteraCTIve
![Page 4: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/4.jpg)
neW start Time
2
We heard you... Basedonyourvaluedfeedbackwemadeimprovementstoserveyoubetter:
Places to registerTournament Capital Centre910 McGill RoadMontoFri: 5:30am-10:30pmSat&Sun: 6:30am-9:00pm
Interior savings Centre300 Lorne StreetMontoFri: 8:30am-12:00pm 1:00-4:30pm
Kamloops Museum & archives207 Seymour StreetTuetoSat: 9:30am-4:30pm
Westsyde Pool & Community Centre859 Bebek RoadMon/Wed/Fri: 12:00-7:30pmTue&Thur: 3:00-7:00pm
Registration TipsA registration account is required to register for our programs New accounts should be created prior toregistrationday.Call828-3500orvisitoneofour‘PlacestoRegister’ listed to the left
A‘FamilyPIN’and‘ClientNumber’ is required to register online.Visitkamloops.ca/ezregtouse‘ForgotClientorPIN’servicepriortoregistrationday.
Keepusup-to-datewithyourcurrent contact information so wecanadviseyouofimportantprogram changes or updates
Refund/Withdrawal Policy•A$10administrationfeewillbechargedforallprogramwithdrawals,excluding memberships Check each programforspecificrefundpolicies.
•Onceaprogrambegins,apro-ratedrefund minus the administration fee will be applied
Cancellations•Programsmaybecanceledifnotenoughpeopleareregistered,sopleaseregisterearlytoavoiddisappointment!
•Mostprogramsareplannedtorunregardlessoftheweather;however,occasionallywemayhavetocancela program due to poor weather If yourprogramiscanceled,youareissued a refund
aquatics Registration beginsDeCeMbeR 9, 2014
at 7:30 am
General Registration beginsDeCeMbeR 10, 2014
at 7:30 am
HoW To ReGIsTeR...
3 Ways To ReGIsTeR
by PhoneCall our Customer Relations
Representativesat250-828-3500
In PersonVisit any of the
locationslistedabove.
onlineVisit our ezReg website at
kamloops.ca/ezreg
services & information
*7:30 start time applies to registrations made online, by phone and in person at TCC.
NEW7:30amregistrationstarttime Upgraded registration computer system Enhanced online registration (EZ Reg) Additional TeleReg support on registration day
![Page 5: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/5.jpg)
3kamloops.ca/recreation 250.828.3500
Program RegistrationOnline kamloops.ca/ezregTelephone 250 828 3500
administrationFacility Bookings 250 828 3600General Inquiry 250 828 3400Adopt-a-Road 250 828 3400
aquaticsOnline kamloops.ca/swimEmail swim@kamloops caCanada Games Aquatic Centre 250 828 3655 Fax: 250 828 3643WestsydePool&CommunityCentre 250 828 3616
Interior savings Centre & arenasOnline kamloops.ca/arenasEmail skate@kamloops caArena Bookings 250 828 3335Blazer’sBoxOffice 250 828 3339Ticketmaster(ConcertSales) 1 855 985 5000
Kamloops Museum & archivesOnline kamloops.ca/museumEmail museum@kamloops caPhone 250 828 3576
PacificSport Interior BCOnline pacificsportinteriorbc.comEmail [email protected] 250 828 3344OperationRedNose 250 320 0650
ParksOnline kamloops.ca/parksEmail parks@kamloops caPhone 250 828 3551
Recreation, fitness, arts & Cultural ProgramsOnline kamloops.ca/recreationEmail recreation@kamloops ca [email protected] [email protected] 250 828 3655
Tournament Capital CentreEmail tcc@kamloops caOnline tournamentcapital comPhone 250 828 3655KamloopsClassicsSwimming 250 828 3660Kamloops Gymnastics &TrampolineCentre 250 374 6424SageSportInstitute 250 314 5000TCCSwim&FitnessShop 250 372 5305TRU Athletics 250 828 5009
Follow us on Facebook for up to date eventandfacilityinformation.facebook.com/cityofkamloopsfacebook.com/kamloopsaquaticsfacebook.com/tournamentcapital
UsefUl ConTaCT InfoRMaTIon
services & information
![Page 6: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/6.jpg)
4
HoURs of oPeRaTIon MonDay - fRIDay saTURDay - sUnDayTCC(wellnessCentre&IndoorTrack)* 5:30am-11:00pm 6:30am-9:30pm
Canada Games Pool 6:00am-11:00pm 7:30am-9:00pm
ToURnaMenT CaPITal CenTRe
Day Passes PUnCH CaRDs(Valid for 2 years from date of purchase MonTHly MeMbeRs
Pool&IndoorTrack Full Access*1 Pool&Indoor
Track (14 admissions)Full Access *1
(10 Admissions) indoor Track Full Access*1
Children(4-13)*2 $3 75 $7 $43 $67
18 50(All Ages)
$34Youth(14-18) $5 25 $9 $62 $85 $45Adult(19-59) $7 $11 $84 $104 $55Senior(60+) $5 25 $9 $62 $85 $45
Family*3 $3 75 each N/A $43 $250 N/A $110
Adult(19-59) Senior(60+) Youth(14-18) Child(4-13) FamilyAdvancedPayment $552 $480 $480 $348 $1,080MonthlyPayment*6 $46 $40 $40 $29 $90
annual full access - Regular Membership *5 (Witha12-monthcommitment)
annual full access - Corporate Membership *5
(Witha12-monthcommitment)
annual full access - build your own family Membership *5
(Witha12-monthcommitment)
*1Fullaccesspassincludeswellnesscentre(gym),indoortrack,andCanadaGamesPoolaccess*2 Children 3 years of age and under are free*3Familyisamaximumoftwoadultsandallchildren18yearsofageandunderwhoarerelatedbybirth,legalstatus,ormarriage.Alegally
dependent person with a disability will qualify regardless of age *5Fullaccessmembership:Somerestrictionswillapply.Pleaseaskatfrontcounterformoredetails.*6$40administrationfreewillapplytostartmonthlypaymentplanonnewmembershipsonly,feedoesnotapplytoconsecutiverenewals.Patronshavetheoptionofmakingoneadvancedpatmentormonthlypaymentsforayear
*TCC will be closed on all statutory holidays with the exception of Family Day February 10
•TRUStudentUpgrade:$28withaVALIdU-PASSSTICKER•10&40PunchPassesalsoavailableforPool&Track•Patronswithadisabilitypaytheagerateandtheircareaideisadmittedforfree•ForSpecialPoolRatespleaserefertotheSchedulessectioninourActivityGuide•GymAgePolicy-Allyouthaged12-17yearsarerequiredtocompleteaFREEweightroomorientationpriortobeinggrantedaccesstoCityofKamloopsGym.Youth12-14yearsofagearerequiredtobeunderthedirectsupervisionofapayingadult(18+)
Employees DiscountsBronze 5-50 10%Silver 51-100 15%Gold 101+ 20%
First Adult $46 SecondSenior $34SecondAdult $36 EachYouth(14-18) $24FirstSenior $39 EachChild(4-13) $18
services & information
![Page 7: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/7.jpg)
5kamloops.ca/recreation 250.828.3500
ToURnaMenT CaPITal CenTRe InfoRMaTIonGym age Policy•Allyouthaged12-17yearsarerequiredtocomplete
a FREE weight room orientation
•Uponcompletionofanorientation,youthaged12-14arerequiredtousethegymsunderdirectsupervisionofapayingadult(18+years).Youthaged 15+ may use the gym on their own
•dropinorientations: MonDay - fRIDay 7am,7:30am,3:30pm,&7pm saTURDay & sUnDay 10am,10:30am,3pm,&3:30pm
Guest Code of ConductOurgoalistoprovideafriendly,safeandfunenvironmentforourguests.
•Pleaseberespectfulofothers,theirbeliefs,opinions,belongings,andfeelings.
•Pleaseberespectfulofdirectionsgivenbystafforvolunteers.
•Ensureconversation,behaviour,andlanguage are appropriate for a public facilitythatcaterstoallcultures,diversities,andagegroups.
•drugs,alcohol,anditemsthatwouldbedeemed as weapons are prohibited on site
•Cameras,smartphonesandotherelectronicrecordingdevicesarestrictlyprohibitedunlesspriorapprovalfromthecityisgiven
•Pleasereportanywitnessedmisconductorsuspiciousactivitytofacilitystaff.
ParkingPlease remember to input your stall number into the parking kiosks and take the ticket with you
AdditionalFREEparkingisavailable on the TRU campus after 5:00 pmMondaytoFridayandalldayonweekends.
The indoor track and field house will closed to the public for programming
Monday and Wednesday from 4:00-5:00 pm, Tuesday and Thursday from 4:30-6:00 pm,
november 3rd, 2014 - april 16th, 2015
Public Notice
services & information
![Page 8: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/8.jpg)
6
access KamloopsAccess Kamloops is a regularly updated directoryofallnot-for-profitandgovernment-fundedresourcesavailabletoresidents of Kamloops Features include:• onlineandpaperresources,• communitynews• eventssection
Toviewthedirectorygoto:www.accesskamloops.org
boogie the bridge Cultural fundTheBoogietheBridgeCulturalFundprovidesfamilieswithchildrenandyouthages5-18inneedoffinancialassistancetheopportunitytoparticipateinCulturalactivities.For more information and application please viewourwebsite:www.kamloops.ca/boogiefund
KidsportKidSportTMisacommunitybasedsport-fundingprogramthatprovidesgrantsforchildrenandyouthages6-18toparticipateinasportseasonoftheirchoice.KidSportTM
missionistoeliminatethefinancialbarrierstosportparticipation.‘SoALLKidsCanPlay!’For more information and application please viewourwebsite:www.tournamentcapital.com
aRCH - affordable Recreation for Community Health THECITYOFKAMLOOPSWANTSTOSUPPORTYOURACTIVELIFESTYLE!
ARCH is an opportunity to access Kamloops facilities and programs
step 1: Visit us at www.kamloops.ca/arch to see if you qualify
step 2: Fill out the application
Applications areavailableonthe web or at the Tournament CapitalCentre,WestsydePool,or Interior SavingsCentre
step 3: Take your application to a public screening agency(WhiteBuffalo,InteriorFriendship Centre or Family Tree)orvisitourwebsite to see all community agencies that refer clients to the ARCH program
step 4: Onceapproved,youwillreceiveanapprovalletter and information package
step 5: Bring your approvalletterand picture ID to the Tournament CapitalCentre,WestsydePool,or Interior SavingsCentreto be registered in the ARCH Program
community resources
![Page 9: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/9.jpg)
7kamloops.ca/recreation 250.828.3500
City of Kamloops residents and businesses are encouraged to contact theircommunityassociationthroughthee-mailaddresses,websites,
and Facebook pages below
aberdeen neighborwood association Facebook:www.facebook.com/AberdeenNeighborwoodAssociation
barnhartvale Community association Ontheweb:www.barnhartvale.com Facebook:www.facebook.com/Barnhartvale
Dallas Community association Email: dca@kamloopscommunities ca Facebook:www.facebook.com/dallasCommunityAssoc
Downtown Western Residents society Facebook:downtown&WesternResidentsSociety
Juniper Ridge Community association Email: Juniper RidgeCA@gmail com Facebook: search “Juniper Ridge Community Association”
north shore Central Community association Email: northshorecentral@yahoo ca Facebook:www.facebook.com/NorthShoreCentral
Pineview valley Community society Email:[email protected] Facebook: www.facebook.com/PineviewValleyCommunitySociety
The sagebrush neighborhood association Email: south shore ca@gmail com Facebook:www.facebook.com/sagebrushneighbourhoodassociation
sahali Community association Email: sahalicommunityassociation@gmail com Facebook:www.facebook.com/sahalica
valleyview Community association Email:[email protected] Ontheweb:www.valleyviewcommunity.ca
Westsyde Community Development society Email: wcds@westsyde info Ontheweb: wcds westsyde info
NEW! batchelor Heights Community association and the Heffley Creek Community Recreation Association are in development.Staytunedformoreinfo!
Community associationsfaCebooK & eMaIl!Kamloops is home to 13 Community Associations,volunteersgroupswhohelp make your neighborhood shine
You can also be a part of creating stronger communities with one simple action!
like your Community association on facebook and/ or send them your email. That’s it!Communicating with neighbors is one of the most important CAroles,andbeingconnectedbenefitsyouinsomanyways.•Hearaboutblockparties,neighborhoodwalks,orotherwonderfulgrassrootevents.
•ReceiveCAnewsletters.•LearnwhenconstructionorCityservicesaregoingto be happening in your neighborhood
•Voiceideasorfeedbacktohelpimproveyourneighborhood – your CA wants to hear from you
Together we make communities strong!
Visitusatwww.kamloops.ca/cafor more information
comm
unity resources
![Page 10: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/10.jpg)
Community CommitteesDo you have ideas, projects or concerns you would like to share with the City? Do you wonder who you should talk with?TheCityofKamloopshasseveralcommitteeswhoworktohelpCityCouncilmakeinformeddecisions.Committeesaremadeupofcitizens,Councillors,andadvisingorganizations.Please contact any of the following to share your feedback:
PaRKs anD ReCReaTIon CoMMITTeeadvisesCityCouncilonissuesrelatedtocommunityparks,sportandrecreation.Contact Val Lyons at 250-828-3400 or [email protected]
soCIal PlannInG CoUnCIladvisesCityCouncilonissuesthatimpactyourqualityoflife.Contact Carmin Mazzotta at 250-828-3728 or cmazzotta @kamloops.ca
senIoRs aDvIsoRy CoMMITTeeadvisestheSocialPlanningCouncilonimprovedaccesstoCityservicesforseniors,andtheirfamilies,forparticipationinallaspectsofCitylife.Contact Ben Chobater at 250-828-3582 or [email protected]
yoUTH, CHIlDRen anD faMIlIes aDvIsoRy CoMMITTeeadvisestheSocialPlanningCounciltoensurechildren,youth,parentsandprovidersareinvolvedin the decisions made within the City of Kamloops and in the community that affect them Contact Ben Chobater at 250-828-3582 or [email protected]
DIveRsITy aDvIsoRy CoMMITTeeadvisestheSocialPlanningCouncilonmattersrelatedtoculturaldiversitywithinKamloops.Contact Ben Chobater at 250-828-3582 or [email protected]
MayoR’s aDvIsoRy CoMMITTee foR PeRsons WITH DIsabIlITIesadvisestheSocialPlanningCouncilonmattersrelatedtopersonswithdisabilitiesandtheircommunitywell-being.Contact Ben Chobater at 250-828-3582 or [email protected]
aRTs CoMMIssIonisresponsiblefordevelopingandpromotingtheartswithintheCityofKamloops.Contact Barbara Berger at 250-828-3663 or [email protected]
HeRITaGe CoMMIssIonadvisesCityCouncilonheritagerelatedissues.Contact the Kamloops Museum at 250-828-3576
KaMlooPs sPoRTs CoUnCIladvocateandsupportforlocalsport.Contact Linda Stride at 250-828-3692 or [email protected]
URban aGRICUlTURe & fooD sysTeMs aDvIsoRy CoMMITTeeoverseesthedevelopmentoftheUrbanAgriculture&FoodSystemsStrategy.Contact Carmin Mazzotta at 250-828-3728 or [email protected]
Community Resources
8
community resources
![Page 11: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/11.jpg)
bIG online Canada is a resource tool and searchable database linking your criteria to availablefunding.Non-profitcommunityorganizations,culturalandsportinggroups
haveanopportunitytoaccessthisonlinesearchengine.
for more information, contact Cara at 250-828-3611 or [email protected]
Are You Looking For Grant Money?
Comm
unity Resources
Grants and ResourcesTheCityofKamloopsunderstandstheimportanceofnon-profitandvolunteerorganizationsinhelpingdevelopanddelivervaluableservicestoKamloopsresidents.Grantsareonesourceoffunding,andtheCityoffersanumberofgrantingopportunitiesforgroupstotakeadvantageof.TogetherweareMakingKamloopsShine!
neIGHboURHooD beaUTIfICaTIon GRanT ThroughtheCommunitiesinBloomInitiativefundingisavailableannuallyintheSpringtocommunitygroupsforimprovingstreetappealofproperties,enhancinglandscapesandactivities,fosteringcivicprideandgrowingaproud,confidentandhealthcommunity.Applicationinformationatwww.kamloops.ca/cib/cibgrants.sht
neIGHboRHooD MaTCHInG fUnDTheNeighborhoodMatchingFundsupportsneighborhood-drivenprojectsthatbringpeopletogetherincelebration.Grantapplications are accepted all year round Application information at www.kamloops.ca/ca
ToURnaMenT CaPITal GRanTsAmateursportorganizationsandindividualsareeligibleforeventsutilizingservicesand/orfacilitieswithintheCityofKamloops.FormoreinformationcontactSeanSmithat250-828-3552orssmith@kamloops.caThemaximumfundsavailableare:• ProvincialTournament(participantsfromBC)$500• WesternCanadianTournament(participantsfromBC,AB,SK&MB)$1,000• NationalTournament(participantsfromCanada)$1,500• InvitationalTournament(participantsfromoutoftown)$1,500
bC sUMMeR GaMes sPoRT DeveloPMenT GRanTTheBCSummerGamesSportdevelopmentGrantisavailabletolocalcoaches,officialsandsportorganizationsinterestedinfurtheringtheirknowledgeintheirrespectivesport.Examplesmayinclude:aLevelIIIcoachpursuingLevelIVcertification;anumpirebeingcertifiedtotrainotherumpires;asportorganizationpresentingahigh-profile“KeynoteSpeaker”thatmightbeofvaluetonumerousindividuals.Applicantsmayreceive50%ofregistrationfeesuptoamaximumof$500.FormoreinformationcontactSeanat250-828-3552orssmith@kamloops.ca
WInTeR GaMes leGaCy fUnDWinterGamesLegacyFundGrantsaretosupportanathleteorgroup(mustberesident(s)ofKamloops)advancesbeyondlocalcompetitionorisrecruitedtoaprovincialornationallyrankedteam.Qualifyingevents,ifapplicable,musthavetakenplacewithinthethreemonthspriortotheapplication.Themaximumamountallocatedis$150forindividualsand$300forgroups.Iffundsarelimited,prioritymaybegiventoyouthapplicants.FormoreinformationcontactSeanat250-828-3552orssmith@kamloops.ca
9kamloops.ca/recreation 250.828.3500
comm
unity resources
![Page 12: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/12.jpg)
10
The City of Kamloops wants people of all abilitiestobeactive,andwe’llsupportyoueverystepoftheway.Take part in an adapted program or register for oneofthemanyactivitiesfoundthroughouttheguide–THECHOICEISYOURS.Ourgoalsareto,whereverpossible: • Provideaccessibleprogramsandfacilities • Offerqualityactivitiesthatfityourneeds • Makesureeveryonehastheopportunityto
enjoy healthy recreationTheCityofKamloopsdoesnotprovidepersonalcare,administermedicationorgiveone-to-oneassistance.ThoseneedingextrasupportcanbringtheirownassistantatNOAddITIONALCOST.
Formoreinformationcall250-828-3582 orvisitusatwww.kamloops.ca/accessrec
Program Support Easy as 1-2-3
1. Choose your program(s) and register early 2. ContactusorcompleteaRequestforAdaptiveProgramSupport(RAPS)formforanyadaptations
that help support your participation 3. Let’sworktogethertomakesureyour
experience is all it can be
Accessible Recreation
Adapted programming can help you getcomfortablewithanactivitybefore registering in one of our
many other programs The choice is yours!
Adapted Programming
![Page 13: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/13.jpg)
11kamloops.ca/recreation 250.828.3500
aCTIve lIvInGadapted yoga $48Enjoy basic yoga exercises in a safe and supported environment. Moveat your own pace and learn the joys of mindful exercise. Caregivers arerequired to join in when needed
Yacht Club: Physical Disabilities»Jan13-Feb17 12:00-1:00PM Tue 235585
developmentaldisabilities»Jan13-Feb17 1:30-2:30PM Tue 235586
aQUaTICsadapted swim Join in the fun and splash into our supported swim lessons for kids with developmental or physicaldisabilities. Beginner level is forkidswhoareswimmingforthefirsttime. Intermediate level is for kidswho are becoming comfortable with swimming unassisted. Caregiversare required to ensure a fun and safe environment.
WestsydePool $42.30»Jan14-Mar11 4:00-4:30PM Wed 235593
Canada Games Aquatic Centre $51.70Beginner»Jan10-Mar14 5:00-5:30PM Sat 235594
Intermediate»Jan10-Mar14 5:00-5:30PM Sat 235595
sPoRTsadapted Hockey $50This exciting program is open to boys andgirlswithdevelopmentaldelays.Kids will be taught the basic skating and puck skills that every playerneeds. Siblings are encouraged toparticipate if they help make the experience more comfortable for yourchild.Siblingsmustregisteraswell.Minimumequipment required:helmet with full face mask, neckguard, gloves, skates, and stick.Wearing a full set of equipment isrecommended.Icetimesmayvary.
InteriorSavingsCentre»Jan10-Mar14 8:30-9:30AM Sat 235582
adapted skating $30Learnthebasicsofskating inafunatmosphere Kids will work on balance andskatingskillsinasafe,welcomingenvironment. For individuals withdisabilities. Caregivers are requiredto participate
InteriorSavingsCentre»Jan10-Mar14 7:45-8:15AM Sat 235584
Wheelchair basketball $25Offeredinpartnershipwith Kamloops adapted sports association,wheelchairbasketballisafast-paced,incrediblyfunworkout!Olympicandnational levelplayerswill teachyouchair skills, shooting techniques,and game strategy For all ages and abilities! drop-ins welcome. Chairsareprovided.
Tournament Capital Centre»Jan8-Mar12 7:00-8:00PM Thu 235591
Wheelchair Curling Kamloops adapted sports association presents wheelchair curling Come on out and throw some rocks,meet new friends, and havean awesome time with the newest sportofferedthroughKASA.Broomsnot required
Formoreinformation,[email protected] orvisitkamloopsadaptedsport.com.
Accessible Recreation
2015 Special Olympics BC Winter GamesThisyear,winterinKamloopswill be warmed by an inspiring displayofdedication,skill,andsportsmanship when the 2015 SpecialOlympicsBCWinterGames come to town
Kamloops will be host to the 2015SOBCWinterGamesthisFebruary,markingtheevent’sreturn to our community for the firsttimein12years!
Approximately 600 athletes and200volunteercoachesandmission staff from the eight SOBCregionsinB.C.andtheYukon will come together to competein:alpineskiing,cross-countryskiing,curling,figureskating,floorhockey,snowshoeing,andspeedskating
Getinvolvedasavolunteerandbeinspired!Learnmoreat: sobcgameskamloops ca
athletes of all abilities = Making Kamloops shine!
accessible recreation
Pool PartyLookingtothrowapartywithatwist?
Now you can arrange to book your ownprivateswimpartyatoneofour
pools! For more informationcall us at 250-828-3500.
Spin to WinThanks to the Kamloops adapted
sports association,wehaveahandcycleinourSpinStudio.
SpintoWinisanintegratedspinclass–see page 40 for more details
![Page 14: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/14.jpg)
12
AquaticsCold Water SurvivalOvermanyyearsCanadiandoctorGordonGiesbrecht– also known as Professor Popsicle – has researched the effects of cold water immersion and has coined thephrase‘1-10-1’asasimplewaytorememberthefirst3criticalphasesofcoldwaterimmersionandtheapproximate time each phase takes 1 - Cold shock: Aninitialdeepandsuddengaspfollowedbyseverehyperventilation.Youmustkeepyourairwayclearorruntheriskofdrowning.ColdShockwillpassinabout1minute.Concentrateonavoidingpanicandgettingcontrolofyourbreathing.Wearingalifejacketiscriticallyimportanttokeepyouafloatandbreathing.10 - Cold Incapacitation: Overapproximatelythenext10minutesyouwilllosetheuseofyourfingers,armsandlegsforanymeaningfulmovement.Concentrateonself-rescueinitiallyandpreparetohaveawaytokeepyourairwaycleartowaitforrescue.Swimfailurewilloccurwithinthesecriticalminutesandifyouareinthewaterwithoutalifejacket,drowningwilllikelyoccur.1 - Hypothermia: Eveninicewateritcouldtakeapproximately1 hour before becoming unconscious due to hypothermia If you understandtheaspectsofhypothermia,techniquesofhowtodelayit,selfrescueandcallingforhelp,yourchancesofsurvivalandrescue will be dramatically increased
Cold Water survival info courtesy of www.coldwaterbootcamp.com.
More water safety tips at kamloops.ca/swim.
![Page 15: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/15.jpg)
13kamloops.ca/recreation 250.828.3500
DUCK•12-24months
sTaRfIsH•4-12months
sea oTTeR•Frontandbackfloatsandglideswith help
•1mswim with help
salaManDeR•Frontandbackfloatsand swims
•Roll-overswims
•2mswim.
sUnfIsH•Front,back,roll-over,andside swims
•deepwateractivities.
•5mswim.
CRoCoDIle•Front,back,and
side swims and basic front crawl
•deepwaterswimming
•10mswim.
WHale•10mfront,back,
and side swims and basic front crawl
•deepwaterswimming
•15mswim.
sea TURTle•24months-3years
lesson fees: ParentandTot: $52 Preschool: $60 SwimKids (30 min): $47 SwimKids (45 min): $52 SwimKids (60 min): $61
sWIM KIDs 1•Frontandbackfloatsandswims
•Roll-overswimsandbasic front crawl
•5mswim
sWIM KIDs 2•Sideswimsand
basic front crawl•deepwateractivities
•10mswim
sWIM KIDs 3•Frontandbackfloatsandswims
•Roll-overswimsandbasic front crawl
•15mswim
sWIM KIDs 4•15mbackswim•10mfrontcrawl•25mswim
sWIM KIDs 5•15mfrontand
back crawl•Whipkickonback•50mswim
sWIM KIDs 6•25mfrontand
back crawl•15melementary
backstroke•75mswim
sWIM KIDs 7•50mfrontandbackcrawl•25melementary
backstroke and whip kick on front
•150mswim
sWIM KIDs 8•75mfrontand
back crawl•15mbreaststroke•300mswim
sWIM KIDs 9•100mfrontand
back crawl•25mbreaststroke
and side stroke•400mswim
sWIM KIDs 10•100mfrontandbackcrawl•50melementary backstroke,breaststrokeand side stroke
•500mswim
leaRn-To-sWIM PRoGRaM oveRvIeWPaRenT anD ToT lessons(ages 4 months-3 years)•Parentparticipationisrequired.•Progressionisbasedonage.
PResCHool lessons (ages 3-6 years)•Progressionisbasedon completionoflevel.
sWIM KIDs lessons (ages 5-14 years)•Progressionisbasedon completionoflevel.
Thesesamplefeesarebasedona10-classsession.Feeswillbepro-ratedforgreater/fewerclasses.
aquatics
![Page 16: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/16.jpg)
14
*Schedulesubjecttochange.**ThenextlessonsetstartFebruary11(Mon/Wed),andFebruary10(Tue/Thu).Seelessonhotsheetfordetails-pickoneupatthepoolorvisitwww.kamloops.ca/swim.
aquatics
WInTeR 2015 WeeKDay sWIM lesson sCHeDUleCanaDa GaMes aQUaTIC CenTRe WesTsyDe PoolMon/Wed** Tue/Thu** Mon/Wed** Tue Thu
start Date: Jan 12 Jan 13 Jan 12 Jan 13 Jan 15Starfish 9:30 am 9:30 am 3:30 pm
Duck 10:00 am 4:30 pm 10:00 am 3:30 pm
sea Turtle 10:30 am 4:30 pm 10:30 am 3:30 pm
sea otter
9:00 am9:30 am10:00 am10:30 am11:00 am3:00 pm
4:00 pm4:30 pm5:00 pm6:00 pm6:30 pm7:00 pm
9:00 am9:30 am10:00 am10:30 am
3:00 pm4:00 pm4:30 pm6:30 pm
3:00 pm4:30 pm 5:00 pm 3:00 pm
salamander9:00 am4:00 pm4:30 pm
5:30 pm6:00 pm
9:00 am4:00 pm4:30 pm
5:30 pm6:00 pm 3:30 pm 3:00 pm
Sunfish 6:30 pm 11:00 am4:00 pm
5:00 pm6:30 pm 4:00 pm 5:30 pm
Crocodile 3:30 pm 3:30 pm 7:00 pm 5:00 pm 3:30 pmWhale 3:30 pm 3:30 pm 7:00 pm 5:00 pm 3:30 pm
swim Kids 1 4:00 pm6:00 pm
4:30 pm5:30 pm 5:00 pm 5:00 pm
swim Kids 2 3:30 pm5:30 pm
3:30 pm6:00 pm 5:00 pm 5:00 pm
swim Kids 3 3:00 pm 3:00 pm 5:30 pm 5:30 pm
swim Kids 4 3:00 pm 3:00 pm 6:00 pm 6:00 pm 5:30 pm
swim Kids 5 3:30 pm 3:30 pm 6:00 pm 6:00 pm
swim Kids 6 5:30 pm
swim Kids 7 5:30 pm
swim Kids 8 4:15 pm
swim Kids 9 4:15 pm
swim Kids 10 4:15 pm
adults 6:30 pm
Private lessons 7:00 pm 7:00 pm 6:30 pm 6:00 pm
1.Keeplittlefeetoffthecooldecks–bringclean,non-slipdeckwear2.Wrapthemupinacozytowelrobebefore/after their lesson3.Aswimshirtorthicker‘rashguard’takestheedge off the cooler air4 Be sure to thoroughly dry off and keep clothes dry while changing5.Blow-dryhairandputatoqueonbeforeheading outside after lessons6.Celebratetheirachievementsandwarmthemup with a hot chocolate!
Tips to Warm Up your Winter Swim Lessons
![Page 17: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/17.jpg)
15kamloops.ca/recreation 250.828.3500
*Schedulesubjecttochange.Seelessonhotsheetfordetails-pickoneupatthepoolorvisitwww.kamloops.ca/swim.
aquatics
WInTeR 2015 WeeKenD sWIM lesson sCHeDUleCanaDa GaMes aQUaTIC CenTRe WesTsyDe Pool
Fri Sat Sun Fri Sat
start Date: Jan 9 Jan 10 Jan 11 Jan 9 Jan 10
Starfish 8:30 am 9:30 am 4:00 pm 10:00 am
Duck 10:00 am 9:00 am 10:00 am 8:30 am 5:00 pm 4:00 pm 10:00 am
sea Turtle 10:00 am 9:30 am 10:00 am 9:00 am10:00 am 5:00 pm 4:00 pm 10:00 am
sea otter9:30 am3:00 pm4:00 pm4:30 pm
5:00 pm5:30 pm6:00 pm
8:30 am9:00 am9:30 am10:00 am10:30 am
11:00 am4:00 pm5:00 pm5:30 pm
8:30 am9:00 am9:30 am10:30 am
11:00 am4:00 pm5:30 pm6:00 pm
3:00 pm5:30 pm
10:30 am11:30 am
salamander 3:00 pm4:30 pm 5:00 pm
8:30 am9:00 am9:30 am10:00 am
10:30 am11:00 am4:00 pm4:30 pm
9:00 am9:30 am10:00 am
10:30 am4:00 pm5:00 pm
3:30 pm5:30 pm
9:30 am11:00 am
Sunfish 4:00 pm 9:30 am4:00 pm 5:00 pm 9:30 am
4:30 pm 5:30 pm 3:00 pm 9:00 am
Crocodile 4:00 pm 10:30 am 4:30 pm 10:00 am 4:00 pm 3:30 pm 9:30 am
Whale 4:00 pm 10:30 am 4:30 pm 10:00 am 4:00 pm 3:30 pm 9:30 am
swim Kids 1 3:30 pm 9:00 am 4:30 pm 9:00 am 4:30 pm 4:30 pm 10:30 am
swim Kids 2 3:30 pm 4:00 pm 10:00 am10:30 am 4:30 pm 9:30 am 4:30 pm 4:30 pm 10:30 am
swim Kids 3 3:30 pm 5:00 pm 9:00 am10:30 am 4:00 pm 9:00 am
10:30 am 5:00 pm 4:00 pm 10:00 am
swim Kids 4 4:30 pm 9:00 am 4:00 pm 10:00 am3:00 pm 5:00 pm 4:30 pm 11:00 am
swim Kids 5 4:30 pm 9:30 am 4:30 pm 10:30 am3:30 pm 4:30 pm 5:00 pm 11:30 am
swim Kids 6 3:30 pm 10:00 am 4:30 pm 10:30 am 5:00 pm 6:00 pm 11:30 am
swim Kids 7 3:30 pm 10:00 am 10:30 am 5:00 pm 6:00 pm
swim Kids 8 5:00 pm 9:00 am 3:00 pm 9:30 am 3:00 pm 12:00 pm
swim Kids 9 5:00 pm 9:00 am 3:00 pm 9:30 am 3:00 pm 12:00 pm
swim Kids 10 5:00 pm 9:00 am 3:00 pm 9:30 am 3:00 pm 12:00 pm
adultslearn to swim 5:30 pm 6:00 pm
adultsstrokes 5:30 pm
Private lessons 5:30 pm 6:00 pm
11:00 am4:00 pm4:30 pm
5:30 pm6:30 pm
3:30 pm6:00 pm 1:00 pm
![Page 18: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/18.jpg)
We offer a variety of formats, times and days to guarantee fun!
Ask about our swim pass goody bag stuffers!Visit kamloops.ca/swim for pool party details. DIM SWIM
Fun, Music, Atmosphere
Saturdays, 6:00-9:00 pm ∙ September-May ∙ Canada Games Aquatic Centre ∙ www.kamloops.ca/swim
16
oRIGInal aQUaTIC PRoGRaMsadapted aquaticsAre you looking for Adapted Aquatics programs?Weofferswimminglessonsfor children with developmental orphysicaldisabilities.Seepage11fordetails
Gym n’ swim ages: 3-5Childrenenjoysupervisedgymnasticsand swimming while parents enjoy free time at TCC Contact the Kamloops Gymnastics and Trampoline Centre(KGTC)at250-374-6424formore information and to register
Private lessons $22/30 min ages 3+Full or half lesson sets of one-on-one instruction. Work on specificskillstomasteralevel-thecontentis up to you! Ask our staff about a semi-privateoption.VisittheezRegwebsite or call 250-828-3500 toregister
Junior lifeguard $54.90 Club ages 8-12Keeps kids active and interestedin swimming and lifesaving. Anawesome program for aspiring lifeguards Participants must be able toswim25m.Focusisondevelopingwater proficiency and rescue andfirstaidskills.
WestsydePoolandCommunityCentre»Jan15-Mar12 4:15-5:15PM Thu
Pool Paddling - $52 sessions ages 18+
Keep your paddling skills sharp in the comfort of the Canada Games Aquatic Centre Bring your own gear and boat Note: no instruction is provided.
Canada Games Aquatic Centre»Jan14-Feb25 9:00-10:30PM Mon 235932
adult Recreation Water Polo Regular admission ages 15+
drop in for some fun-focusedscrimmage. Swimming ability and“egg beater” kick are required; water polo experience is optional
Canada Games Aquatic Centre»Jan6-Mar10 9:00-10:00PM Tue
aquatics
Did you KNOW?Fragrances,lotionsandhair
products impact pool filtrationandchemistry.
Helpkeepourpoolsclean-Showerbeforeyouswim!
![Page 19: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/19.jpg)
We ReCoMMenD THIs PaTH...bronze coursesdeveloplifesavingfitnessanddecisionmakingskills.
standard first aidprovidespracticalskillstohandleemergencyresponsesituations
national lifeguard promotespreventionofdrowning and aquatic related injury
Instructor Training prepares you to teach swimminglessonsandlifesavingskills.
bUIlD THe foUnDaTIon foR sUCCess!Lifeguardspreventdrowning,teachwatersafetyandprovideleadershipinourcommunity.
Want help planning your lifeguard training? Consult one of our Aquatic Coordinators by email at [email protected] or by phone at 250-828-3754
optional Training:AEdProvider,BCRPAAquafitnessInstructor,PoolOperatorLevel1
Start Here!bronze star
ForChildren10-13years
bronze Medallion13yearsorBronzeStar
bronze CrossBronzeMedallion
standard first aid15 years
national lifeguard16years,BronzeCross,SFA
Water safety Instructor15years,AWSI
lifesaving Instructor16yrs,BronzeCross
W.H.M.I.S CertificateAvailableatTRUoronline
assistant Water safety Instructor15years,SwimKidslevel10
Dream Job!kamloops.ca/swim
17kamloops.ca/recreation 250.828.3500
JoIn THe TeaMbe a lIfeGUaRD
aquaticsDid you KNOW?
![Page 20: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/20.jpg)
1818
Days Dates Time Fee Location Program No
bronze star-StudentswilllearnbasicCPR,firstaid,andwaterrescuesandsearches,aswellaswaterhazardawareness.Prerequisites: Strong swimming ability is recommended; 100% attendance is required.
Fri Jan9-Mar13 6:00-7:00pm $95 Canada Games Aquatic Centre 234582
bronze Medallion-Preparesstudentstorespondeffectivelytoavarietyofaquaticemergencies.Studentswilldeveloptheirfitnesslevels,safetyknowledge,waterrescueskills,andjudgment.Prerequisites: Bronze Star or 13 years of age (by last day of course); ability to swim 200 m; 100% attendance is required.
Sat&Sun Jan24-Feb1 1:00-8:00pm $195 Canada Games Aquatic Centre 234583
bronze Cross-Challengesstudentstoperformincreasinglycomplexwaterrescues,firstaid,andCPRscenarios.Preparesstudentsforfurtherlifeguardtrainingandisalsoanexcellentlifeskillandconfidencebuilder.Prerequisites: Bronze Medallion; 100% attendance is required.
Thu-Sun Feb12-15 4:30-8:30pm(Thu&Fri)1:00-8:00pm(Sat&Sun) $170 Canada Games Aquatic Centre 234584
standard first aid (sfa)-ProvidescomprehensivetrainingcoveringallaspectsoffirstaidandCPR.Topicsincludespinal,bone,andjoint injuries; illnesses due to extreme heat and cold; abdominal and chest injuries; and burns Prerequisites: 15 years of age (by last day of course); 100% attendance is required.
Tue&Thu Feb24-Mar5 4:00-9:00pm $195 Tournament Capital Centre 234585
national lifeguard (nl)-NListhenationalstandardforlifeguardsinCanada.Candidateswilllearntoapplyrescuetechniquesandfirstaid skills Prerequisites: 16 years of age (by last day of course); Bronze Cross; SFA; 100% attendance is required.
Mon-Thu Mar16-26 10:00am-5:00pm $350 Canada Games Aquatic Centre 234586
assistant Water safety Instructor (aWsI)-Introducescandidatestothefoundationsofteachingskillsbyfocusingontheoreticaland practical knowledge that supports the learning experience Prerequisites: 15 years of age (by last day of course); Swim Kids 10 (or equivalent); 100% attendance is required.
Fri Jan23-Mar13 4:00-9:00pm $320 Canada Games Aquatic Centre 234587
Water safety Instructor (WsI)-PreparescandidatestoteachtheCanadianRedCrosslearn-to-swimprogramsbyfocusingonstrategiestointroduceanddevelopswimmingandwatersafetyskills.Prerequisites: 15 years of age (by last day of course); AWSI; 100% attendance is required.
ThiscoursewillbeofferedintheSpring/Summersession.
lifesaving Instructor (lsI)-CombinestheoryandpracticetopreparestudentstoteachandevaluateavarietyofLifesavingSocietyprograms,suchasCanadianSwimPatrol,BronzeStar,BronzeMedallion,BronzeCross,andothers.Prerequisites: 16 years old (by last day of course); Bronze Cross; 100% attendance required.
ThiscoursewillbeofferedintheSpring/Summersession.
Refund Policy:Withdrawspriorto7daysofstartdateare100%refundable;withdrawswithin7daysofstartdatearerefundedat50%.No refunds on or after start date
aDvanCeD aQUaTIC CoURses WInTeR 2015
aquatics
Recertification Clinics - Allcandidatesarerequiredtopresenttheiroriginalcertificationatthestartoftheclinic.
Clinic Day Date Time fee location Program no.
WSI Wed Jan 21 5:00-9:00pm $85 Canada Games Aquatic Centre 234588
LSI Mon Feb 16 6:00-10:00pm $75 Canada Games Aquatic Centre 234589
NL Sun Mar1 9:00am-5:00pm $125 Canada Games Aquatic Centre 234590
![Page 21: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/21.jpg)
19kamloops.ca/recreation 250.828.3500
Kamloops Tournament Capital Centre
Your one stop shop for all ofyour aquatic fitness needs
Your one stop shop for all ofyour aquatic fitness needs
Competitive Swimming • Aqua Fitness • Waterpolo • Synchro
Bring in thisad and receivean additional5% off yourpurchases
Tournament Capital Centre – 910 McGIll Road • On-line store: www.team-aquatic.com
19kamloops.ca/recreation 250.828.3500
Help keep our pools clean - shower before you swimFragrance,lotions,andhairproductsimpactpoolfiltrationandchemistry.
ThinkHealthy-SwimHealthy-BeHealthy kamloops.ca/swim
![Page 22: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/22.jpg)
20
Early YearsPhysicalLiteracyisaboutdevelopingtheFUNdamentalmovementskillsandtheFUNdamentalsportsskillssokidshavetheconfidenceandcompetencetodoANYTHINGtheywantinordertobeactiveforlife.Thebasicenvironmentswherechildrenshouldlearnfundamentalmovementskillsareontheground,inthewater,onthesnowandiceandintheair.Justaslearningthealphabetisneededtoread,theABCs-agility,balanceandcoordinationaresome of the skills that support physical literacy
Some activities to get you started this winter are:- Preschooliceskating- Buildingasnowman- Makingsnowangels- Jumpingintoapileofsnow- Swimmingduringpublicswims- Buildingasnowfort- Signingupforindoorrecreationprograms
Develop your child’s movement vocabulary
sotheyhavethebestchanceatbeingactiveforlife!Checkoutourphysical
literacy programs in our Early Years section
![Page 23: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/23.jpg)
Free Winter Activities in Kamloops
There are many fun and FREE WinteractivitiesinKamloopsthat the whole family can participate in Here are a few activitiesandplacesthatwillhelpkeepyouactiveduringtheWinterseason.
snowshoeing• StakeLake• McConnelLake• KennaCartwrightParkWinter Hiking• PetersonCreek• KennaCartwrightParkoutdoor skating• PineviewValley Community Ice Rink• JuniperIceRinkat Juniper Park• dallas-Barnhartvale Church• Heffley–LenHaughton Park• CentennialPark RalphClearwatersSports Complex • Rayleigh’sRae-MorParkTubing and Tobogganing• Rayleigh-overHighway 5 from the Petro Canada gas station• Brocklehurst–SinghStreet SoccerBowl• BachelorHeights–behind BachelorHeightsalongLac Du Bois Road• Abredeen–Manyareasto check out! along the way
aRTs anD CUlTURebeaver bonanza at the $5 Kamloops Museum 4-6 yrs
Join the Kamloops Museum &Archives as we discuss why thebeaver is a Canadian symbol, whyit is part of our history, and somecool facts about this unique animal Createacraft,exploretheMuseum,and make new friends
KamloopsMuseum&Archives»Feb26 10:00-11:00AM Thu 235534
»Mar11 10:00-11:00AM Wed 235535
DanCInGlittle Dancer I $87.50
2½-4 yrsIn this program, your child willdiscoverandexplorebasicmovementskills,musicalawareness,expression,andcreativitythroughdance.
RayleighElem.School»Jan6-Mar10 9:00-9:30AM Tue 233582
Sista’sLovetodanceStudio»Jan10-Mar14 9:00-9:30AM Sat 233583
»Jan10-Mar1411:40AM-12:10PMSat 233584
little Dancer II $94 4-5 yrsIn this program, your child willdiscoverandexplorebasicmovementskills,musicalawareness,expression,andcreativitythroughdance.
Sista’s Love to dance Studio »Jan10-Mar14 9:40-10:25 AM Sat 233588
RayleighElem.School »Jan6-Mar10 9:00-9:45AM Tue 233589
Play anD leaRn frozen $20
3-5 yrs Explore winter fun and create a winter wonderland with your favourite Frozen characters. Enjoystories,songs,andcrafts,andmeetnew friends too! Come wearing your favouritewintercostume.
KamloopsMuseum&Archives»Jan20 10:00AM-12:00PM Tues 234632
Queen of Hearts $20 3-5 yrs
JoinAliceandherfriendsforaMadHatter Tea Party and fun activities.Create some great Valentine’s Day crafts.Learnthroughstories,games,andphysicalactivity.ComedressedasyourfavouriteAliceinWonderlandcharacter
KamloopsMuseum&Archives»Feb10 10:00AM-12:00PM Tues 234633
laughing leprechauns $20 3-5 yrs
Join us for a morning of leprechaun fun!Wewillmakecrafts,findapotofgold,singsongs,andplaygames.Wearyourbestgreenoutfit.
KamloopsMuseum&Archives»Mar10 10:00AM-12:00PM Tues 234634
New
New
21kamloops.ca/recreation 250.828.3500
Early Years
early years
![Page 24: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/24.jpg)
sPoRTsactive Tots $35
4-6 yrs Throughplayandmovement,childrendevelop FUNdamental movementskillsthatwillprovidethefoundationfor physical activity. The programwillfocusonamulti-sportapproach.Your child will be introduced to Tots Soccer, T-ball and Floor Hockey.This program is in partnership with PacificSportInteriorBC.
WestsydeNeighbourhoodCentre»Jan21-Feb18 9:30-10:30AM Wed 234083
sports on Mats $35 4-5 yrs
Introductoryjudo,karate,wrestling,and gymnastics skills come together to deliverafun,innovativeapproachforkidstomovetheirbodiesinavarietyof ways. Practice tumbling, falling,rolling, and lateral movements todevelopfundamentalphysicalskills.
WestsydeNeighbourhoodCentre »Jan15-Feb1910:00-11:00AM Thu 233934
Tots floor Hockey $25 2½-3½ yrs Introduceyourchildtofloorhockeyfundamentals, plus fun activities,games, songs, and more! Thisprogram will engage children,increasetheirphysicalliteracyskills,and introduce them to new friends
WestsydeNeighbourhoodCentre»Jan20-Feb10 9:30-10:00AM Tue 233936
Tots floor Hockey $30 3½-5 yrs Introduceyourchildtofloorhockeyfundamentals, plus fun activities,games, songs, and more! Thisprogram will engage children,increasetheirphysicalliteracyskills,and introduce them to new friends
WestsydeNeighbourhoodCentre»Jan20-Feb10 10:15-11:00AM Tue 233937
22
early years
Did you know?ThattheCityofKamloopshasfreepre-schoolskating
sessions throughout the winter 2015 season Check our skate website for schedules and more information:
www.kamloops.ca/arenas
Snow PaintingSnowpaintingisagreatwinteractivityandauniquewaytonurtureartistic talent or introduce children to the joy of artistic creation
What you need:
•Snow
•Foodcoloring
•Spraybottles
Fillspraybottlewithwarmwateraddfoodcolouring-makesurewaterbottles haveenoughcoloringinthemtomakethecolourvisibleoncesprayedonthesnow.
![Page 25: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/25.jpg)
23kamloops.ca/recreation 250.828.3500
early years
. . . always putting children fi rst & always going several steps beyond!
25O.319.9O44 • www.kamloopskidz.com
“A lifetime of learning begins here”
Valleyview Campus1764 Valleyview DrivePreschoolChildcare - Ages 1 to 12
Sahali Campus1585 Summit Drive PreschoolChildcare - Ages 5 to 12
Pineview Campus 1711 Copperhead DrivePreschoolChildcare - Ages 1 to 12
JUNIOR KINDERGARTENMonday & Wednesdaysfrom 11:45am-2:15pm $125/MonthAges: 4 year olds January 5th - June 19th
Code: JKMW
Are you concerned that your child may not be ready for Kindergarten next September? This class is only for children who will be entering kindergarten in September 2015. Our focus will be:
• social/emotional development including play skills;
• skill development including listening and working cooperatively;
• gross and ne motor development including correct pencil grasp, cutting, drawing;
• cognitive and language development including name recognition, name writing, colors, letters, shapes, numbers.
All areas of the whole child will be focused on to ensure your child is ready for Kindergarten – our classes ll quickly – don’t miss out!
JUNIOR PRESCHOOLFridays from 12-1:30pm FREECode: JPFJanuary 12th - February 13th
Ages: 2.5 year oldsThe transition from Toddlers to Preschool can be a little stressful on some children and their parents. This class is designed as an introductory experience away from Mom/Dad. Children will be busy meeting new friends, singing songs, creating art, playing with fun materials. There will also be a large gross motor component where children can run, jump and use up all that energy. Sure to be loads of fun.
Registering NowRegistration now for our January 2015 classes! Childcare
registration is ongoing, enquire
today!
What Our Parents Say“My son learned a love of school and was beyond prepared to start kindergarten”
...Rachel
“Your wonderful location, playgrounds, facility and philosophy were why we chose you, but the extra special care and attention is what keeps me recommending your preschool”
...Erin
![Page 26: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/26.jpg)
Children
24
Did you know?
Playingactivevideogamesstilldoesn’tgiveyourchildrenthephysicalactivitythattheyrequire.Accordingto activehealthykids.ca,activevideogamesmaygetheart ratesup,butthey’renotsignificantlyhelpingkidsgettothe60minutesofmoderate-tovigorous-intensityphysicalactivityrequiredeachday.Screentime,includingactivevideo games always poses a threat to play; unstructured play in ournaturalenvironment.
Embracethecoldwithagreatattitude,warmclothesandspontaneous,unstructuredactivities.Gettingreadytogooutsidecanseemlikeadauntingtask,butwhynotmakeitfun?Startby creating a list including pictures of items your child will need to stay warm outside This can help your child independently getready-eveniftheycan’treadalist,theycanrefertothepictures.Youcouldevenmakearaceoutofit!Challengeyourchild to get ready before you do
Unplugging and reducing your screen time in the winter doesn’t havetobeachallengingexperience,butratheranopportunitytobondwithyourchild(ren)andenjoyplayingtogether,outsideinournaturalenvironment.
Doll brothersWhetherHudson(10)and Luke(9)areplayingintheirbasement,ontheirdrivewayorontheice,theirfavoriteWinteractivityishockey.Whentheyarenotplayinghockeyyouwillfindthempublic skating at the local arenas or attheWCPoutdoorrink.Aspecialwinter outing is tubing at Harper mountain
![Page 27: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/27.jpg)
25kamloops.ca/recreation 250.828.3500
aRTs anD CUlTUReart explosion! 6-13 yrsYour child will enjoy a stimulating selection of irresistible ideas and visualexcitement.Sculpt,draw,andpaint a new project each week using materials found around the house A healthysnackwillbeprovided.
OldCourthouse $75»Jan15-Feb12 3:30-5:00PM Thu 233082
$60»Feb19-Mar12 3:30-5:00PM Thu 233083
ParkviewActivityCentre
$75»Jan14-Feb11 3:30-5:00PM Wed 233084
$60»Feb18-Mar11 3:30-5:00PM Wed 233085
Creative exchange $1/child at the Museum 3 yrs +The Museum provides the craftsupplies, you bring the creativity!Create a masterpiece based on our permanent and temporary, or theseason.After,exploretheChildren’sMuseum and discover somethingnew. Adult supervision required,pleasepre-register.
KamloopsMuseum&Archives
»Jan31 2:30-4:00PM Sat 235536
»Mar21 10:00-11:30AM Sat 235537
Portrait stories $10 at the Museum 9-12 yrsAttention shutterbugs! Bring in photos of your life and create a fictionalstoryusingyouasthemaincharacter. Baby pictures, familyphotos, or a great family memorywillserveasthebackdrop,andthenyoudeveloptheplotline.
KamloopsMuseum&Archives»Mar7 10:00AM-12:00PM Sat 235544
Pioneer Games fRee at the Museum 5-12 yrsWhat did kids do before Xbox orNintendo?Beforekids‘pluggedin’toplay,games likecheckers, tag,andSimonSayswerepopularpastimes.Joinusaswediscoversomeof thegames that children played before video games, cell phones, or TV.Pleasepre-register.
KamloopsMuseum&Archives»Mar14 10:00-11:30AM Sat 235547
sensational spring $10 per Days at the session Museum 7-12 yrsAttention nature lovers! duringSpring Break, learn about all thewonderful features of nature, suchas animals, water, the earth, andtrees Each day is a new theme Createcrafts,dohands-onactivities,and make new friends
KamloopsMuseum&ArchivesAwesome Animals»Mar17 10:00AM-12:00PM Tue 235553
WonderfulWater»Mar18 10:00AM-12:00PM Wed 235555
Extraordinary Earth»Mar19 10:00AM-12:00PM Thu 235556
TerrificTrees»Mar20 10:00AM-12:00PM Fri 235557
Digital DetoxTakea‘techtimeout’!Bearolemodelfor your children and put the phones down,turnofftheTVandshutoffthecomputers.Setanexampleofbeingactive,eveninthewintermonths.Positivesocialinteractionswithoutinvolvingscreentime,willbuilthealthierlivesandencouragechildrentobeactivewithfamilyandpeers.Hereareafewactivitiesthatyou can do in the winter months that encourage you to unplug and play:
•AttendactivitiesduringUnplugged andPlay’week.Seetheinsidecover for details •Hostfamilygamenightsandinvite the neighbours
•Takefamilywalksbymoonlight
•Tryicefishing
•Buildasnowfamilyinthe backyard
•Goiceskating
•Shoveltheneighbour’sdriveway together
•Playgamestogetherinthesnow.Soccerandtagcanbefuninthe snow!
•Goonawinterpicnic
•Buildafortinthelivingroomandhaveafamilysleepover
•Tryanewactivitylikecurlingor snowshoeing
•Createawintertreasurehuntforthe children
children
Kamloops Children’s Museum
TheKamloopsChildren’sMuseumislocatedonthefirstflooroftheKamloopsMuseum&Archives,at207SeymourStreetandisopenTuesdaytoSaturday,9:30am–4:30pm.dressupasapioneer,trade supplies in our fur trade
cabin or put on a show in our puppet theatre Come and explore!
![Page 28: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/28.jpg)
26
spring break Photo $125 Camp for Creative Kids
9-13 yrsStudentswillcreatetheirowncomicbook storyboard by bringing their story to life with photography This three-day camp will have studentsshooting in manual in no time! They will begin by using aperture and shutter priorities and graduating to manual by the end of the camp! Students must bring their owncamera
ExposurePhotoStudio»Mar24-26 8:00AM-3:00PM Tue-Thu 235637
egyptology for Kids $10 at the Museum 9-12 yrsExplore the world of ancient Egypt in two hours! Learn aboutmummification,createacanopicjar,anddiscoverwritinginhieroglyphics.CanyouwalklikeanEgyptian?
KamloopsMuseum&Archives»Mar28 10:00AM-12:00PM Sat 235545
In the studio fReeCreate a portrait of yourself using props and backgrounds at the KamloopsMuseum&Archives.Staffwill take your photo so you can bring it home to share Dress up as a pioneer or fur trader! Please pre-register.
KamloopsMuseum»Feb7 1:00-3:00PM Sat 235589
DanCInGIntro to Irish Dancing $125 1 - Reel fun 6-8 yrsA high-energy, fun class in whichdancers will learn the basics of soft shoe Irish dancing Dancers will develop grace, poise, and goodposture while learning the steps of theBeginnerReel.developphysicaland mental skills through aerobic exercise, listening, and followinginstructions.Someteamdancingandceilidh dancing will be introduced at the end of the course
SouthKamloopsSec.School»Jan8-Mar12 5:15-6:15PM Thu 234164
Intro to Irish Dancing $125 1 - Reelin’ n’ Jiggin’ 9-12 yrsA high-energy, fun class in whichdancers will learn the basics of soft shoe Irish dancing Dancers will develop grace, poise, and goodposture while learning the steps of the Beginner Reel and Beginner Jig develop physical and mental skillsthrough aerobic exercise, listening,and following instructions. Someteam dancing and ceilidh dancing will be introduced at the end of the course
SouthKamloopsSec.School»Jan8-Mar12 6:30-7:30PM Thu 234165
Movers and Groovers $100 6-8 yrs
Get into thedancemoveswith thisupbeat introduction to hip hop dance techniques Each lesson will take you through a choreographed dance sequence. Before you know it, youwill be dancing like a star!
Sista’sLovetodanceStudio
»Jan10-Mar14 10:30-11:30AM Sat 233592
Musical Theatre $100 8-14 yrs
Singing, acting, choreography,movement, improvisation, andcharacter development will becombinedinthisperformance-basedclass! Broadway music and pop songs will be explored in a new way as we journey into the world of musical theatre
Sista’sLovetodanceStudio
»Jan7-Mar11 4:00-5:00PM Wed 233594
square Dancing fRee 7 yrs +
Learnthebasicsofsquaredancing.Ifyoucanwalk,youcansquaredance!Partners and/or dance experienceare not required
ArthurHattonElem.School»Jan16-Mar13 2:45-4:00PM Fri 234979
children
Raising “5-2-1-0” Children
Let’sallaimtoraisehealthierchildrenbyfollowingthe5-2-1-0message.Atleast5fruitsandvegetables,nomorethan2hoursofscreentime,atleast1hour
ofphysicalactivity,and0sugarydrinksdaily.
![Page 29: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/29.jpg)
27kamloops.ca/recreation 250.828.3500
Ukrainian Dancing $85 beginner 7 yrs +Learn traditional Ukrainian danceand have fun with many characterdances that incorporate role playing and story lines Experience is not required Dance slippers are an additional cost to this program
StuartWoodElem.School»Jan14-Jun17 6:00-7:30PM Wed 235439
sPoRTs ball sports $30
7-12 yrsYour child will explore different ball sports through fun games and activities,whilelearningfundamentalmovementskillstohelpbuildphysicalliteracy
WestsydeNeighbourhoodCentre»Jan13-Feb3 3:00-4:30PM Tue 233935
Darts $35 11-14 yrs
Come on out and join in this fun recreational activity. developyour hand-eye coordination,concentration,andmathskillswhilebuildingselfconfidenceandmeetingnew friends
WestsydeNeighbourhoodCentre»Jan4-Mar10 233932 Sun,10:00-11:00AM Tue,6:00-7:00PM
Junior badminton $30 8-12 yrs
Learn the fundamentals ofbadminton, including all strokes(forehand, backhand, clear, smash,andnetshots),footwork,rules,andstrategy Free play and games at the end of each session. Must supplyyour own racquet
Bert Edwards
»Jan8-Feb5 6:00-7:00PM Thu 233736
Junior Tennis $125 spring break Camp 8-12 yrsThese tennis camps are designed to helpyouryoungsterimproveandhavefun! Tennis Canada and provincialassociation partners has introduced a new community program called Progressive Tennis. With smallercourts, smaller racquets and softerballs, the game is fun and easy toplay This camp is in partnership with the Kamloops Tennis Association
Kamloops Tennis Centre
»Mar16-20 9:00AM-12:00PM Mon-Fri 234880
soccer Drills and skills $20
6-9 yrsThis clinic is for players who are new to soccer Drills and skills will be covered,aswellasgameplay.
WestsydeNeighbourhoodCentre
»Feb21 10:00AM-12:00PM Sat 233938
Jam Can bonspiel - $40 Team Registration 6-13 yrsCome out to the Kamloops Curling Club’s Jam Can Curling Bonspiel and try a new sport! You’ll get two full daysoffunwithyourfriends.Luncheswill be provided. Must register asa team, maximum four per team.Childrenmustbesupervised.
Kamloops Curling Club»Mar28/29 8:00AM-5:00PM Sat-Sun 235832
Jam Can bonspiel - $10 Individual Registration
6-13 yrsCome out to the Kamloops Curling Club’s Jam Can Curling Bonspiel and try a new sport! You’ll get two full days of fun with your friends Lunches will be provided. Childrenmustbesupervised.
Kamloops Curling Club»Mar28/29 8:00AM-5:00PM Sat-Sun 235833
children
Thecoldesttemperatureeverrecordedintheworldwas-128degreesCelsius,inVostokStationinAntarcticain1983.
(http://en.wikipedia.org/wiki/List_ofweather_records)
Did you Know?
New
New
New
![Page 30: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/30.jpg)
28
outdoor Community Rinks Winteristhetimetotakepartintheageoldtraditionofgettingtogetherwithfamilyandfriendsforskatingattheoutdooricerink.Wehappilyhandleafrostynoseandtinglingtoesforthesimplejoysofchasingeachotheraroundtheice,holdinghandswithasweetheart,orslappingapuckwithbuddies
KamloopshasoutdoorrinksinJuniperPark-JuniperRidge,PineviewValleyCommunityIceRink,CentennialPark(Westsyde),andHeffleyCreek–LenHaughtonPark.Theserinksaremaintainedbycommunityvolunteers.
Sopackathermoswithcoffeeorhotcocoa,putonsomewarmclothes,andenjoythewonderfulwinterweather at your neighborwood outdoor rink
Youth
doyouwanttobeactiveandmakenewfriendthiswinter?CheckoutourPublicSkatingandStickandPuckprograms.Forschedulesandprogramguidelinespleasevisitour
website:www.kamloops.ca/arenas
Public Skating and Stick and Puck
Note: In most cases the rinks are floadedinthelateeveningsso they all not open for skating during the early day time hours
![Page 31: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/31.jpg)
New
29kamloops.ca/recreation 250.828.3500
aRTs anD CUlTUReface Painting $50 Workshop 101Face painting can bring out the artist in anyone! This workshop will giveyou tips and tricks Fee includes a facepainting kit
ParkviewActivityCentre»Mar10 6:30-8:30PM Tue 235093
face Painting $60 Workshop 201Learn how to face paint like aprofessional with appropriate products and tools. If you havepreviousexperienceorattendedtheFace Painting Workshop 101, thisworkshopisforyou.Mustbringyourown face painting supplies
ParkviewActivityCentre»Mar31 6:30-8:30PM Tue 235094
Printmaking $45Learn the basics of printmaking byusing everyday household objectssuchassponges,mesh,string,wool,bubblewrap,paperclips,cardboard,and paper All supplies will be providedforthisworkshoptocreateyour masterpiece!
OldCourthouse»Jan24 1:00-3:00PM Sat 235445
»Feb20 1:00-3:00PM Fri 235446
spring break Photo Camp $125Create your own comic book storyboard by bringing your story to lifewithphotography.Plus,innotime,this three-day camp will have youusing your camera’s manual setting! You will begin by using aperture and shutter priorities and graduating to manualbytheendofthecamp.Mustbring your own camera
ExposurePhotoStudio»Mar24 8:00AM-3:00PM Tue 235638
The storyteller - $250 Teen Photography Class This eight-week program teachesstudents the technical, artistic, andemotional aspects of photography throughhighlycreativephotoshoots.Photographeverythingfromfashiontoexplosionstolightpainting.Mustbring your own camera
ExposurePhotoStudio»Jan14-Mar4 3:30-5:00PM Wed 235632
DanCInGbelly Dancing $80This program will introduce participantstothebasicmovementsof theartofbellydance.Workshopincludes warm-up, isolations,technique, combinations, andcool-down. Workshop is geared tobeginners,butisopentoalllevels.
BeattieSchooloftheArtsMcGillCampus»Jan14-Mar4 7:00-8:00PM Wed 235435
Hoop Dancing $40This new form of dance, fitness,and self-expression is electrifying,and it’s inspiring people across the countryandaroundtheworld!Learna variety of basic moves and thenexplore tricks and techniques that will expand your skills This beautiful performance art is a fun workout for building confidence,gettingfit, andhaving fun.Noprevious experienceis necessary Practice hoops will be provided.
OldCourthouse»Feb5-19 6:30-7:30PM Thu 235092
sPoRTs ball sports - Girls only
$35 13-15 yrsJoin us in this program designed for girlswanting to try a variety ofsports.Havefun,meetnewfriends,andenjoysomephysicalactivity!
WestsydeNeighbourhoodCentre»Feb3-24 4:30-5:30PM Tue 233939
ball sports - boys only $35
13-15 yrsJoin us in this program designed forboyswantingto tryavarietyofsports.Havefun,meetnewfriends,andenjoysomephysicalactivity!
WestsydeNeighbourhoodCentre»Feb4-25 4:30-5:30PM Wed 233940
youth Darts $35 15-18 yrsJoin this fun activity! developyour hand-eye coordination,concentration,andmathskillswhilebuildingself-confidenceandmeetingnew friends
WestsydeNeighbourhoodCentre»Jan4-Mar10 233933 Sun 11:00AM-12:00PM Tue 7:00-8:00PM
doyouwanttobeactiveandmakenewfriendthiswinter?CheckoutourPublicSkatingandStickandPuckprograms.Forschedulesandprogramguidelinespleasevisitour
website:www.kamloops.ca/arenas
Public Skating and Stick and Puck
Agameofspeed,power,andagility,wheelchairbasketballisa sport for all ages and abilities! StartingJanuary8everyThursdayat7PM.drop-inswelcome!Sport
chairsprovided.
Wheelchair Basketball
youthNew
New
New
New
New
![Page 32: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/32.jpg)
30
Parks Tot Lots
WesTsyDe
bRoCKleHURsT
abeRDeen saHalI
valleyvIeW
JUnIPeR RIDGe
Dallas
baRnHaRTvale
baTCHeloR HeIGHTs
MoUnT DUffeRIn
RayleIGH
KaMlooPs InDIan
ReseRve no.1
aberdeenPineviewValleyPark 1925 Hugh Allan DrWestHighlandsPark 1185 Links Way
barnhartvaledallas/Barnhartvale Nature Park 1210 Eliza Rd
batchelor HeightsBatchelor Nature Park 1750 Batchelor Dr
brocklehurstBrocklehurst Park 2470 Fleetwood Ave
Campbell CreekCampbell Creek Nature Park
9080 Trans-Canada Hwy EastCity Centre
Exhibition Park 1055 River StPioneer Park 40 7th AvePrince Charles Park 1145 Nicola StRiversTrailParkBridge 100 Lorne StRiversTrailParkPlace 894 Lorne StRiversidePark 100 Lorne St
SahaliTerraceNaturePark 980 3rd AveWaterfrontPark 20 Mt Paul Way
Heffley CreekTournament Capital Ranch 5355 Yellowhead Hwy
Juniper RidgeThe Kamloops Bike Ranch 1105 Highland RdValleyviewNaturePark 220 Valleyview Pl
Mission flatsMissionFlatsNaturePark 2710 Mission Flats Rd
Mount DufferinKenna Cartwright Nature Park 2000 Hillside Dr
north shoreMcArthurIslandPark 1525-1580 Island ParkwayMcdonaldPark 262 King StOverlanderPark 247 Kitchener Cres
sahaliAlbertMcGowanPark 2025 Summit DrHumphreySanctuary Nature Park 1801 Springhill Dr
Peterson Creek Nature Park 1440 Glenfair Dr
valleyviewJackGregsonWalkingTrail 1598 Lorne St EastValleyviewCentennialPark 2288 Park Dr
WestsydeRiversTrailParkWestsyde 2525 Oak Hills BlvdWestsydeCentennialPark 705 Franklin Rd
1
1 613
14 19
20
21
22
23
24
25
26
27
28
29
15
16
17
18
7
8
9
10
11
12
2
3
4
5
2 23
24 25
16 173 6
2719
18
5
4
28
29
15
22
10 12 14 8
7
9
11 26
13
2021
![Page 33: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/33.jpg)
31kamloops.ca/recreation 250.828.3500
Tot Lots
WesTsyDe
bRoCKleHURsT
abeRDeen saHalI
valleyvIeW
JUnIPeR RIDGe
Dallas
baRnHaRTvale
baTCHeloR HeIGHTs
MoUnT DUffeRIn
RayleIGH
KaMlooPs InDIan
ReseRve no.1
aberdeenSiftonTotLot 2046 Sifton Ave
batchelor HeightsSouthviewTotLot 1564 Southview Terrace
brocklehurstAcadiaTotLot 1067 Acadia Pl
CambridgeTotLot 637 Cambridge Cres
EdgemountTotLot 2235 Edgemount Ave
InvermereTotLot 845 Invermere Crt
McLeanTotLot 1190 McLean St
SpartanTotLot 1610 Spartan Pl
Campbell CreekCampbellCreekTotLot 8701 Dalls Dr
City CentredominionTotLot 1351 Dominion Cres
KinsmenSouthTotLot 975 Pleasant St
DallasBogettiTotLot 4308 Bogetti Pl
north shore8thTotLot 1153 8th St
BelmontTotLot 709 Cumberland Ave
KinsmenNorthTotLot 605 Comox Ave
MooseTotLot 385 Schubert Dr
RichmondTotLot 601 Richmond Ave
SherbrookeTotLot 1026 Sherbrooke Ave
YewTotLot 514 Mackenzie Ave
RayleighCammerayTotLot 4705 Cammeray Dr
sahaliGlenNevisTotLot 818 Gleneagles Dr
SahaliTotLot 435 Arrostone Dr
West endAllanPowersTotLot 330 Centre Ave
ConnaughtTotLot 225 Connaught Rd
Grandview-dufferinTotLot 461 Dufferin Terrace
McIntoshTotLot 502 Battle St West
WestsydeHookTotLot 1545 Collingwood Dr
RainbowTotLot 670 McCurrach Pl
WestPinesTotLot 616 Harrington Rd
17
813 20
26
27
28
29
21
22
23
24
25
14
15
16
17
18
19
9
10
11
12
2
3
4
5
6
1
637
2829
208 18
2 27
13 1417
17
19 16
23 2625 24
4
5
21
22 11 10 12
parks & tot lots
![Page 34: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/34.jpg)
32
FamilyUsing Your Five Senses to be WinterActiveEncourageunstructuredactiveplayoutsideinthesnow.JolandaHengstmanfromSixtySecondParenthasanactivitythatnotonlygetskidsoutdoors,butgetsthemthinkingabouttheoutdoors,too.
Takeyourkidsonawalkandhavethemchooseoneofthefivesenses and ask them questions about how they are using that sense
Hearing:Whatdowehear?Isitloudorsoft?Canyoumimicthesound?Thesecanbenaturalsoundsaswellasman-madesounds.
Touch:Canyoutouchsomethingtall,round,oryellow?Isitroughorsmooth?Isitwarmorcold?
sight:Playthegame“ISpy…”oraskwonderingquestionslike,“Howcanyouseeifthewindisblowing?”
Taste: Whatdoyouthink_____tasteslike?doestheairhaveataste?
smell:Whatdoyousmell?doesthishaveasmell?Youmayalsoincreasethefunbychallengingyourkidstorun,jump,hop,skiporslide on snow
for more ways to be active, visit www.activeforlife.ca
Did you knowCooking with kids is a great
way to conect and spend quality time together as a family while teaching little ones important healthyeatinghabits.Sogetcooking with your little chef today! For some hearty and nutritiouswinterrecipes,visit
www.healthycanadians.gc.ca
![Page 35: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/35.jpg)
John Tod’s New Beginning
Thisfall,thenewlyrenovatedJohn Tod Centre opened its doorsat150WoodStreet.Thenew Centre brings together the operations of the Boys and Girls Club of Kamloops and the KamloopsCommunityYMCA/YWCAinanexcitingandboldnew community partnership thatwillprovideprogramsandservicestochildren,youth,families,seniorsandthe broader community
TheYMCA/YWCAfitnessoperations formerly located inNorthillsMallwillnowbe based in the John Tod Centre,alongwitharangeofotherprogramming,including a toy lending library and a child care resource and referral program
The Boys and Girls Club of Kamloops brings their licensedchildcare,RogersRaisingtheGrade,PowerStart,afterschooldrop-in,summercamp,andotherprogramsandservicesinto the new facility as well Together in the John TodCentre,theKamloopsCommunityYMCA/YWCAand Boys and Girls Club of Kamloops are creating a new space for community
33kamloops.ca/recreation 250.828.3500
aRTs anD CUlTURestorytime fRee at the Museum Join us as we explore pioneer pastimes,worldsoflongago,ancientcivilizations,seasons,andfunstories!Museumstaffwillbereadingpicturebooks and everyone is welcome toattend. After the stories, stay andexplore the Children’s Museum.Pleasepre-register.KamloopsMuseum&Archives»Jan30 10:00-10:30AM Fri 235538
»Feb27 10:00-10:30AM Fri 235539
»Mar31 10:00-10:30AM Tue 235540
In the studio fReeCreate a portrait of yourself using props and backgrounds at the KamloopsMuseum&Archives.Staffwill then take your photo allowing you to take your portrait home to share Dress up as a pioneer or fur trader.Pleasepre-register.KamloopsMuseum&Archives»Feb7 1:00-3:00PM Sat 235589
Chinese new year $1/child at the Museum Celebrate Chinese New Year at the Kamloops Museum. We will bereadingstories,creatingcrafts,andlearning about Chinese culture Adult supervision required. Please pre-register KamloopsMuseum&Archives»Feb19 10:00AM-12:00PM Thu 235550
CooKInGPie in the sky Parent $40 1st Child fRee 8 yrs +An introduction to the world of pies Learn to make a versatile flakypastry, suitable for fruit or savouryapplications Also an introduction to tartsandavarietyoffillings.SouthKamloopsSec.School-LowerCampus»Mar2 6:00-8:00PM Mon 235088
Italian Cooking Parent $40 1st Child fRee
8 yrs +Family members will learn to cook together while preparing basic and traditional Italian recipes that the whole family will enjoy SouthKamloopsSec.School-LowerCampus»Mar5 6:00-8:00PM Thu 235089
DanCInGbelly Dance for fun fReeModelling healthy activities is thebest way to teach our children Join us for this fun, one-day, motheranddaughterclass.Learnthebasicmovementofbellydancing,includingwarm-up, isolations, technique,combinations, and cooldown. Opentoalllevels.TCC-TournamentCapitalCentre»Jan25 1:30-2:30PM Sun 235436
Play anD leaRnDallas Play Group fReeThis is a play group for parents and children under five years old.Comeoutandsocializewithfamiliesfrom dallas and Barnhartvale. Theplay group runs in conjunction with school days Parent participation is required.dallasElem.School»Jan5-Mar9 9:00-11:00AM Mon 230234
sPoRTsfamily sports night $40Joinus for familynight,where youcan play a variety of sports andgames Get some exercise and enjoy fun family time!WestsydeNeighbourhoodCentre»Jan16-Feb6 6:30-8:00PM Fri
family
Did you know
![Page 36: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/36.jpg)
34
family
FamilydayFestivalandGranFondoisonSunday,February 15 at the Tournament
CapitalCentre.Comeandenjoythefestivities! More info: www.kamloopsgranfondo.ca
Save the DateBenefits of Volunteerig
Career exploration - Volunteering can be an excellent way to learn more about a particular career possibilities Personal Growth - Lifelonglearningincludeshands-onexperiencesasavolunteercanteach you about issues such as environmentaltopublichealthtoanimal welfare socialize - Volunteering can be afun,meaningfulwaytomakenew friends and get to know others who care about the same things you do Have an Impact - Whateveryourpassion,howeveryougetinvolved,volunteeringoffersawaytohavearealandlastingimpact for you and your community
Volunteer Highlightaiden Henderson age 13Aidenhasalovefortheatre,whichleadhimtovolunteerwithX-Fest2014 Volunteering with ProjectXgavehimtheopportunity to connect with professional actors and expand his knowledge ofwhatisinvolvedinproducing a three week outdoor theatre production Aidenalsovolunteersathisschool,BeattieSchooloftheArtsandheisanavidhat collector
Matt,Anna,Nico(4years)andSkyla(1year)enjoydancing,swimming,soccer,bikeriding,andhikingvarioustrailsinKamloopsincluding Kenna Cartwright Park They enjoy 4 seasons weather and like the friendly people they meet when participating in recreational activities.(Annahasbeeninstructingchildren’sdanceprogramswiththe city since 2010)
Active Family
abC family literacy Day:Saturday,January31st from9:00am-12:30pmattheHenryGrubeEdcuation
Centre Kamloops families come together to spend quality timewitheachotherenjoyingcrafts,activitiesand
entertainment from many local talents for more information, phone 250-554-3137 ext. 582
abC family literacy Day
family Day festival & Grand fondo
![Page 37: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/37.jpg)
35kamloops.ca/recreation 250.828.3500
family
Save the Date
![Page 38: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/38.jpg)
36
AdultGET WINTERACTIVE
Whilethewintermonthsmayseemliketheperfecttimetocurlup,hibernateandenjoythepleasureofourinhomeelectronics,weencourageyoutotrysomethingdifferentthisyear!Whynotchallengeyourselfto put down the electronics and enjoy some time beinginteractivewithyoursurroundingswithoutthedistractions!
Leavethephoneathome(oratleastinthecar)andtakeasnowyhikewithfriends,tryanewactivitylikecrosscountryskiing,orsimplyruleonedayaweekasadigitaldetox day with the intent of banishing your electronics for thebenefitsofinteractingwithothers.
WhileyoumayfeelmoreconnectedtoothersbyregularlycheckingyouremailandupdatingyourFacebookstatus,research shows that technology addiction is a real concernandcanleadtofeelingsofisolation.Socheckinwithyourself,andhaveagoodlookatyourtechhabits.
Wechallengeyoutodigitally detoxthiswinter,andgetWinteractivewithyourenvironment!
Did you know?TheKamloopsMuseum&Archiveshasanactivecollectionpolicy.Weareinterestedinobjectsthathelp us to tell the story of Kamloops to our many visitors.Ifyouhaveauniqueobjectthatyouwould
liketoseeinthemuseum,giveusacall.
![Page 39: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/39.jpg)
37kamloops.ca/recreation 250.828.3500
fITness In MoTIon20-20-20 $63 Getajumponyourfitnessgoalswith this perfectly balanced routine: 20minutesofcardio,20minutesofstrength,and20minutesofcore!Thiscalorie-blastingworkoutwillhaveyoutoningandsculptingyour muscles while building your endurance TCC-TournamentCapitalCentre»Jan13-Mar10 5:15-6:15PM Tue 234893
aqua express Circuit $63Get the best of both worlds with this high-intensity, interval-style class.Work your aerobic and anaerobicsystems using circuit training in a non-impact environment. Travelfromstationtostationusingnoodles,weights,andyourownbodyweightfor exciting and challenging exercises while using elements of water running forrecovery.
Canada Games Aquatic Centre»Jan15-Mar12 6:30-7:30AM Thu 234882
back to basics $80Learn the basics of strength
trainingwithaprogressiveprogramgeared towards beginner exercisers andactive agers. This programwillstart in thefitnessstudioandworkintoafull-bodyprograminthegym.At theendofeightweeks,youwillhavetheconfidencetocompletetheprogram on your own
TCC-TournamentCapitalCentre»Jan12-Mar9 10:00-11:00AM Mon 234892
beginner boot Camp $63Are you looking for a great, full-body workout to shake up your fitness routine? This beginner-friendly interval class will combinestrength and cardio drills to get your heart pumping! Enjoy longer rest breaks while experimenting with newequipmentsuchasBOSU®andmedicineballstoaddvarietytoyourworkout!!
WestsydeNeighbourhoodCentre»Jan13-Mar10 6:00-7:00PM Tue 233884
bootcamp $64 18 yrs +
Are you looking to take your exercise routinetothenextlevelwithaheart-pumping,leg-burningworkout?Eachclass will incorporate a different mode oftraining,ensuringadynamic,full-body workout every time, resultinginahealthier,leanerbody.
TCC-TournamentCapitalCentre»Jan12-Mar9 5:30-6:30PM Mon 234894
»Jan14-Mar11 5:30-6:30PM Wed 234895
HIIT - High Intensity Interval Training 18 yrs +Using tabata-style intervals (highintensity training followed by a short rest),youwillblastyourentirebodyforachallengingandrewardingfull-body workout Come prepared to sweatwiththisfast-pacedclass.
TCC-TournamentCapitalCentre $49»Jan14-Mar11 6:00-7:00AM Wed 233886
$47.25»Jan15-Mar12 5:15-6:00PM Thu 233887
WestsydeNeighbourhoodCentre$63
»Jan15-Mar12 6:00-7:00PM Thu 233888
Interval fit Circuit $56Get a great workout, circuit style!This class is a fun, time-efficient,total body workout that combines strength,cardio,core,andflexibilitytrainingusingintervalstationsandavarietyofequipment.
WestsydeCommunityCentre»Jan12-Mar9 6:00-7:00PM Mon 235172
low Intensity Circuit This total body workout is a
circuit-styleclassthatcombinescardiowithcore,flexibility,andstrength training This introductory class is designed for you to work at yourownindividualfitnesslevel.WestsydeCommunityCentre $84»Jan12-Mar9 9:00-10:30AM Mon 235178
$94.50»Jan14-Mar11 9:00-10:30AM Wed 235179
$94.50»Jan16-Mar13 9:00-10:30AM Fri 235180
Power Hour $63Areyou looking forahigh-intensityworkout that includes strength,cardio, and intervals? Ramp upyourmetabolismandfitnessusingavarietyof traditionaland innovativefitnesstechniques.Useballs,bands,BOSU® balls, and weights forstrengthwork,andmixintraditionalaerobics to get your heart pumping Join us for an hour of power!
WestsydeNeighbourhoodCentre»Jan14-Mar11 5:45-6:45PM Wed 233891
adult
Did you know?Drop-in Fitness Classes
Lookingforadrop-infitnessclasses?Seepages48-49forValue Added Fitness Classes
(free to TCC members)
![Page 40: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/40.jpg)
38
Runners’ Core and flexibility $56Get on the right track for an injury-free season with this class,which focuses on the unique needs of runners.Combinecoreandflexibilityto increase muscle strength while increasing efficiency and promotingmuscle recovery. Join us for yourbest running season yet!
TCC-TournamentCapitalCentre»Jan12-Mar9 6:30-7:30PM Mon 235232
sun Run Walk/Run Clinic $142Get started on a healthy, activelifestylefortheNewYear.SportMedBCand the Cityinvite walkers, novicerunners, and nordic walkers to theInTrainingprogram,whichculminateswiththeVancouverSunRuninApril!Usingagraduatedtrainingprogram,you will be guided through the basics of starting an exercise program Topics covered include footwear,clothing,nutrition,hydration, injuryprevention, and cross-training.Program fee includes an InTraining T-shirt,atraininglogbook,registrationfortheVancouverSunRun,aneventT-shirt,andlotsofexpertadviceandgroup support
Heritage House»Jan17-Apr11 8:30-11:00AM Sat 233382
Water Running $63doyoulovetorun,areyoulookingforsomecross-training,ordoyouhavean injury? This deepwater runningworkoutwillusesimilartoolstoland-based running, including pickupsand drills, to increase your fitnessin a low-impact environment.Workat your own pace for a great way to build your running base without the repetitiveimpactofrunning!
Canada Games Aquatic Centre»Jan13-Mar10 6:30-7:30AM Tue 235235
Weight Room fRee orientationsAreyounewtotheweightroom?doyouhavequestionsabouthowtousethecardioandstrengthequipment?Join one of our certified fitnessprofessionals to learn how to use theequipmentsafelyandeffectively.You will be shown proper technique for various machines and cardioequipment
WestsydeCommunityCentre»Jan14 6:00-7:00PM Wed 235257
»Feb4 6:00-7:00PM Wed 235258
»Feb25 6:00-7:00PM Wed 235259
»Mar11 6:00-7:00PM Wed 235260
ZUMba® 18 yrs +Come join the dance sensation! Zumba® is a fusion of Latin andinternational music that creates a dynamic, exciting, effective fitnesssystem! The dance routines feature aerobic/fitness interval trainingwith a combination of fast and slow rhythms that will tone and sculpt the body
Yacht Club $64»Jan12-Mar9 5:30-6:30PM Mon 235297
TCC-TournamentCapitalCentre $72»Jan14-Mar11 6:30-7:30PM Wed 235298
Hal Rogers $72»Jan15-Mar12 5:30-6:30PM Thu 235299
IfyouhavebeenoutinWestsydelatelyyoumayhavenoticedchangestotheformerWestsydeElementarySchool.TheCityofKamloops is pleased to welcome theWestsydeNeighbourhoodCentre,locatedat3550WestsydeRoad.
Thismulti-usefacilityincludesavarietyofprogramsandservicestofurtherservetheneedsoftheWestsyde,Bachelor Heights and North Kamloops populations
look for winter programs including:
- fitness classes
- yoga classes
- sport Programs for Tots
- Drop In table tennis
- family sport nights
- and much more!
You will also notice improvementstotheWestsydeCommunityCentre(located at 859 Bebek Road) Withanexpandedworkoutarea,andadedicatedstrength room there is somethingforeveryone!
Whetheryouarelookingfora great cardio or strength workout,circuitstyleclasses,aquafitorswimlessonslooknofurtherthantheWestsydeCommunity Centre
Westsyde Neighbourhood
Centre
adult
Did you know?Allofourfitnessclassareratedaseitherbeginner,intermediateor
advanced?Seepg.48-50forindividualcourselevels.
![Page 41: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/41.jpg)
39kamloops.ca/recreation 250.828.3500
adult
Canada’s Tournament Capital
Kamloops IndoorGranFondo & Family Day Festival!SUNDAY, FEBRUARY 8TH at TCC! 10 AM – 4 PM
EVENT RELATED INQUIRIES: ALEX DE [email protected] • 250-828-3828
GRANFONDO FUNDRAISER: TRINA [email protected] • 250.314.0773
FREE ACTIVITIES FOR THE WHOLE FAMILY!Come enjoy Kamloops’ biggest Family Day celebration
with PacificSport Kidzone Activities, Tots Bike Parade, and a free swim at Canada Games Pool from 1-4 pm!
Interested in cycling and taking part in the MS Society Fundraiser?
FOR MORE INFORMATION VISIT
WWW.KAMLOOPSGRANFONDO.CA
![Page 42: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/42.jpg)
40
sPInDrills and Hills $63discover indoor cycling with thismotivating workout. This class willinclude a variety of intervals andcycling drills that are guaranteed to challengeyourcurrentfitness level.Workatyourown intensitythroughhill climbs, speed intervals, andactiverecovery!
TCC-TournamentCapitalCentre»Jan13-Mar10 9:00-10:00AM Tue 235305
»Jan14-Mar116:15-7:15PM Wed 235306
»Jan15-Mar12 9:00-10:00AM Thu 235307
High Intensity spin $42Push your limits with this high-intensity spin class designed to increaseyourcardiovascularcapacityand improve your performance.Whetheryouareaweekendwarrior,fitness enthusiast, or just enjoy achallengingworkout,thisclassisforyou. The use of a variety of high-intensity intervals is guaranteed tomakeyousweatwhileyou improveyour strength and power!
TCC-TournamentCapitalCentre»Jan12-Mar9 6:15-7:00AM Mon 235313
simply spin $17.50This 30-minute, entry-level, indoorcycling class will introduce the basic techniques of spinning indoors Learnthe‘howtos’ofindoorcycling,includingbikeset-up,ridingpositions,and drills This class is designed to build confidence and fitness usingsimple drills to prepare you for longer classesinthefuture.*Pleasenote-theWednesdayclassisnotKeeponMoving(KOM)designated.
TCC-TournamentCapitalCentre»Jan13-Feb10 10:00-10:30AM Tue 235315
»Jan14-Feb11 5:15-5:45PM Wed 235316
simply spin and beyond! $21Building on the foundation of SimplySpin,thisclassgoesbeyondthe basics and introduces longer intervals.Learnhow tocomfortablyuse the gears and explore different riding positions on the bike to work at your own intensity for a quality workout! Geared towards the beginner exerciser, this classis a great way to test out a longer class before adding in the intensity of drills and Hills. *Please note -theWednesdayclassisnotKeeponMoving(KOM)designated.
TCC-TournamentCapitalCentre»Feb17-Mar1010:00-10:45AM Tue
235317
»Feb18-Mar11 5:15-6:00PM Wed 235318
spin fusion $94.50 18 yrs +
Enjoy 50 minutes of intense cardio on thespinbike,followedby20minutesofcoreandabwork fora full-bodyworkout.Wrapuptheclasswith20minutes of stretching to balance out the body
TCC-TournamentCapitalCentre»Jan13-Mar10 7:30-9:00PM Tue 235319
spin it, then HIIT it! $94.50 18 yrs +
Join us for 50 minutes of high intensityspin,followedby25minutesof tabata-inspired high intensityintervals! Wrap up this great classwith a relaxing 15 minute stretch
TCC-TournamentCapitalCentre»Jan15-Mar12 7:30-9:00PM Thu 235321
spin to Win 18 yrs +Are you looking for a challenging interval spin class? This class willprogress from week to week in both intensity and interval times. It willcombine drills with speed intervalsand hill climbing alternated with activerecovery.Thisisagreatclassto enhance your current riding,get you ready forwinter sports, orsupplement your current fitnessprogram
TCC-TournamentCapitalCentre $70»Jan12-Mar9 4:30-5:45PM Mon 235322
$94.50»Jan15-Mar12 6:00-7:30AM Thu 235323
adult
Save the Date?didyouknowthatJune6,2015marksthe3rdAnnualNationalHealthandFitnessday?MarkyourcalendarsandwatchformoredetailstocomeintheSpring/SummerActivityGuide!Areyouabusinessinterestedinparticipating?Contactfitness@kamloops.catoseehowyoucan getinvolved.
![Page 43: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/43.jpg)
41kamloops.ca/recreation 250.828.3500
yoga spin $96Join us for 45 minutes of high-intensity spin, combining differentintensities and drills for a hard workout Finish off with 45 minutes ofyoga, includingaseriesofposeswoventogetherwithbreathtoquietthemindandbuildstrength,balance,focus,andflexibility.
TCC-TournamentCapitalCentre»Jan12-Mar9 7:00-8:30PM Mon 235325
yoGabeginner yoga Bypractisingsimpleyogapostures,breathing exercises, and easymovements, youwill build strengthand flexibility and improve yourposture in a relaxed atmosphere Learnacompleterangeofbasicposesinthisnon-intimidatingenvironment.Modificationswillbeprovidedtohelpyougetthemostoutofeachclass,no matter your fitness level. Noexperience is necessary
TCC-TournamentCapitalCentre $64»Jan12-Mar9 5:15-6:15PM Mon 235328
$72»Jan14-Mar11 7:45-8:45PM Wed 235329
ValleyviewCommunityHall $64»Jan12-Mar9 6:00-7:00PM Mon 235330
WestsydeNeighbourhoodCentre $72»Jan13-Mar10 9:00-10:00AM Tue 235332
$108»Jan14-Mar11 7:00-8:30PM Wed 235333
$72»Jan15-Mar12 9:00-10:00AM Thu 235334
Intermediate yoga $96Yoga is an Eastern approach to a full body/mind workout. If youhavebeenpractisingforoverayearconsistently and would like to deepen yourunderstandingand loveof theyogapostures, breathing exercises,and meditation, then this class isfor you! You will practise a varietyof poses and enjoy powerful yogic techniquesforimprovedenergyandattitude!
WestsydeNeighbourhoodCentre»Jan12-Mar9 7:00-8:30PM Mon 235340
Power yoga $72Whether you are an athlete or aweekend warrior, improve yourstamina, strength, balance,flexibility,andcorewhileinvigoratingyour body! You will be exploring a variety of poses as well as flowingsequences while linking breath with movement.Pastyogaexperience isrecommendedas this class ishigh-intensity
TCC-TournamentCapitalCentre»Jan13-Mar10 6:30-7:30PM Tue 235343
yoga for Relaxation $72Relax your mind while experiencing the soothing meditative qualitiesof yoga by linking breath with movement.Thisclassexploresbasicyoga poses to promote a conscious mind/body relaxationwhileworkingto combat stress and fatigue Poses are held longer to achieve a deep,cleansing stretch for the muscles as well as the mind Each class will conclude with a peaceful, guidedrelaxation for a tranquil end to your day
Hal Rogers»Jan13-Mar10 7:15-8:15PM Tue 235350
ValleyviewCommunityHall»Jan15-Mar12 7:15-8:15PM Thu 235351
PRe anD PosT naTalaquanatal Exercise during pregnancy can help you to prepare physically and psychologically for the demands of labourandchildbirth.Joinacertifiedinstructor to experience safe and weightless exercise By using the natural buoyancy of thewater, youwillstrengthenyourcoreandpelvicmuscles without straining your joints and ligaments Enjoy a beautiful feeling of weightlessness while you experience the benefits of aquaticexercise
WestsydeCommunityCentre $40»Jan15-Feb12 6:30-7:30PM Thu 235352
$32»Feb19-Mar12 6:30-7:30PM Thu 235353
stroller fit - beginner outdoor/Indoor $56Enjoya safe, low-impact classwithyour baby or toddler in his/herstroller.Walkyourselfbackintoshapewithspeeddrills,squats,lunges,andstroller drags
TCC-TournamentCapitalCentre»Jan12-Mar9 1:00-2:00PM Mon 235354
TRaInInG & assessMenTsTrain smart Package $99 (90 minutes) This one-on-one personal trainingsession allows you to discuss your goals with a personal trainer while completinga30-minuteassessmentto establish your baseline fitnesslevel.Thesecond60-minutesessionis spent learning your personalizedfitness program to help yougain confidence in your exerciseprogram
234233
adult
Cancellation PolicyPersonal Training Refund Policy: 24 hour cancellation
notice required No refund or credit for unused sessions Valid for one year from the date of purchase
![Page 44: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/44.jpg)
42
Personal Training add-onsOnce you have completed a TrainSmartpackage,youcanaddadditional60-minutepersonaltrainingsessions.These appointments can be made at your convenience, whether youwould like to meet regularly to help with motivation or just when yourequire updates to your program
1 session $65234234,234235,234236
4 sessions $250234237,234238
12 sessions $690234239,234240
Train smart, with a friend! $320Put a fun twist on one-on-onepersonal training and bring a friend! This semi-private session packagewith a personal trainer will help build your motivation while addressingyourpersonalgoals.Thefirstsessionwillincludeanassessment,followedbythree60-minutesessionstogainconfidence in your new exerciseprogram
234241
Train smart assessment with a Kinesiologist $150If you have an injury, chroniccondition,orconcernsaboutthesafetyofexercise,thisprogramisdesignedforyou!Completeacomprehensivefitness assessment and exerciseprogram with a Kinesiologist. Withfocused education ranging from chronic disease to orthopaedics,working with a Kinesiologist will help you meet your fitness goals safelyand effectively (program includestwo 60-minute sessions). Contact250-828-3742forinformation.
235741
Train smart with a Kinesiologist add-ons These 60-minute sessions aredesigned with the client’s specificrehabilitation needs in mind Clients must first complete a Train Smartassessment with a Kinesiologist
4 sessions $280235742
8 sessions $540235743
12 sessions $780235745
sPoRTsCo-ed volleyball $55Allskill levelswillenjoyaneveningof recreational volleyball. This is agreatwaytokeepactive,havefun,and meet new people Beginners are welcome!
MarionSchillingElem.School»Jan13-Mar3 7:45-9:45PM Tue 233733
»Jan15-Mar5 7:45-9:45PM Thu 233734
Women only Competitive volleyball $70Competitive volleyball for womenonly! Players sign up individuallyand will be placed on teams at the first session. Previous volleyballexperience and an understanding of 6-2-5-1rotationsarerequired.
JuniperRidgeElem.School»Jan6-Mar10 6:30-9:30PM Tue 233735
floor Hockey - Co-ed $40If you are looking for ways to make new friends and have fun whilegetting fit, give floor hockey a try.Teams and game schedule will be created depending on the number of players Please bring your own floor hockey stick. Registration feeiswaivedforgoalieswiththeirownequipment
dufferinElem.School»Feb4-Mar11 6:30-8:00PM Wed 233732
learn to Play Co-ed Ice Hockey - beginner $72Learn skating skills, stick handling,and puck control techniques,and finish off the session with ascrimmage. Full gear and CSA-approvedhelmetarerequired.
InteriorSavingsCentre»Jan11-Feb1 11:00AM-12:30PM Sun 233737
learn to Play Co-ed Ice $80 Hockey - IntermediateEnhance your skills!With the focuson individual skill development andtherulesofthegame,thisprogramprovides a unique experience forall players Beginner program recommended Full gear required
MemorialArenaandInteriorSavingsCentre»Feb8-Mar8 11:00AM-12:30PM Sun 233738
adult
Wheelchair BasketballAgameofspeed,power,andagility,wheelchairbasketballisasportforallagesandabilities!startingJanuary8everyThursdayat7PM.drop-inswelcome!
Sportchairsprovided.
See page 11 for registration details.
Peter Mahaits
New
![Page 45: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/45.jpg)
43kamloops.ca/recreation 250.828.3500
adultTennis eZ Play - $65 beginnerThisfour-weekprogramprovidesanintroductiontotennisfundamentals,including basic technique and tactics The clinic is in partnership with the KamloopsTennisCentre.Ifrequired,racquets can be purchased at the Kamloops Tennis Centre
Kamloops Tennis Centre»Feb2-Mar2 6:30-8:00PM Mon 234876
Tennis eZ Play - $75 Intermediate This program is for players who have previous tennis experienceand understand basic positions in doubles You will learn ball control andpolishyourservingandvolleyingskills
Kamloops Tennis Centre»Mar9-30 6:30-8:00PM Mon 234877
DanCInG
belly Dance Workshop $90This program will introduce participantstothebasicmovementsof the sensual art of belly dance Workshop includes warm-up,isolations, technique, combinations,andcool-down.Workshop isgearedto beginners, but is open to alllevels.
BeattieSchooloftheArtsMcGillCampus»Jan14-Mar4 7:00-8:00PM Wed 235434
Introduction to $45 Hoop Dance This new form of dance, fitness,and self-expression is electrifying,inspiring people across the country and the around world! You will be introduced to a variety of basicmoves,and thenexplore tricksandtechniques that will expand your skills This beautiful performance art isafunworkoutforthemind,body,and soul. No previous experienceis necessary Practice hoops will be provided.
OldCourthouse»Feb5-19 6:30-7:30PM Thu 235592
Irish Dancing I $130 Reel fun A high-energy, fun class in whichdancers will learn the basics of soft shoe Irish dancing Dancers will develop grace, poise, and goodposture while learning the steps of the Beginner Reel and Beginner Jig. develop physical and mentalskills through listening and following instruction and aerobic exercise Some team dancing and ceilidhdancing will be introduced at the end of the course
SouthKamloopsSec.School»Jan8-Mar12 7:45-8:45PM Thu 234166
latin Dance $165 Couple $90 singleThe Cha Cha is one of the most popularofthesocialLatin-Americandances.Thelively‘one,two,chachacha’rhythmisflirtatious,andfullofpassion and energy. Everybody canlearn the Cha Cha!
SouthKamloopsSec.School»Jan12-Mar9 7:00-8:30PM Mon 235032
aRTs anD CUlTURearchives orientation $4 at the MuseumLearnallabouttheMaryBalfArchiveslocated in the Kamloops Museum& Archives. Join the archivist andexplore the collection, learn howto access resources and start researching your topic today
KamloopsMuseum&Archives»Jan31 10:00-11:30AM Sat 235532
Museum Guided Tour $4Join Kamloops Museum & Archivesstaff for a guided tour of all the latest exhibits, galleries, and displays.Gain a greater understanding and appreciation of Kamloops’ history,learnaboutthelivesoflocalpioneers,and hear some interesting stories
KamloopsMuseum&Archives»Feb12 12:00-1:00PM Thu 235541
»Mar14 3:00-4:00PM Sat 235542
How to Manage your Personal archives $4JointheKamloopsMuseumarchivistand learn all about preservingyour personal archival documents,familyphotographs,andmultimediamaterials. discover the basics ofarchival preservation and explorevarious options and resources forprotecting your personal treasures
KamloopsMuseum&Archives»Mar7 10:00-10:45AM Sat 235533
Peter MahaitsPeterhasbeenavolunteerattheKamloopsMuseum&Archivesforfiveyears.Peterdoesarchivalfilingand research and assists the museum curator As aretiredCNlocomotiveengineer,Peter’sknowledge of trains and railway equipment has beenveryvaluabletothemuseum
New
![Page 46: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/46.jpg)
44
Creative Writing $125 WorkshopThis interactive course incorporatesthe generating of ideas, plotdevelopment,useofthefivesenses,pace,setting,andediting,allleadingto the writing of short stories There will be several stress-freewriting activities per session in asupportive atmosphere. The courseisappropriateforthosewritingfictionandnon-fiction.
SouthKamloopsSec.School»Jan26-Mar2 7:00-9:00PM Mon 235438
face Painting - $50 beginners This workshop offers tips on how to face paint Face painting can bring out the artist in anyone! Fee includes a facepainting kit ParkviewActivityCentre»Mar10 6:30-8:30PM Tue 233882
face Painting - $60 advanced Learn how to face paint like aprofessional with appropriate products and tools. If you havepreviousexperienceorattendedtheFace Painting - Beginnerworkshop,thisworkshopisforyou.Mustbringyour own facepainting supplies
ParkviewActivityCentre»Mar31 6:30-8:30PM Tue 233883
Guitar - level 1 $90Have you always wanted to playtheguitar, butnevergot around toactually starting? In this fun, non-intimidating setting, you will learnthe very basics of playing guitar,includingidentificationofthepartsofthe guitar and learning some chords and simple melodies
NorkamSec.School»Jan21-Mar11 6:45-7:45PM Wed 235548
Guitar - level 2 $90This program is intended for beginners who have had a smallamount of experience on the guitar and would like to learn a bit more Participants should feel comfortable playing a few chords prior to taking this class You will learn some basic chord progressions, a scale, anda song, as well as explore finger-picking techniques
NorkamSec.School»Jan21-Mar11 8:00-9:00PM Wed 235549
Knit Circle fReeKnitters of all ages and skill levelsare invited to spend time togetherknitting and chatting about their projects. Bring your own yarn,needles,scissors,andsupplies.
Heritage House»Jan14-Mar25 6:30-8:30PM Wed 235554
Photography - Intro $30 to Digital PhotographyIntended for new users of digital cameras or for anyone considering a new digital camera, this sessionwill address such topics as digital photography vs. film, megapixels,and what to look for in a digital camera.Wewilllookatvarioustypesofdigital cameras,postprocessing,and storage
SahaliSec.School»Jan6 7:00-8:30PM Tue 234786
Photography - Posing Women $150Learn how to pose your subject inways that will make your client fall in love with themselves. The keyto selling images is in making the subject feel beautiful In this full day class, wewill explore the secret tocreating the hourglass shape and posing subjects inways that flattertheir body type
ExposurePhotoStudio»Jan10 10:00AM-3:00PM Sat 235633
Photography - Composition $40Intended for those people who want to take their photos beyond the snap shotlevel.Joinanexperiencedlocalphotographer to examine easily applied composition techniques used by the pros to produce those special photos These techniques can be applied immediately and used with any type of camera Cameras are required Tripods recommended
SahaliSec.School»Jan13 7:00-9:00PM Tue 234986
Photography - beyond $85 Point and shoot Learn to be more creative withyour camera andmove beyond themanufacturer’s settings Each of the threeclassesisastand-alonetopic,so you can register separately or sign upforallthree.Learnaboutapertureand depth of field, shutter speed,and low light photography Each classisastandalonetopic,andyoucan register separately for specifictopics Cameras required and tripods strongly recommended
SahaliSec.School»Jan20-Feb3 7:00-9:00PM Tue 234787
Photography - aperture and Depth of field $40In thisBeyondPoint&Shootclass,learntobemorecreativewithyourphotos! discover how to produceimages that highlight subjects while blurring background and foreground clutter These skills are particularly usefulwhenphotographingportraits,flowers,pets,andwildlife.
SahaliSec.School»Jan20 7:00-9:00PM Tue 234789
adult
Register Now!
New
![Page 47: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/47.jpg)
45kamloops.ca/recreation 250.828.3500
SchedulesJoinustotryover15fitnessclassesthatrangefrombeginnertoadvanced.ClassesarefreetoTCCmemberswithamonthlyorannualpass*.
Attendatleastoneclassthroughouttheweektobeeligibletowinafree13weekfitnessclassintheSpringof2015.
Entries available at the Tournament Capital Centre (Wellness Centre) beginning January 5, 2015
*Notamember?Noproblem,purchaseadropinfitnesspassbeforethestartofyourclass. **Limitedtothefirst19participants.
Mini Fitness Session “Try before you buy!”
MonDay, JanUaRy 5 TUesDay, JanUaRy 6 WeDnesDay, JanUaRy 7 THURsDay, JanUaRy 8 fRIDay, JanUaRy 9
High Intensity spin**6:15-7:00AMSpinStudio
High Intensity Interval Training (HIIT)6:00-7:00AMNorth Court
Gentle Circuit8:00-9:00AMFieldhouse
Gentle Circuit8:00-9:00AMFieldhouse
Gentle Circuit9:00-10:00AMFieldhouse
Drills & Hills**9:00-10:00AMSpinStudio
Gentle Circuit9:00-10:00AMFieldhouse
Gentle Circuit9:00-10:00AMFieldhouse
iflow Challenge12:10-12:55PMFitnessStudio
Drills and Hills**12:10-12:55PMSpinStudio
Core strength12:10-12:55PMFitnessStudio
Drills and Hills**12:10-12:55PMSpinStudio
High Intensity Interval Training (HIIT)12:10-12:55PMFitnessStudio.
Runner’s Core and flexiblity6:30-7:30PMFitnessStudio
Gentle Touch yoga1:00-2:00PMFitnessStudio
Zumba6:30-7:30PMFitnessStudio
High Intensity Interval Training (HIIT)5:15-6:00PMFitnessStudio
![Page 48: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/48.jpg)
46
admission Policy: Children 6 years of age or under must always be accompanied in the water and be within arm’s length of a parent or other person 16 years of age or older Ratio of children6yearsorundertoparent/guardianmustbenogreaterthanthreetoone.
Diving boards: Childrenmustbe7yearsofageoroldertousethe3mor5mdivingboards.
Hot Tub, steam Room, and sauna: Children 12 years of age and under must be accompanied by a parent or guardian (16 years or older)
Waterslides: Childrenunder42in.(1.07m)inheightarenotpermittedonthewaterslide.Children6yearsofageandunderwhomeettheheightrestrictionmustbecloselysupervisedbyanadult.Singleridersonly-nochainsormultipleridersallowed,includingparentswithchildren.Seeposted“WaterSlideRules”forfulldetails.
Wellness Centre and Weight Room: Youthages12-17mustcompleteanorientationpriortousingtheweightroom.Uponcompletionofanorientation,youthages12-14MUSTbedirectlysupervisedbyapayingadult.dryshirts,shorts,andclose-toedshoesarerequired.
ViewourCodeofConductandHealthandSafetyRulesatwww.kamloops.ca/swim.
our goal is to promote a safe and positive swim. Please review with all posted safety rules and report to a lifeguard if you need assistance.
• All persons who are not toilet trained MUST wear a swim diaper.
IMPoRTanT safeTy InfoRMaTIon
CanaDa GaMes aQUaTIC CenTRe
CanaDa GaMes Pool fees effective Jan 1, 2014-Dec 31, 2015
*25mlaplanesunlessotherwisenoted.•*Poolspacemaybelimitedduringlessontimes•Poolcloseddec12-14(swimmeet)Visitkamloops.ca/swimforChristmasschedule(dec20-Jan4)•Schedulesubjecttochange.
schedules
910McGillRoad effective January 5-March 13, 2015 250-828-3655
MonDay TUesDay WeDnesDay THURsDay fRIDay saTURDay sUnDayPoolOpenLapandLeisure*
6am-11pm(50m6-8am) 6am-11pm 6am-11pm
(50m6-8am) 6am-11pm 6am-11pm(50m6-8am) 8:30am-9pm 7:30am-9pm
Waterslide 6:30-9pm 6:30-9pm 6:30-9pm 6:30-9pm 6:30-9pm 1-4pm6-9pm
1-4pm6-9pm
divingBoardsand Deep End 7:30-9pm 7:30-9pm 7:30-9pm 7:30-9pm 6:30-9pm 1-4pm
6-9pm1-4pm6-9pm
Sauna,SteamRoom,andHotTubs
6am-11pm 6am-11pm 6am-11pm 6am-11pm 6am-11pm 7:30am-9pm 7:30am-9pm
Swimming Lessons*
9-11:30am3-7:30pm
9-11:30am3-7:30pm
9-11:30am3-7:30pm
9-11:30am3-7:30pm 3-6:30pm 8:30-11:30am
3-7pm8:30-11:30am
3-7pm
Aquafitness(Deep) 9-10am 9-10am 9-10am 9-10am 9-10am
Aquafitness(Aqualite) 11am-12pm 11am-12pm
KCSMasters Swimming 6:30-7:30pm 6:30-7:30pm 6-7am
sInGleaDMIssIon
PUnCH CaRD (10 aDMIssIons)
PUnCH CaRD (40 aDMIssIons)
Toddler(0-3) fRee!
Child(4-13) $3.75 $31 $114
Youth(14-18) $5.25 $45 $160
Adult(19-59) $7 $60 $208
Senior(60+) $5.25 $45 $160
Familydrop-in $3.75each(max$16) n/a $114
(1 punch per person)
sPeCIal RaTes•EarlyBirdandNightOwl:$3.75-firstandlasthour,MondaytoFridayonly.•LiquidLunch:$3.75-11:30am-12:30pm,MondaytoFridayonly.•LessonRate:$3.75-EnjoyaswimorsoakinthehottubwhileyourchildisinaCityofKamloopsswimlesson.oTHeR aDMIssIon InfoRMaTIon•Afamilyisamaximumoftwoadultsandallchildrenaged18yearsandunderwhoarerelatedbybirth,legalstatus,ormarriageandlivingwithinthesameresidence.Alegally
dependent person with a disability will qualify regardless of age Please note that the family punch card can only be used for adult admission when swimming with an eligible child or a legally dependent person with a disability •
•Patronswithadisabilitypaytheagerateandtheircareaideisadmittedforfree.
![Page 49: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/49.jpg)
47kamloops.ca/recreation 250.828.3500
WesTsyDe Pool anD CoMMUnITy CenTRe
*Allfeaturesavailable.Somepoolfeaturesopen.¤OnlyavailableOct4-dec13.†Poolspacemaybelimitedduringlessontimes.Visitwww.kamloops.ca/swimfortheweeklyWackyWednesdayeventthemeandtheChristmasschedule(dec20-Jan4).
Schedulesubjecttochange.Weightroommaybeoccasionallyunavailabletoaccommodatelandfitnessclasses.
WesTsyDe Pool fees effective Jan 1, 2014-Dec 31, 2015
Make Your Next PartY a SPlaSh!
schedules
We offer a variety of formats, times and days to guarantee fun!
Ask about our swim pass goody bag stuffers!Visit kamloops.ca/swim for pool party details.
859 Bebek Road effective January 5-March 13, 2015 250-828-3616
MonDay TUesDay WeDnesDay THURsDay fRIDay saTURDay sUnDayEveryoneWelcomePublicSwim* 6:30pm-8pm 6:30pm-8pm
WackyWednesday 6:30pm-8pm 1-4pm 1-4pm
EveryoneWelcomeLeisureSwim
12:30-2pm3-6:30pm
2-5:30pm6:30-8pm
12:30-2pm3-6:30pm
2-5:30pm6:30-8pm
12:30-2pm3-6:30pm 9:30am-1pm*
LapSwim 6-10:30am12:30-6:30pm
2-5:30pm6:30-8pm
6-10:30am12:30-6:30pm
2-5:30pm6:30-8pm
6-10:30am12:30-6:30pm 9:30am-1pm*
Sauna,SteamRoom,and Hot Tub
6-10:30am12:30-8pm
2-5:30pm6:30-8pm
6-10:30am12:30-8pm
2-5:30pm6:30-8pm
6-10:30am12:30-8pm
9:30am-1pm*1-4pm 1-4pm
SwimmingLessons† 3-6:30pm 3-7pm 3-6:30pm 3-7pm 3-6:30pm 9:30am-1pm
Aquafitness(Shallow) 9-10am 9-10am 9-10am
Aqualite 2-3pm 2-3pm 2-3pm
Aquafitness (Deep) 5:30-6:30pm 5:30-6:30pm
WeightRoom 6am-8pm 6am-8pm 6am-8pm 6am-8pm 6am-8pm 9:30am-1pm*1-4pm¤ 1-4pm
sInGleaDMIssIon
PUnCH CaRD (14 aDMIssIons)
PUnCH CaRD (40 aDMIssIons)
one MonTHPass
Toddler(0-3) fRee!
Child(4-13) $3.25 $37.50 $96 $26
Youth(14-18) $3.75 $45 $115 $32
Adult(19-59) $5 $61 $155 $45
Senior(60+) $3.75 $45 $115 $32
Family* $3.25each(max$13) $37.50(1punchperperson) $96(1punch
per person) n/a
WeightRoomOnly $3.75 $45 $115 $32
sPeCIal RaTes anD oTHeR aDMIssIon Info•TalktoaCustomerRelationsRepresentativeformoreinformationonswimpasses.•LessonRate:$3.25-EnjoyaswimorhottubwhileyourchildisinaCityofKamloopsswimlesson.•Afamilyisamaximumoftwoadultsandallchildrenunder18yearsofagewhoarerelatedbybirth,legalstatus,ormarriage.
A legally dependent person with a disability will qualify regardless of age •Patronswithadisabilitypaytheagerateandtheircareaideisadmittedforfree.
![Page 50: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/50.jpg)
48
Tournament Capital Centrefitness schedule Winter 2015
Formoreclassinformationandcoursecodes,seepages37to58orvisitwww.kamloops.ca/ezreg.*GentleCircuitparticipantsarerequiredtopurchaseatrackpass.Patronswithoutatrackpasswillbesubjecttoregularfitnessdrop-infees.**ValueaddedclassesarefreetoTCCpassholders(monthlyandannual).Patronswithoutamembershipwillbesubjecttoregularfitnessdrop-infees.Pleasenote:unlessotherwiseindicated,theagepolicyonallfitnessclassesrequiresparticipants(registeredordrop-in)tobe13yearsorolderatthetime of participation Instructors and classes are subject to change without notice
LEGENd
= Mild/all levels - For beginners or those returning to exercise after an extended absence These classes are gentle on the joints with low to no impact
= Intermediate -Forindividualswhoarecurrentlyexercisingandarelookingforamorechallengingclass. Theseclassesmayfeatureintervals,strengthtraining,andmoreadvancedexercises.
= advanced -Forexperiencedexerciserswhoarelookingforahighintensityclasswithadvancedexercisetechnique. Theseclassesmayincludehighintensityintervals,cardiovascularcomponentsandstrengthtraining.
REGISTERTOdAYBYCALLING250-828-3500
Register now!
Oops! We cancelled it ...…becausewedidn’tknowyouwantedit!
Weencourageyoutoregisteratleastoneweekprior to class so we can reduce class cancellations
schedules
MonDay TUesDay WeDnesDay THURsDay fRIDay
MoR
nInG
HighIntensitySpin6:15-7:00am
WaterRunning6:30-7:30am
HIIT (High Intensity IntervalTraining) 6:00-7:00am
SpintoWin6:00-7:30am
Gentle Circuit 8:00-9:00am*drop-in
Aqua Express Circuit
6:30-7:30am
Drills and Hills 9:00-10:00am
Tai Chi (Beginner) 8:30-9:30am
Gentle Circuit 8:00-9:00am*drop-in
Gentle Circuit 9:00-10:00am*drop-in
Osteofit19:45-10:45am
Gentle Circuit 9:00-10:00am*drop-in
Gentle Circuit 9:00-10:00am*drop-in
SimplySpin10:00-10:30am
Tai Chi (Intermediate) 9:45-10:45am
Drills and Hills 9:00-10:00am
SimplySpinandBeyond! 10:00-10:45am
(Feb 17)
Osteofit19:45-10:45am
Back to Basics 10:00-11:00am
Osteo211:00am-12:00pm
SensationalSurvivors
11:00am-12:00pm
Osteofit2 11:00am-12:00pm
![Page 51: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/51.jpg)
49kamloops.ca/recreation 250.828.3500
Tournament Capital Centrefitness schedule Winter 2015
TCC Annual Full Facility pass holders enjoy a 50% discount on most TCC and Westsyde fitness classes.only available when registering by phone or in person.
REGISTERTOdAYBYCALLING250-828-3500
schedules
MonDay TUesDay WeDnesDay THURsDay fRIDay
afTe
Rnoo
n
iFlow Challenge 12:10-12:55pm**Value Added
Drills and Hills 12:10-12:55pm**Value Added
CoreStrength12:10-12:55pm**Value Added
Drills and Hills 12:10-12:55pm**Value Added
HITT-HighIntensityIntervalTraining12:10-12:55pm** Value Added
StrollerFit1:00-2:00pm
Gentle Touch Yoga 1:00-2:00pm
Aquatic Gentle Fit 2:00-3:00pm
Aquatic Gentle Fit 2:00-3:00pm
Aquatic Gentle Fit 2:00-3:00pm
SensationalSurvivors 2:00-3:00pm
SpintoWin 4:30-5:45pm
even
InG
Beginner Yoga 5:15-6:15pm
20/20/205:15-6:15pm
SimplySpin5:15-5:45pm
HITT-HighIntensityIntervalTraining5:15-6:00pm
Boot Camp 5:30-6:30pm
SimplySpin&Beyond5:15-6:00pm
(Feb 18)
Boot Camp 5:30-6:30pm
Runners' Core and Flexibility6:30-7:30pm
Power Yoga 6:30-7:30pm
Drills and Hills 6:15-7:15pm
YogaSpin7:00-8:30pm
SpinFusion7:30-9:00pm
ZUMBA® 6:30-7:30pm
SpinitthenHIITit!7:30-9:00pm
Beginner Yoga 7:45-8:45pm
![Page 52: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/52.jpg)
50
Community-based fitness schedule Winter 2015
Westsyde fitness schedule Winter 2015REGISTERTOdAYBYCALLING250-828-3500
REGISTERTOdAYBYCALLING250-828-3500
Formoreclassinformationandcoursecodes,seepages37to58orvisitwww.kamloops.ca/ezregPleasenote:unlessotherwiseindicated,theagepolicyonallfitnessclassesrequiresparticipants(registeredordrop-in)tobe13yearsorolderatthetimeofparticipation.Instructors and classes are subject to change without notice
LEGENd
= Mild/all levels - For beginners or those returning to exercise after an extended absence These classes are gentle on the joints with low to no impact
= Intermediate - Forindividualswhoarecurrentlyexercisingandarelookingforamorechallengingclass. Theseclassesmayfeatureintervals,strengthtraining,andmoreadvancedexercises.
= advanced -Forexperiencedexerciserswhoarelookingforahighintensityclasswithadvancedexercisetechnique. Theseclassesmayincludehighintensityintervals,cardiovascularcomponentsandstrengthtraining.
TCC Annual Full Facility pass holders enjoy a 50% discount on most TCC and Westsyde fitness classes.only available when registering by phone or in person.
schedules
MonDay TUesDay WeDnesDay THURsDay fRIDay
MoRnInG
Beginner Yoga 9:00-10:00am
WestsydeNeighbourhoodCentre
Beginner Yoga 9:00-10:00am
WestsydeNeighbourhoodCentre
LowIntensityCircuit9:00-10:30am
WestsydeComm.Centre
LowIntensityCircuit9:00-10:30am
WestsydeComm.Centre
LowIntensityCircuit9:00-10:30am
WestsydeComm.Centre
ZUMBA®Gold11:00am-12:00pm
WestsydeNeighbourhoodCentre
ZUMBA®GoldToning11:00am-12:00pm
WestsydeNeighbourhoodCentre
afTeR-noon
IntervalFitCircuit6:00-7:00pm
WestsydeComm.Centre
Beginner Boot Camp 6:00-7:00pm
WestsydeNeighbourhoodCentre
Power Hour 5:45-6:45pm
WestsydeNeighbourhoodCentre
HIIT-HighIntensityIntervalTraining6:00-7:00pm
WestsydeNeighbourhoodCentre
evenInGIntermediate Yoga
7:00-8:30pmWestsydeNeighbourhood
Centre
Beginner Yoga 7:00-8:30pm
WestsydeNeighbourhoodCentre
Aquanatal 6:30-7:30pm
WestsydeComm.Centre
MonDay TUesDay WeDnesDay THURsDay
MoRnInGZUMBAGold
11:00am-12:00pmYacht Club
afTeR-noon
Gentle Touch Yoga 1:30-2:30pm
Hal Rogers
evenInG
ZUMBA®5:30-6:30pm
Yacht Club
ZUMBA®5:30-6:30pm
Hal Rogers
Beginner Yoga 6:00-7:00pmValleyviewHall
Yoga for Relaxation 7:15-8:15pm
Hal Rogers
Yoga for Relaxation 7:15-8:15pmValleyviewHall
![Page 53: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/53.jpg)
Events in Kamloops
51kamloops.ca/recreation 250.828.3500
schedules
PUblIC sKaTInG evenTs & PRo D Days ArenasCome on out and check out our freeevents&Proddaysthisseason.SponsoredbyTimHortons.For information: www.kamloops.ca/arenas
WaCKy WeDnesDaysWestsyde Pool6:30pm - 8:30pmevery Wednesday, starting Jan. 7FunActivitieswithanewthemeeachweekFor info: 250-828-3378 or [email protected]
DIM sWIMCanada Games Aquatic Centre6–9pmevery saturday, starting Jan. 10Allattractionswillbeopen,lowlight,musicrequests&sportactivities.For information: 250–828–3754 or [email protected]
UnPlUG & Play lITeRaCy WeeKDaily events • January 24–31Find a healthy balance between technologyandbeingactive.AnumberoforganizationsofferingFREEactivitiesthroughttheweekFor information: 250 828 3611 or www.literacyinkamloops.com
MayoR’s Gala foR THe aRTsCoast Kamloops Hotel and Coference Centresaturday, January 31Everyyearourcommunityleadersgatheratthisprestigiouseventtocelebrate and support the professional artsinKamloops-TheKamloopsArtGallery,KamloopsSymphonyandWesternCanadaTheatre. Ticketsare$125perpersonatKamloopsLive! BoxOffice250-374-5483or www.kamloopslive.ca
PUT yoUR HeaRT InTo ITTCC, Westsyde & Community Fitness ClassesMonth of februaryAttend2fitnessclasseseachweekin february to enter to win the grand prizeofafreeclassintheSpringsession For information: (250) 828–3698
sPIn yoUR HeaRT oUTTournament Capital CentreMonth of februaryEachspinclasswillcompetetocoverthe most distance in February! Push the pace to win a free class in the Springsession.For information: 250-828–3698
KaMlooPs InDooR GRan fonDo & faMIly fesTIvalTournament Capital Centre10am–4pm • Sunday Febuary 93rd Annual Family Day weekend! JoinourMSSocietyFundraiserbyregistering for the Kamloops Indoor GranFondo! Family Fun all day with FREEFor information: 250–828–3828 orwww.kamloopsgranfondo.ca
PRo–D sWIMCanada Games Aquatic Centre12–3pm • February 20All attractions open For information: 250–828–3754 or [email protected]
WeaR ReD DayThroughout the communityall DayFebruary 20 is wear red day! SupportHeartandStrokeawarenessby wearing your best red shirt to school,orwork!For information: 828–3698
HealTHy HeaRT faIRTournament Capital Centre9am–1pmStopbytheTCCforthe4thannualhealthyheartfair!Learnabouthealthynutrition,checkyourbloodpressure,learnaboutAEd’sandsomuch more A face painter will be on sitefrom9-11am,aswellasaPro-dSwimfrom12-3pm.For information: 250–828-3698
annUal KaMlooPs aRTs CoUnCIl’s aRT exPoseDKamloops Old Court House Cultural CentreFebruary 27 • 6pm–8pm opening night february 28 - March 810:00am-5:00pmThis open exhibition and art sale providesemerginglocalartistsofallageswithconstructivecriticismandvisibility.Itlsanexcellentopportunity for the artists to build their resume and compete with peers All mediums are welcome For information: 250–372–7323 or www.kamloopsarts.com
annUal sPRInG bReaK evenTCanada Games Aquatic Centre11am–9pm • March 16–27Ancient Empires theme Games,activities&prizes.For information: 250–828–3754
sPRInG bReaK CaMP aT THe KaMlooPs MUseUMMuseum & Archives9am–4pm • March 18–21Jointhekamloopsmuseum&archivesthisspringbreak!Exploreall the treasures hidden behind closeddoors,discoverpastworlds&learnallaboutlocalhistory.dosomething different this spring break!For information: 250–828–3576 orwww.kamloops.ca/museum
JaM Can 2015Kamloops Curling Club8am–5pm • March 28–29An opportunity For children ages 6–12 years to try the sport of curlingFor information: 250–372–5432
Jan
2
Jan
7
Jan
10
Jan
24
Jan
31
feb
1
feb
1
feb
8
feb
20
MaR
28
feb
20
feb
20
feb
27
MaR
17
MaR
18
![Page 54: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/54.jpg)
52
WeaR a HelMeTBraininjuryisthenumberonekilleranddisablerofpeopleundertheageof45.WearingaC.S.Aapprovedhelmetistheeasiestwaytopreventbraininjurywhileontheice.
PaRTy on THe ICe!HostapartyontheiceduringourpublicskatesessionsonFriday,SaturdayorSunday’satValleyviewArena.The$85admissionincludes:2hour pre-determinedpublicskatesession,3hourprivatepartyroomrental,insurance fees and 10 skate admissions A total of 25 participants can be accomodated in the party room Additional skate passes can be purchased Formoreinformationvisit www.kamloops.ca/arenas or call 828-3653 to book your party
PUblIC sKaTInG/sTICK & PUCKPreschool(0-4) fReeChild(4-13) $3.75Youth(14-18) $4.50Adult(19-59) $5.50Seniors(60+) $4.25Family (up to 4) $11.00
DRoP-In HoCKeyAdult(19-59) $6.50Goalies fRee
To view currenTcancellaTions,
schedules & evenTs please visiT
www.kamloops.ca/arenas
Toreceivethemostcurrentwebversionandinformation,youneedtoclearyourinternet cache and refresh your browser
noT sURe HoW?Contact Nicole Beauregard
at 250-828-3653
Did You Know?
Did You Know?
aDMIssIon RaTesCashOnly(smallbillsappreciated)
Check out our punchcard rates at www.kamloops.ca/arenas
ThatBrockandValleyviewArenasallowpatronsinwheelchairsonthe ice during public skate sessions Helmets are mandatory for the
person in the wheelchair The wheelchair attendants must wear a helmet and skates
PUblIC sKaTInG,sTICK & PUCK,& DRoP In HoCKeyWinter2015
![Page 55: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/55.jpg)
53kamloops.ca/recreation 250.828.3500
adultPhotography - shutter $40 speedIn thisBeyondPoint&Shootclass,examine how shutter speed settings allow us to capture those images of silky waterfalls, circular star trails,freeze sports action and so muchmore In addition we will be seeing how to use ‘bursts’ to capturemovement such as kids, pets, orathletes Cameras are necessary and tripods strongly recommended
SahaliSec.School»Jan27 7:00-9:00PM Tue 234790
Photography - low $40 light and IsoIn thisBeyondPoint&Shootclass,wewillexplorethevastrealmoflowlight photography. Learn how ISOsettings and the Histogram allow most modern dSLRs to be used insituationswhereeventhehumaneyehasdifficulty.Someflashphotographywill also be covered. Join us asweenter an area of photography that is oftenoverlooked.
SahaliSec.School»Feb3 7:00-9:00PM Tue 234791
Photography - adobe lightroom and Photo Critiquing $150 This six-hour class is designedto introduce intermediate levelphotographers to the world of Adobe Lightroom-apowerfulphotoeditingtool. Studentswill be given severalshooting objectives with groupfeedbackandcritique.Studentswillneed a digital camera that has the abilitytocaptureinRAW.
ExposurePhotoStudio»Feb8 10:00AM-4:00PM Sun 235635
Cell Phone Photography $40discoverhowtouseyourcellphoneto produce truly outstanding images No longer limited to the popular and fun selfies and snapshots,users of newer model cell phones are producing outstanding images Learntousefreeprocessingappstoproduce stunning images
SahaliSec.School»Feb17 7:00-9:00PM Tue 234987
flower Photography $125For those of you that are passionate aboutcapturingimagesofflowersandbotanicals-thisistheclassforyou!The class is designed to help guide you through the process of seeing flowers as a piece of art, focusingoncomposition,backgroundchoice,lighting and lens choice. Studentswillneedatripod,acamerathathastheabilitytoswitchto‘Manual’,andabunchofyourfavouriteflowerstophotograph This class will be held indoors and will be working with natural light!
ExposurePhotoStudio»Mar1 11:00AM-3:00PM Sun 235636
Printmaking - beginner $45
Learn the basics of printmakingto create beautiful greeting cards,using everyday household objectssuch as wool, bubble wrap, paperclips,andcardboard.Allsupplieswillbeprovided.
OldCourthouse»Jan24 10:00AM-12:00PM Sat 235443
»Feb11 6:00-8:00PM Wed 235444
spanish - beginner $95This fun, informal class is designedfor individualswhohave littleornoexperiencespeakingSpanish.LearnbasicSpanishgrammarandhowtoread,write,andspeakSpanish.Bookis extra
SouthKamloopsSec.School»Jan12-Feb4 7:00-9:00PM Mon,Wed 233193
Heritage House»Jan12-Feb5 9:00-11:00AM Mon,Thu 233194
spanish - Intermediate $95This program will build on the skills learned in the beginner Spanishclass or if you feel you are ready for an intermediate class Intermediate Spanishisdesignedforthosewantingtoimprovetheirconversationalskills.Book is extra
SouthKamloopsSec.School»Feb16-Mar11 7:00-9:00PM Mon,Wed 233195
Heritage House»Feb16-Mar12 9:00-11:00AM Mon,Thu 233197
spanish - advanced $95This class is designed to continue developing and enhancingcommunicationskillsoftheSpanishlanguage. Previous participantsof the Intermediate class can continue building their confidencewith interacting in various socialsituations
Heritage House»Jan12-Feb5 11:30AM-1:30PM Mon,Thu 233198
»Feb16-Mar12 11:30AM-1:30PM Mon,Thu 233199
New
New
New
New
![Page 56: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/56.jpg)
54
The art of letter fRee WritingLivinginthetechnologicalageofsocialmedia and instant communication,rediscovering the lost art of letterwriting is an enjoyable journey From choosing stationery and writing utensils, to practicing penmanship,you will enjoy this workshop learning the art of letter writing
KamloopsMuseum&Archives»Jan24 1:00-3:00PM Sat 235596
Watercolour - $120 beginners Fun and easy projects are designed to teach basic techniques and build confidence for students to painta basic landscape or a flower. Noexperienceneeded!Mustbringownsupplies
SouthKamloopsSec.School»Feb3-Mar10 7:00-9:00PM Tue 235442
Watercolour - $105 open studioFully explore your favouritetechniquesfrompreviousclassesatyour own pace in the open studio watercolour session. You will havethe chance to review techniquesfrom the beginners’ class and work independently Guidance and gentle criticism will round out the experience
SouthKamloopsSec.School»Jan20-Mar10 6:45-9:00PM Tue 235440
CooKInGspanish Tapas $45Want to add some Spanish flair toyour appetizer repertoire? Learn tomakeavarietyofSpanishtapas.
NorKamSec.School»Jan12 6:30-9:30PM Mon 235087
Cajun Cuisine $45Cajun cooking is one of the hottest cuisines around. Learn to createsome amazing cajun recipes fromaround the world
SouthKamloopsSec.School-LowerCampus»Jan22 6:30-9:30PM Thu 235090
Gluten-free baking $45This program will cover the basicsof gluten-free baking. A variety ofalternatives to wheat flour will beused and discussed Participants will alsotakehomeabagofgluten-freebaking mix This program is offered in partnership with Interior Community Services.
Mt.PaulUnitedChurch»Jan24 9:00AM-12:00PM Sat 235082
Gyoza $45 (Japanese Dumplings) Pork gyoza are Japanese-styledumplings that are a popular appetizerchoiceatmanyrestaurants.Theycanbesteamed,boiled, fried,or deep-fried. Learn how to wrap,fry,andmakethebeststuffinganddipping sauce
SahaliSec.School»Feb10 6:30-9:30PM Tue 235084
Thai $45discover and cook traditional Thaicuisine using common ingredients such as lemon grass, ginger, andkaffirlimeleaves.
NorkamSec.School»Feb12 6:30-9:30PM Thu 235091
Crêpes $45Learn to create the perfect crêpe.This delicate French thin pancake is excellent in many applications -appetizer,entree,ordessert.
NorkamSec.School»Feb16 6:30-9:30PM Mon 235086
Canning $45Learn the art of food preservation!This class takes a step-by-stepapproachtothetechniquesinvolvedin canning. Learn in an hands-onenvironment. This program is inpartnership with Interior Community ServicesCommunityKitchens.
Mt.PaulUnitedChurch»Feb21 9:00AM-12:00PM Sat 235083
Teriyaki Chicken $45Teriyaki chicken is one of the most popular meal choices at Japanese restaurantsinCanada.InJapanese,‘teri’meansshinyorglazedand‘yaki’means grilled or baked You will learn to properly prepare the chicken and makeadelicious,homemadeteriyakisauce
SahaliSec.School»Feb24 6:30-9:30PM Tue 235085
adultNew
New
New
New
![Page 57: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/57.jpg)
55kamloops.ca/recreation 250.828.3500
Cardiovascular Rehabilitation and Prevention
For more information please contact: 250 314-2727
VASCULARIMPROVEMENT
PROGRAM
LUNGHEALTH
SWEET MOVESDIABETES
EDUCATION
ONTRACK
For more information please contact: 250-851-7976
For more information please call the Diabetes Education Program at 250-314-2457
Speak to your doctor for a program referral or for more information please contact 250-828-3742
The Strategic Health Alliance is a relationship between the City of Kamloops and Interior Health. The exercise programs delivered through this innovative partnership offer individuals with chronic conditions a way to get moving using the clinical expertise of medical staff in a
recreation setting. All Strategic Health Exercise programming is by Physician referral.
StrategicHealth Alliance
FOR REFERRAL FORMS, PLEASE VISITWWW.KEEPONMOVING.CA/PHYSICIANS
![Page 58: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/58.jpg)
Adults55+,previouslyActiveAgersisasectionofourActivityGuidecommittedtooffering
programmingtokeeptheagingpopulationactiveand engaged Don’t let the title of this section
fool you! The programming in this section may be enjoyed by anybody aged 18 years and older
Adult 55+
56
Adult 55+No Bake Holiday Wreath Cookies: Yield:about11/2dozen Cooktime:3Minutes Preptime:25Minutes Other:30Minutes
Ingredients:
•1(12-oz.)packagevanillacandycoating,brokenup •Greenpastefoodcoloring •21/2cupscoarselycrushedminishreddedwholewheat cereal biscuits •Minicandy-coatedchocolatepieces,redcinnamoncandies,swirledholidaywhitemorsels
Directions: MicrowavevanillacandycoatinginamediumbowlatMEdIUM(50%power)3minutes,stirringaftereveryminute.Stirindesiredamountoffoodcoloring.Addcereal,stirring gently to coat Drop cereal mixture by heaping tablespoonfuls onto wax paper; shape each spoonful into a wreath.decoratewithassortedcandies.Letcookiesstandabout 30 minutes untilfirm.
Cookingisawonderfulactivitytodowiththelittlepeople in your life The holiday season brings us together whether we are a family by birth or a family by choice The age of technology means that many youngsters areconstantlydistractedbyscreens.Whynottakeadvantageoftheopportunitytoconnectandmakesomememories (don’t forget the camera!) The kids will feel a great sense of accomplishment when they show off their finishedproduct.Hereisarecipetotrywithgrandkidsorspecial little friends:
![Page 59: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/59.jpg)
57kamloops.ca/recreation 250.828.3500
fITness In MoTIonaquatic Gentle fit Acertifiedinstructorinarthritis,
post-rehabilitation therapy, andaquatic fitness leads this program.Classes progress by building on each other to safely challenge your physicalfitness.
Canada Games Aquatic Centre
$24»Jan12-Feb2 2:00-3:00PM Mon 234883
$30 »Jan14-Feb11 2:00-3:00PM Wed 234884
$30 »Jan15-Feb12 2:00-3:00PM Thu 234885
$24 »Feb16-Mar9 2:00-3:00PM Mon 234886
$24 »Feb18-Mar11 2:00-3:00PM Wed 234887
$24 »Feb19-Mar12 2:00-3:00PM Thu 234888
Gentle Circuit Drop-indesignedforthebeginnerexerciser,this circuit covers everything fromwalking to strength exercises to offer aunique,full-bodyworkout.Combineimproved balance, strength, andcoordination training with cardio to start exercising in a safe and fun environment.
TCC-TournamentCapitalCentre»Jan5-Mar13 Mon,Wed,Fri 9:00-10:00AM Tue,Thu 8:00-9:00AM
Gentle Touch yoga This class is for those participants whofindregularyogaclassestobea little toomuch.Enjoy a fun, non-intimidating class that includes the use of chairs and modified poseswhile working on bringing greater mobilityandflexibilitytothejoints.If you are experiencing any stiffness associatedwithagingor injury,thisclassisforyou!Eachclasswillhaveaten-minutebreakandconcludewithguided relaxation
Hal Rogers $64»Jan12-Mar9 1:30-2:30PM Mon 235358
TCC-TournamentCapitalCentre $72»Jan13-Mar10 1:00-2:00PM Tue 235359
Tai Chi (beginner) $54The practice of Tai Chi has been shown to improve one’s balance,body awareness, power ofobservation, memory and overallwell-being.Learnthefirst29TaiChibeginnermovesinanon-judgmental,supportiveatmosphere,taughtbyanexperienced Tai Chi instructor
TCC-TournamentCapitalCentre»Jan14-Mar11 8:30-9:30AM Wed 235360
Tai Chi (Intermediate) $54Ifyouarecomfortablewiththefirst36movesoftheTaiChiset,youmayready for the rest of themoves inthe intermediate session Continue to improveyourbalance,memoryandco-ordination in a fun and relaxedenvironment.
TCC-TournamentCapitalCentre»Jan14-Mar11 9:45-10:45AM Wed 235482
active aging
The Clubhouse
The Clubhouse is a program withinCanadianMentalHealthAssociation(CMHA).Avarietyofprograms/servicesinourcommunityfor adults 18+ years with a diagnosis of a mental illness tohelpmaximizetheirindependence within the community
The Clubhouse offers healthy,recreationalactivities;referralstoothercommunity support and programs; and assists in learning life skills A varietyofservicesareavailabledailysuchas:meals/snacks,clothingdonations,supportstaff,laundryservices,andcomputer access to name a few
If you require any additional information please contact sheena Christian at (250) 374-0440 [email protected]
![Page 60: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/60.jpg)
58
Zumba® Gold Zumba® Gold targets the largestgrowingsegmentofthepopulation-babyboomers.IttakestheZumba®formula and modifies the movesand pacing to suit the needs of the active aging participant, as well asthose just starting their journey to afitandhealthylifestyle.Whatstaysthe same are all of the elements theZumba®FitnessPartyisknownfor - zesty Latin music like salsa,merengue, cumbia, and reggaeton;exhilarating, easy-to-follow moves;and an invigorating, party-likeatmosphere
Yacht Club $64»Jan12-Mar9 11:00AM-12:00PM Mon 233892
WestsydeNeighbourhoodCentre $72»Jan14-Mar11 11:00AM-12:00PM Wed 233893
Zumba® Gold Toning $72Are you looking to take your Zumba®classtothenextlevel?TheZumba®GoldToningclasscombinesthe excitement and exhilaration of a traditional Zumba® class withstrengthtraining.Jointhemovementand help build muscle strength,mobility, posture, and coordination.Specifically adapted for the activeolder adult or beginner exerciser,this class combines all the benefitsoffitnesswiththefunatmosphereofZumba®!
WestsydeNeighbourhoodCentre»Jan16-Mar13 11:00AM-12:00PM Fri 233895
sPeCIalTy fITness
Osteofit 1 Are you at an increased risk for
osteoporosisorhaveyousufferedafracture in the past?Join a certifiedinstructor to increase your fitnesslevel safely and effectively byimproving posture and balance.Build stronger muscles and bones while decreasing the risk of falls and fractures This class is also appropriate for participants with arthritis or osteoarthritis, as wellasbeginner exercisers
TCC-TournamentCapitalCentre $60»Jan13-Feb12 9:45-10:45AM Tue,Thu 235361
$48»Feb17-Mar12 9:45-10:45AM Tue,Thu 235362
Osteofit 2 Safely progress your exercisefromOsteofit1withthismorechallenging class, building on
the principles learned in Osteofit1.Increase your balance, strength,and coordination with exercises designed to challenge you in safe andfunenvironmentwhilemanagingyour risk for falls and fractures!
TCC-TournamentCapitalCentre $30»Jan13-Feb10 11:00AM-12:00PM Tue 235364
$24»Feb17-Mar10 11:00AM-12:00PM Tue 235365
$30»Jan15-Feb12 11:00AM-12:00PM Thu 235366
$24»Feb19-Mar12 11:00AM-12:00PM Thu 235367
sensational survivors $115This all-women, cancer-specificexercise program will provide youwith a safe way to exercise in all stages of treatment and recovery.You will work one-on-one with anexercise professional to create an exercise program specific to you,followedbysixweeksoftwice-weekly,supervisedgroupexercisesessions.Please contact 250-828-3742 formore details
active aging
January is Alzheimer’sAwarenessMonth.
This year the theme is ‘seeme,notmydisease’
Did you know?
KeepOnMovingdesignatedexercise programs are a safe and fun way to keep
yourselfactive.Fitnessclassesareidentifiedwiththelogothroughouttheactivityguide.Formoreinformation,pleasevisitwww.keeponmoving.ca
![Page 61: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/61.jpg)
ThattheSeniorsQuickGuideisresourcetooldevelopedforseniorsandtheircaregiverstohelpnavigatethehealth,wellnessandsocialservicessystemlocally,provinciallyandnationally.CheckoutAccessKamloopshttp://www.accesskamloops.
org/toviewtheSeniorsQuickGuide.
Did you know?
59kamloops.ca/recreation 250.828.3500
active aging
sPoRTsDrop-in badminton $30
Punch CardEveryone is welcome to join in thefun sport of badminton!Bring your racquet and enthusiasm.For $30,participants can purchase a punch card at TCC, Westsyde Pool, orKamloopsMuseum&Archives.
TRU-ThompsonRiversUniversity»Jan5-Mar9 9:30-11:30AM Mon
»Jan9-Mar6 9:30-11:30AM Fri
Drop-in Pickleball $30 Punch Card
Pickleball is a cross between badminton and table tennis It uses a lightweight wooden paddle and a whiffle ball.Learn the basic skills,techniques, and rules of the gamewith an emphasis on fun!For $30,participants can purchase a punch card at TCC, Westsyde Pool, orKamloopsMuseum&Archives.
TRU-ThompsonRiversUniversity»Jan5-Mar9 8:00-10:00AM Mon
»Jan7-Mar11 8:00-11:30AM Wed
»Jan9-Mar6 8:00-10:00AM Fri
SummitElem.School(for beginner players only)»Jan6-Mar10 7:00-9:00PM Tue
Drop-in Table Tennis $30 Punch CardEveryone is welcome to join us inplaying table tennis It is a great way togetsomephysicalactivityinalow-impact sport and meet new friends Punchcardscanbepurchasedfor$30atTCC,WestsydePool,orKamloopsMuseum&Archives.
WestsydeNeighbourhoodCentre»Jan8-Mar12 7:15-9:15PM Thu
January is Alzheimer’sAwarenessMonth.
This year the theme is ‘seeme,notmydisease’
Did you know?
PAR-QAreyouplanningtobecomemorephysicallyactive?Toensureyoursafetyinallfitnessclasses,pleasereviewthePAR-Qat:csep.ca/cmfiles/publications/parq/parq.pdfpriortoyourparticipation.Ifyouhaveconcernsregardingyoursafety
please speak to your physician
![Page 62: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/62.jpg)
60
InTeResTeDIn beCoMInG
a CoaCH?Check out our Coach Enhancement Ad on page 66 for more
information!
JoinusonFebruary20thand21stforthefirsteverPhysicalLiteracyandHealthSummitinKamloops!
Save the Date
Did you know?FromFebruary13-March1,2015,PrinceGeorgeandNorthernBritishColumbiawillplayhostto2,400athletes,1,000coachesandofficials,upto4,500volunteers,hundredsofmediaand
thousandsofvisitorsattheCanadaWinterGames. Followyourfavoriteeventsandathleteshere:
http://www.teambc.org
WHO ARE WE? Theprovincialnetworkofeightnot-for-profitPacificSportcentrescollaboratetosupportincreasedsportparticipationandimprovedsportperformancethroughoutBC.Thesemulti-sportcentresarecommitedtodevelopingsportatalllevelsbyintegratingathleteservices,coachingeducationandphysicalliteracyopportunities.WeserviceKamloops,100MileHouse,Merrit,SalmonArm,Revelstoke,Golden and all areas in between throughout the interior region
PacificSportInteriorBCwouldliketothanktheCanadianSportInstitutePacific,ViaSportBCandtheProvinceofBritishColumbiafortheirsupportofourBC-basedsportinitiativesatallstagesoftheCanadianSportforLife(CS4L)continuum.
Interior BC
![Page 63: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/63.jpg)
61kamloops.ca/recreation 250.828.3500
Finally...wecanofficiallysayCONGRATULATIONSdYLANonyour2008OlympicBronzeMedalANd2010InternationalAthletics Federation Indoor WorldChampionshipBronzeMedal!!dylanArmstrongisCanada’sfirstOlympicmedallist in a throwing eventinalmostacentury.Armstrong made his OlympicdebutatBeijing2008 where he initially finishedfourth,missingoutthebronzebyjust one centimetre Ittooksixyears,butCanadian shot putter Dylan Armstrong is finallygettinghisOlympicmedal!Thiscomes a year after third-placeholderAndreiMikhnevichofBelarus was hit with a lifetime ban for doping dylanisatwo-timePan American Games goldmedallist(2007,2011) and the 2010 Commonwealth Games Champion and also wontheoveralltitleinshot put for the 2011 diamondLeague.dylanhopes to compete at the 2015 world outdoor championships in Beijing andthe2016OlympicGames in Rio de Janeiro GoodLuck,dylan!
Check out our Programs!Availabletoallmembersof
the community
Dylan Armstrong2008 Olumpic Bronze Medalist
in Shot Put
Athlete Profile
pacific sport
PaCIfICsPoRT InTeRIoR bC910McGillRoad Kamloops BC V2C 6N6Fax250-828-3619
LookforusonFacebookFacebook.com/PacificsportInteriorbc
www.pacificsportinteriorbc.com
Carolynn boomerGeneralManager [email protected]
eryn bulmer barrettSportPerformanceCoordinator250-828-3583ebarrett@pacificsport.com
Katie KlassenSportParticipationCoordinator/[email protected]
Josée WarrenSportdevelopmentCoordinatorMerrittOffice250-315-1075jwarren@pacificsport.com
Powering sport - What We DoPacificSportcentresofferavarietyofprogramsandservicesforBC-basedathletes at all stages of the Canadian SportforLife(CS4L)continuum.
sport Participation and DevelopmentGrassroots programs that support physical literacy and ensure that BC youth have the opportunity to beinspired by sport and lead a healthy andactivelifestyle.
sport Performance and leadershipHigh-performance programs thatprovide BC athletes and coachesaccesstotrainingfacilities,innovativesportsciencetechniques,andsupportservicestoprovideeveryadvantageto win medals for Canada
education and advocacyOpportunitiesforsporteducationatalllevelsoftheCS4Lpathwayincludingcurrent and interactive seminars,workshops, and conferences thatassist in furthering community sport developmentandperformance.
support and ResourcesSpecialized equipment, technologyinnovations, and grants to assistwith the transfer and acquisition of knowledge, technical, and tacticalimplementation as well as the administrativeprogressoflocalsportorganizations.
PacificSport ProgramsFor more information or to register for any of these programs, contactPacificSport at 250-828-3583, orvisitourwebsite:
www.pacificsportinteriorbc.com.
Group/team rates are available formost programs:
$100foragroupof8-12
$150foragroupof12-15
ContactPacificSportformoredetails!
![Page 64: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/64.jpg)
62
Visit www.pacificsportinteriorbc.com to sign up for our monthly newsletter!
pacific sport
sPoRT PeRfoRManCe PRoGRaMsOpen to all athletes, coaches, andparents
WorkshopsareFREEforallIPSandPacificSport carded athletes andcoaches
For a complete listing of all sport performance programs, workshops,and new additions to the calendar in 2015,pleasegoto
www.pacificsportinteriorbc.com/index.php?p=3_1.
PRo D Day WoRKsHoPsPacificSport is offering a series ofSportPerformanceWorkshopsonProD days Expand your knowledge and improve your performance withoutmissing school or team practices! The workshopsareFREEforPacificSport-registered athletes, and will beoffered on February 20 and April 20
nCaa scholarships $20 and Recruiting 14+ yrsA basic introduction to the NCAA systemwillteachyouhowtonavigatethe recruiting process and market yourself to coaches in order to earn a scholarship. Ken Olynyk, TRUAthletic director and coach, leadsthis workshop, which will focus onathleteself-marketingstrategies,SATexams, as well as decision-makingtools that are important to potential CISathletes.
TCC-TournamentCapitalCentre»Feb20 1:30-3:00PM Fri 235392
CoaCH eDUCaTIon WoRKsHoPsfield Testing Kit 18+ yrs Coach Training The field testing kits provide thenecessarytoolsforserviceprovidersto assess the physiological parameters of their athletes using Best Practice as well as system alignment with the Canadian Sport for Life model.These kits are equipped to do a general battery of tests to assess leg power,speed,balance,coordination,muscular endurance, and aerobicpower
video analysis and 18+ yrs Dartfish Training Theseworkshopsprovideinstructionon enhanced performance feedback through effective use of videotechnology. Coaches will leave theworkshop with resources and access tovideoanalysisequipment.Topicscoveredwillinclude:
- How biomedical principles driveperformance analysis;
-Choosingtherightvideoequipment;and
-Videoanalysisbestpractices,fromtapingtoreview.
BC Athletics and the Kamloops Track&FieldClubareextremelypleased to announce that Olympian,WorldAthleticsChampionship800mSilverMedallistandCanadianRecordHolderat800m,GaryReed,is returning to Kamloops to assume the role of Interior BC Regional Athletics Coach–Middledistance&Cross Country beginning September2014.Retiredfromcompetitivetrackandfieldindecemberof2010,aftercompetingsincetheageof13,Gary’seight year professional running career included twoOlympicGamesandsixWorldChampionships.His new role will allow him to connect with developingathletes,coaches,schoolsandclubs in both the Interior andOkanaganRegionsof British Columbia It is excitingtohaveachampionin the community who will continue the ongoing developmentofAthleticsin Canada and help shape our future track champions WelcomebacktoKamloops,Gary!
Gary ReedReginal Athletics Coach
Middle Distance & Cross Country
Coach Profile
Prince George is hosting thefirsteverCanadaWinterGamesinBritishColumbia in February 2015 This is the third
time British Columbia has hosted a Canada Games as NewWestminsterhostedtheCanadaSummerGames in 1973 and Kamloops in 1993
CWG Fun Fact
![Page 65: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/65.jpg)
63kamloops.ca/recreation 250.828.3500
pacific sport
COACH ENHANCEMENT PROGRAMSNCCP COACH CERTIFICATIONThe National Coaching Certi�cation Program (NCCP) is a coach training and certi�cation program o�ered in over 66 sports across Canada. The NCCP is a collaborative program of the Government of Canada, provincial/territorial governments, national/provincial/territorial sport organizations, and the Coaching Association of Canada. For more information, visit ViaSport's website at www.viasport.ca. This fall, we will be running the following coach training courses. Please visit our website, www.paci�csportinteriorbc.com, for more details.
Are you looking for the NCCP Level 1, 2, or 3 courses? The modules
have been renamed Intro to Competition and Introduction to Competition Development.
For more information, please contact Paci�cSport or ViaSport BC.
Register for NCCP programs by phone at 250-828-3500 or online at www.kamloops.ca/ezreg.
All courses will be located at the Tournament Capital Centre (TCC), 910 McGill Road. For more information about any of the NCCP coach training courses, please contact Eryn Bulmer Barrett, Sport Performance Coordinator, at ebarrett@paci�csport.com or 250-828-3583, or visit our website at www.paci�csportinteriorbc.com.
NCCP Competition Introduction Modules NCCP Competition Introduction Modules3-Course Bundle: Teaching & Learning, Designing a Basic Sport Program, and Basic Mental Skills. Jan 17 and 18. $99. Course No. 235387.Jan 17 - Teaching & Learning - 8:30 am-4:30 pm. $80. Course No. 236433.Jan 18 - Designing a Basic Sport Program - 8:30 am-12:30 pm. $60. Course No. 236434. Jan 18 - Basic Mental Skills - 1:30-4:30 pm. $45. Course No. 236435.
Psychology of PerformanceFeb 21, 8:30 am-12:00 pmInstructor: Glenn Armstrong.$40 Course No. 235389.
Coaching and LeadingApr 17, 6:30-9:30 pm, and Apr 18, 8:30 am-4:30 pmInstructor: Glen Armstrong.$95 Course No. 235391.
Planning a PracticeMar 14 - 8:30 am-4:30 pm$80 Course No. 235390.
Changes to Competition Introduction Module Delivery - Former Part A and BPreviously, the six multi-sport modules were o�ered as stand alone or grouped into Part A or Part B workshops. (Part A: Making Ethical Decisions, Planning a Practice, and Nutrition; and Part B: Design a Basic Sport Program, Teaching & Learning, and Basic Mental Skills). The Coaching Association of Canada has moved away from using the language Part A and B in reference to these modules, so they stand alone like the Competition Development modules. Save money and register for the course module bundles, or just sign up for the individual module you need for your sport-speci�c certi�cation requirements!
COACHES' CORNERCoaches' Corner is a great opportunity for coaches and sport administrators to learn and network. Join us for fun and informal "lunch and learn" sessions on the following dates:
JANUARY 15 and MARCH 1212:00 noon SHARP
Frick and Frack Restaurant, 577 Victoria Street
RSVP to Eryn Bulmer Barrett, Sport Performance Coordinator
250-828-3583ebarrett@paci�csport.com
Prince George is hosting thefirsteverCanadaWinterGamesinBritishColumbia in February 2015 This is the third
time British Columbia has hosted a Canada Games as NewWestminsterhostedtheCanadaSummerGames in 1973 and Kamloops in 1993
CWG Fun Fact
![Page 66: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/66.jpg)
64
pacific sport
sPoRTMeD bC WoRKsHoPsSportMedBCworkshopsareofferedin collaboration with SportMed BC,and are open to coaches, athletes,and parents These workshops are often approved for BCRPA/CMTBCContinuing Education credits A certificate of completion will beissued
» Athletic Taping
»ConcussioncManagementWorkshop
»SportsFirstAid
»SportSmart
For more information, visit www.sportmedbc.com/eventsorcallAlexat604-294-3050ext.107.
affIlIaTeD sPoRTs
alPIne sKIInGsun Peaks alpine ski ClubOurgoalistopromotealpinesportsas healthy, enjoyable activities forpersons of all ages and abilities,while focusing on building character athletes through the sport of alpine ski racing Go to www sunpeaksracers catoexploreorNGSL,U14,andU16programs,orvisitusonFacebookatSunPeaksRacers.
The nancy Greene ski league (nGsl)» “FUNdamental” stage of ski racing forchildren5-12yearsofage.» Introduces basic skiing techniques and skills and develops the ABCs(agility, balance, coordination,strength/speed).» Children have the option ofparticipating in competitions with other clubs in the Interior Programs runonSundays from thefirstweekof January to theendofMarch.For more information, contact PamJacoby (NGSL rep) at pjjacoby@shaw ca
bC alpine U14/U16 series» This is the next step after completing the Nancy Greene SkiLeague(NGSL)program.»Opentoallathletesages12-15todevelopracingandskiingskillsandprogress according to ability » Experienced coaches provide astrong technical foundation » A low-stress, low-cost program,withzonecompetitions.» Program runs weekly from mountain opening to the end of ski season For more information, contact LisaSmillie(U14/U16rep)atlisasmillie@telus net
Harper Mountain ski ClubRioTintoAlcanNancyGreeneSkiLeague Ages4-12 Program Coordinator: Robert Brettell harperskiclub@gmail com 250-579-0104 Visit www harpermountain com for more information » The Harper Mountain Ski Club(HMSC),established in1973,offersalpine ski racing instruction for childrenages4-12 inafun,family-oriented atmosphere » Club members participate in the Nancy Greene Ski League and aretaughtalpineskiracingutilizingtheHuskySnowStarProgram(Canada’sNationalAlpineSkiSkilldevelopmentProgram)bycertifiedskiinstructors/coaches » HMSC offers a freestyle programfor kids ages 8-14 (limited spaceavailable). The freestyle programis geared towards kids possessing advancedskierabilitywhowouldliketotryanalternativetoalpineracing.Moguls,park,pipe,aerials,andbigmountain disciplines will be explored and theirvarious techniques taughtin a fun and engaging atmosphere by certified park and freestyleinstructors » Both programs (alpine racing and freestyle) will offer the athletes an opportunity to compete against other clubs at various mountainsthroughout the Interior (competing is not mandatory) The HMSC winter season programsrun Sundays, January throughMarch,from9:30amto2:30pmatHarperMountain(a20-minutedrivefromKamloops).Clubfees:$350
aTHleTICsKamloops Track and Field Club Head Coach: Oleg Bondarchuk (allevents)National Throws CentreCoach: Dr Anatoly BondarchukBC Reginal Coach: Gary Reed Office:250-851-2512www.kamloopstrackandfield.ca
about UsThe Kamloops Track and Field Club has a proud history of producing successful athletes. We currentlyemploya full-timeHeadCoachanda National Throws Coach and many part-timecoaches toensurequalityprograms from the grassroots to the high-performanceathlete,aswellasamastersprogram.Wearecommittedtoensuringthatallparticipantshaveapositiveexperience!
Training facilitiesSeptembertoMarch-TCCFieldhouseApriltoAugust-HillsideStadium
Programs» Cross-country - Middle distance(AllAges):Fitness-basedtrainingforanyathlete(3days/week).
» Track Rascals (Ages 6-8): Trackand field fundamentals and fun(6weeks,1day/week,Wednesdays,5:00-6:00pm).
» Juniordevelopment (Ages9-12):Introduction to track and field andbasicskills(15-16weeks,2-3days/week),TuesdaysandThursdays.
» Midget (Ages 13-15): Advancedtraining opportunities No attendance rules (15-18 weeks, 4-5 days/week)
»Juvenile,Junior,Senior(Ages16+):Specialized training opportunities.Mandatoryattendance(16-18weeks,5days/week).
» Masters (Ages 35+): All-roundtraining. All events are covered (3days/week).
RegistrationForinformationonwinterprograms,visit www.kamloopstrackandfield.caorcallHeadCoach,OlegBondarchuk,at250-819-1512.
![Page 67: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/67.jpg)
65kamloops.ca/recreation 250.828.3500
baseballCoach: Ray Chadwick rchadwick@tru ca
The TRU WolfPack baseball teamplays all of its games at Norbrock Stadium,locatedonMcArthurIsland.Home games are played as double headers, usually on Saturdays andSundays. League play starts inMarchandfinishes inApril,withanexhibition schedule in the fall
basKeTballContact:KenOlynyk kolynyk@tru caCoach:JoeEnevolsonwww kamloopsbasketball com
Girls - Grade 6-12SixSessionsCoach:ScottReeves
Kamloops basketball academyMore information and registrationforms at www kamloopsbasketball com
Canoe/KayaKKamloops Canoe and Kayak ClubShumwayLake
www kamloopscanoeandkayakclub ca Forclubinformation,email: info@kamloopscanoeandkayakclub ca ClubPresident:BethMorgan 250-851-9862 BCRegionalCoach:StanMarek
Sprint canoe and kayak racing areverysuccessfulCanadiansportsandour athletes continue to medal at theOlympicGames.Sprintracingisa great form of exercise that instills discipline,determination,andagoodwork ethic, skills that athletes willutilizetherestoftheirlives.Membersof Kamloops Canoe and Kayak Club can train in both disciplines of the sport, canoe and kayak. Levels ofcompetition vary from recreationalto highly competitive. For moreinformation, please visit ourwebsite
CRoss-CoUnTRy sKIInGoverlander ski ClubCross-countrySkiingCoach:danaManhard250-573-6024dmanhard@shaw cawww.overlanderskiclub.com
ProgramscommenceOctober8,seewebsite for details
Programs»SkiLeagueages5-8
»SkiLeagueages8-12
»Juniordevelopmentages12-20
Annual program
»Mastersprogramages20+
» Introductory or skill developmentlessons for all ages and abilities
Formoreinformationonanyprograms,visit www.overlanderskiclub.com.The programs offer age-specificskills following the Cross Country Canadadevelopmentmodel. Cross-country skiing is a “lifetime” sport suitable for individuals and familiesof all ages and abilities
CURlInGCurl bCRegional Coach: Brenda Nordinbnordin@curlbc ca250-329-6038
McArthurIslandCurlingClubwww mcarthurislandcurlingclub com250-554-1911micc1@telus net
Kamloops Curling Club700VictoriaStreetKamloops BC V2C 2B6www kamloopscurlingclub com250-372-5432paula@kamloopscurlingclub com
pacific sport
Practicingfundamentalmovementskillsasachildfor2-3hours a week can reduce the risk of them getting injured duringphysicalactivityasanadult.Formoreinformation
visitwww.activeforlife.ca
Physical Activity/CS4l
![Page 68: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/68.jpg)
66
pacific sport
DIvInGRiptech DivingInfo@riptech cawww riptech ca250-320-0436
diveRightIn!WithRiptechdivingRecreationaltocompetitiveprogramsfor ages 5 and up
Introductory program for beginners Learn the fundamentals of divingin a fun and safe environment.Individuals progress at their ownrate.Instructorsfocusondevelopingcoordination, flexibility, strength,fitness, posture, listening skills,concentration,and,of course,FUN!Prerequisite: participants must be able to swim comfortably in deep water
Competitive programs by invitationonly Unless you are transferring fromanothercluborfromadvancedgymnastics/trampoline, we requirealldiverstostartinFundive.
Programs run year-round withregistration ongoing
fIGURe sKaTInGKamloops skating Clubwww kamloopsskatingclub com250-554-4944Find us on Facebook - KamloopsSkatingClubPresident: Andrea Veitchkcspresident@hotmail caRegistrar: Rhonda Rowlandkcsregistrar@hotmail ca
Winter RegistrationRegistration is ongoing New program startsJanuary6,2015.Pleaseemailkscpresident@hotmail ca for more information
Programs offered:
Preschool - ages 3-5A10-weekLearntoSkateprogram.
Canskate - ages 5-12 A10-weekLearntoSkateprogram.SkatersworkattheirownlevelandprogressthroughtheSkateCanadabadge system at their own pace
Junior academy Program - advanced Canskate ProgramPrepares the skater for advancingintotheStarSkaterprogram.
starskaters (Test and Competitive)Contact the club for more information on this program
GyMnasTICs/TRaMPolInePossibilities play at KGTC Join the fun in our incredible indoor playground!
KamloopsGymnastics/ Trampoline CentreTournament Capital Centre910McGillRoad250-374-6424info@kgtc cawww kgtc ca
adult with Tot Drop-in (14 months-3.5 yrs)Mon,Wed,Fri11:00am-12:00noon
Just Me Drop-in (3-5 yrs)Mon,Wed,Fri11:00am-12:00noon
active start Programs (14 months-5 yrs)Check out our website to learn more about the the variety of preschoolprograms designed to enhance your child’sdevelopment.
Recreational Programs (6-13 yrs)(beginner through Intermediate)Recreational programs follow the CANGYM/CANJUMP programsfor skill acquisition, focusing oncontinuous achievement in a fun,safeenvironment.
advanced Recreational Programs (7-13 yrs, with coach invite or by assessment)Traintoachievemoreadvancedskilldevelopment. Build skill sequencesfor fun and optional participation in performance-based events anddisplays
Gym sport activities (6-10 yrs)A 10-week program option onFridays,asan introductiontoKGTCgymactivitiesonallapparatus.
High school Training (11-18 yrs)Nopreviousskill required.Setyourown goals for each apparatus and worktoachievethem.
Gymnastics for ParkourAnactiveandfunfree-runningfitnessprogram, teaching you to moveefficiently and safely, developingcritical thinking skills and overallawareness
Development/Competitive streamKGTC offers artistic men’s and women’s,trampoline,tumbling,andcheerleading programs Athletes learn to train and train to win
adult Drop-in (18+ yrs, Co-ed)Allabilitieswelcome!Supervisedbycoaches to ensure safety while you explorethefunofmovement.
Registered adult ProgramsCheck out our website for further information
birthday PartiesSundays throughout the year.Games, pit relays, trampoline, andrope swings Incredible fun with friends and family!
Camps/special eventsPro-ddayCamps/ChristmasCamps/Spring Break Camps/Summer FunCamps/Parents’NightOut
Registrationisavailableonline24/7!For detailed schedules and program information,visitwww kgtc ca
![Page 69: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/69.jpg)
67kamloops.ca/recreation 250.828.3500
pacific sport
laCRosselacrosse bCCome out and play Canada’s oldest sport-thefastestgameontwofeet!SeasonalprogramsincludebothBoxandFieldlacrosseinafun,safe,anddevelopmentalclubenvironment.Allages and skill levelswelcome.Visitour website for additional information and registration KamloopsRattlersLacrosseClubBCRegionalCoach/President: Doug Clarkpresident@kamloopsrattlers comwww kamloopsrattlers com box lacrosse ProgramsRegistration: January of each year viawebsite. Season:March-June.Mini-Tyke-5-6yrsTyke-7-8yrsNovice-9-10yrsPeeWee-11-12yrsBantam-13-14yrsMidget-15-16yrs
field lacrosse ProgramsRegistration: July of each year viawebsite Season:September-december.Under 8 (U8)Under 10 (U10)Under 12 (U12)Under 14 (U14)Under 16 (U16)
Save these dates and check ourwebsite frequently for the latest information and program updates
sofTballKamloops Minor fastball associationwww kamloopsminorfastball comEmail: kmfa2001@yahoo caContact: VinaNeumanat 250-554-2138Find us on Facebook!
sPeeD sKaTInGKamloops long blades speed skating Club CoachCoordinator:SandiVyse250-573-4517or250-851-1481Email: speedskate@shaw cawww kamloopslongblades comPractices are Monday, Tuesday,Wednesday, andThursdayeveningsatMcArthur IslandSportandEventCentre. Competitive, Recreational,High Performance, Learn to Skate,andLearntoSpeedSkateprograms.All ages and abilities welcome New and improved Skating andSpeedSkatingLessons!Fee is$75,payable by cash or cheque
learn to skate/learn to speed skate Weareofferingsix-weeklessonsforboth Learn to Skate and Learn toSpeedSkate.Mondays, Jan 26-Mar 9 (no skating on Family Day)Participants are welcome to use Kamloops Long Blades skates at noextracost,ortheirownskates.Otherequipment will be needed and discussed at time of registration Participants need to be able to skate across the width of aniceranktoparticipateintheLearntoSpeedSkateprogram.
Club ProgramsRegistration is ongoingRecreationalpracticeonceperweek,Competitivetwiceperweek,andHighPerformance four times per week Try it once before joining the club Early bird and family discounts available. Speed skates includedwith registration
sWIMMInGKamloops Classics swimming Head Coach: Brad Dalkewww swimkamloops comadmin@swimkamloops comCanada Games Pool 910McGillRoad250-828-3660
Kamloops Classic Swimming isdedicated to providing the best availableteaching,coaching,training,&competitiveopportunitiestoalllevels of swimmers at an affordable cost
learn to swim with swimskill lesson ProgramOur learn to swim program (forages 5-12) focuses on strokedevelopment. Register online atwww swimkamloops com or by phone at 250-828-3660. $130 forsixteen 45-minute sessions (greatvalueat$10.83/hour).
Winter session - all levels*MondaysandWednesdays,Jan12-Mar9,3:30or4:15pm(No lesson Feb 9)*TuesdaysandThursdays,Jan13-Mar10,3:45,4:30,or5:15pmMini-Meet-AllswimmersWed,Mar11,3:30-5:00pm.
spring session - all levels*MondaysandWednesdays,Mar25-May27,3:30or5:15pm(NolessonApril3,6,orMay18)Mini-Meet-AllswimmersFri,May29,3:30-5:00pm.
Club swimmingWhetheryouryoungathleteislookingforasportforpersonaldevelopmentandfun,orlookingforacompetitivesport they can grow into, ClubSwimming is a great choice! Thisyear-round training program is forall ages and levels. The coachingstaffareprofessionallycertified,andathletes have regional/provincial/national competition opportunities
Masters swimmingFor those swimmers 19 years of age orolderwhowant to improve theirswimmingskillsandstamina,here’san opportunity to meet and make newfriends,compete,andtravel.Mon,Wed,6:30-7:30pmFri,6:00-7:00am FREEONE-WEEKTRIALANYTIME!Ongoingregistrationatwww.swimkamloops.com,orcall250-828-3660.
![Page 70: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/70.jpg)
68
pacific sport
synCHRonIZeD sWIMMInGKamloops sunrays synchronized swimmingPresident:MandyCurtiswww kamloopssynchro comkamloopssunrays@gmail com
Love to dance? Interested ingymnastics? Are you artistic?Expressive? do you like to swim?Then synchronized swimming is foryou!Synchronizedswimmingisasportofstrength,flexibility,andcreativity.Itisdemandingbutfun.Inthewater,synchronized swimmers achievethe aquatic endurance of speed swimming, theprecisionandpowerof gymnastics, and the artistry ofdance.TheKamloopsSunraysofferaffordableintroductory,recreational,andcompetitiveswimmingprogramsforbeginnertoadvancedswimmersfrom the ages of 7 to 19, as wellas Masters sessions for swimmers over18.
free see It, Try It sessionsFind out if synchro is the sport for you and see where you should begin yoursynchronizedswimmingcareer.drop-in sessions at the CanadaGames Pool are available. Pleasevisit ourwebpage to see upcomingdates and times
Call from anywhere in Kamloops, and we will safely drive you and your
vehicle home.
November 28 and 29December 5, 6, 12, 13, 19, 20, 26,
27, and 31
250-372-5110All donations go to Paci�cSport and supporting amateur athletes in Kamloops.
TennIsKamloops Tennis CentreRegional Head Coach: Kelly Hubbardwww kamloopstennis cominfo@kamloopstennis com250-372-1783
Junior Tennis ProgramsAges5-17
adult Tennis ProgramsAdultprogramsrunyear-round.Formoreinformation,visitwww kamloopstennis com or call 250-372-1783.
![Page 71: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/71.jpg)
69kamloops.ca/recreation 250.828.3500
pacific sport
Youth SPORTS CAMPSPro D Day CampsEvery Pro D day, there is a camp that o�ers your child the opportunity to experience Olympic and Paralympic sports. Your child will spend the day learning traditional and non-traditional sports led by certi�ed coaches from our community, plus enjoy a recreational swim! We invite Olympians, the Kamloops Blazers, Olympic hopefuls, high-level coaches, and other sport experts to share their experiences and skills with your child. Join us and �nd your game! Ages 7-12.
Thursdays, April 2-May 21 TCC North Court6:30-8:30 pm Course No. 235433
Date Location Course No.Friday, February 20 TCC North Court 234683Monday, April 20 TCC North Court 234687Monday, May 11 TCC North Court TBA
$25 per child 8:30 am-4:30 pm
Two NUT-FREE snacks are provided.
Spring BreakAre you looking for something fun and active for your child this Spring Break? Try our popular XploreSportz Spring Break Camps! Each day, the kids will participate in two di�erent sports and a recreational swim at the Canada Games Aquatic Centre. Ages 7-12.
Date Location Course No.
March 16-20 TCC North Court 234697
March 23-27 TCC North Court 234698
$150 per child, $130 for each additional child.
Includes two NUT-FREE snacks each day, a camp T-shirt, and a prize!
In this fun, non-competitive, skill-based environment, girls ages 7-12 have the chance to try two sports and a recreational swim. A certi�ed female coach will introduce the girls to the skills and games relating to their sport or activity. Improve your athletic skills and con�dence while making new friends!
TBA
![Page 72: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/72.jpg)
7070
![Page 73: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/73.jpg)
71kamloops.ca/recreation 250.828.3500 71kamloops.ca/recreation 250.828.3500
LEARN TO SKI OR SNOWBOARD PROGRAMSThe perfect introduction for first time skiers and snowboarders including lesson, equipment rentals, and learning area pass. Available daily.Sun Kids (6–12) Full Day Includes supervised lunch (9:00am to 3:30pm): $99Morning (9:00am to 12:00pm): $80 Afternoon (1:30pm to 3:30pm): $59 Youth & Adult (13+)Full Day (9:00am to 3:30pm): $99 Afternoon (1:30pm to 3:30pm): $69
NORDIC SKIING PROGRAMSIntro to Nordic PackageIncludes a Nordic ticket, rental gear, and 2 hours of instruction for the perfect introduction to Nordic skiing.$69 | Daily: 9:00am, 11:00am, and 1:30pm
2 Hour Group Lessons$59 | Daily: 9:00am, 11:00am, and 1:30pm
Private LessonsAdd a friend to your private lesson for just $38!2 Hours: $115 | Daily: 9:00am, 11:00am, and 1:30pm1 Hour: $79 | Daily: 9:00am, 10:00am, 11:00am, 12:00pm, 1:30pm
FREESTYLE PROGRAMSTaught by certified Freestyle Coaches for all ability levels, learn the fundamentals of Freestyle skiing and snowboarding in a fun and safe environment.Weekend Programs (6–12 years & 13–18 years)10 Consecutive Full Day Saturdays Program: $399 (1 Day $79)Starting January 10, 10:00am to 3:00pm10 Consecutive Half Day Sundays Program: $219 (1 Day $49)Starting January 11, 1:00pm to 3:00pm3-Day Freestyle Camps (6–12 Years): $129December 26–28 and March 14–16, 9:00am to 12:00pm
SPREAD ACROSS THREE AMAZING PEAKS!
ONE GIANTCLASSROOM
LOCALS PROGRAMSEnjoy 10 consecutive weekly lessons at a great price, with the same instructor and group of peers. Local Kids (4–12) 10 Consecutive Weeks: $205 Choose from either 10:00am to 12:00pm or 1:00pm to 3:00pmSaturdays, starting January 10; Sundays, starting January 11 Local Adults (13+)10 Consecutive Saturdays: $309 Starting January 10, 10:00am to 12:00pm
OFF-PISTE PROGRAMSSo much more than world-class groomers, Sun Peaks was developed in the 1960s for its steeps, glades, moguls, and exceptional powder skiing. These camps are tailored for intermediate to expert skiers—let us show you the ropes!Beyond the Groomers CampDiscover the best hidden stashes along with lift line priority, video analysis, and après ski.3-Day Camp: Adults (13+) $399 | Kids (6–12) $329Monday to Wednesday, 9:00am to 3:00pm each dayAll Mountain Skills CampIntroduction to terrain assessment, hazard analysis, overnight survival, and companion rescue; with transceiver, probe and shovel techniques.2-Day Camp: Adult (13+) $299 | Youth (10–16) $259Thursday to Friday, 9:00am to 3:00pm each day
Whether you’re new to our mountains or a seasoned veteran, you can always improve. Develop your technique, define your style, and enrich your experience on the snow at Canada’s second largest resort!
Rates are subject to tax and unless otherwise stated,do not include lift tickets. Subject to change without notice.
For more information call 250.578.5505or visit SunPeaksResort.com/School
![Page 74: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/74.jpg)
7272
www.vvsc.ca or [email protected] for registration informationion
TAKE YOUR SKATING TO THE NEXT LEVELPOWER SKATINGHockey players - improve your strength, speed andagility on the ice!
www.vvsc.ca
Winter sessions beginthe week of January 5th, 2015
SHITO-RYU KARATETraditional Okinawan/Japanese • In Kamloops Since 1984
Muso Jikiden Eishin Ryu & Takeda Ryu Iaido (Sword) - Call for infoMonday & Wednesday on the Southshore at Lloyd George School
Children • Aged 7 - 13 • 6:00 - 7:10 pm Adults & Students • 7:15 - 9:00 pm
TRY OUR FREE INTRODUCTORY WEEKFEES: Children & Students: $ 0/month • Adults: $ 0/month
No Contracts • GST/PST Included • Plus Association Dues • Family rates available
INSTRUCTORS: Paul and Charlotte RobertsonInstructors are certifi ed by Karate Canada
and have been police checked.
For information contactPaul or Charlotte at 250-376-7551
Member of Karate BC, Sport BC, Karate Canada & Sport CanadaRenshikan
St. Andrews Presbyterian Church - 6th Ave & Douglas StMondays: 1st, 3rd, 5th Children 6:30-7:40pm Students/Adults 7:45-9:30pmWednesdays: Children 6:00-7:10pm Students/Adults 7:15-9:00pmFridays: 2nd, 4th Children 6:00-7:10pm Students/Adults 7:15-9:00pm
We also teach Iaido - Japanese sword on Saturdays 9:00 to 10:30am - $40.00 month
FEES: Children & Students: $60/month • Adults: $70/month
![Page 75: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/75.jpg)
73kamloops.ca/recreation 250.828.3500 73kamloops.ca/recreation 250.828.3500
Creative Beginnings1440 Hugh Allan Drive (Beside Aberdeen McDonald’s)
PRESCHOOL Mon/Wed/Fri 8:45-11:15 $165/monthTues/Thurs 8:45-11:15 $110/monthTues/Thurs 11:30-2:00 $110/monthDAYCARE/PRESCHOOL0-3 years: prices vary3-5 years: Full-time $675/month ~ $40/dayAFTERSCHOOL CARE$340.00/month(Pickups from Summit, McGowanAberdeen,Dufferin,Paci c Way)
*Montessori enhanced program *Self-motivated learning experiences*Extensive academic programming *Language and Reading Programs
REGISTER NOW - SPACES ARE FILLING
Cheapest Rates in Kamloops!
250-377-8700 or 250-319-8586www.creativebeginningspreschool.ca
![Page 76: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/76.jpg)
7474
A Safe & Clean Indoor Play Centre for
children and their families
Have fun on the interactive game fl oor, climb up to the top of the treehouse and be sure to check out our themed crafts each week.
We have sandwiches, treats, specialty coffees and real fruit smoothies.
Check Facebook for our winter programs and information on our monthly pizza nights!
DROP-IN PLAY ADMISSION
WE DO BIRTHDAY PARTIES!
UNLIMITED PLAY TIME
701-1801 Princeton Kamloops Hwy, Kamloops • 250-377-7529Monday - Friday 9:30am - 4:30pm ~ Sat/Sun 10:00am - 5:00pm • www.lilmonkeystreehouse.com • Find us on Facebook!
![Page 77: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/77.jpg)
75kamloops.ca/recreation 250.828.3500 75kamloops.ca/recreation 250.828.3500
START CURLING THIS WINTERLEARN TO CURL8 Week Program: $99 + taxWednesdays at 7pm January 14th - March 4th
19+, LOTS OF FUN • COACHING AND EQUIPMENT PROVIDED • NO CURLING EXPERIENCE NECESSARY!
SPONSORED BY
![Page 78: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/78.jpg)
7676
![Page 79: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/79.jpg)
77kamloops.ca/recreation 250.828.3500 77kamloops.ca/recreation 250.828.3500
BEAVERS: AGES 5-7 SHARING-SHARING-SHARING CUBS: AGES 8-10 DO YOUR BEST!SCOUTS: AGES 11-14 BE PREPARED
VENTURES: AGES 14-17 PLAN YOUR OWN PROGRAM
OTHERS: BE PART OF THE SERVICE TO COMMUNITY...
VOLUNTEER YOUR TIME...VOLUNTEERS FROM THE UNIVERSITY ACQUIRE
SERVICE HOURS FOR YOUR PROGRAMS
FOR MORE INFORMATIONCall Roxy 250.374-1137www.scoutskamloops.ca
PAID ADVERTISEMENT
BE PART OF THE ADVENTURE!THERE’S A PLACE FOR YOU IN SCOUTING
![Page 80: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/80.jpg)
7878
Boys and Girls Club of
Kamloops has been providing essential programs
and services for children, youth and families,
since 1955.
Come see us at our new location! John Tod Centre – 150 Wood St
www.bgckamloops.com 250-554-KIDS (5437)
Parenting Skills &
Family Meals
RECREATIONAL & SOCIAL SKILLS
AND MUCH MORE!
![Page 81: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/81.jpg)
79kamloops.ca/recreation 250.828.3500 79kamloops.ca/recreation 250.828.3500
CLASSES RESUME ON JAN.5TH, 2015
ACTING
My World of Discovery Childcare
Open Monday to Friday6:45am - 5:00pm
Ages 11 months - 12 yearsDrop o� and Pick up at
Arthur Stevenson Elementary
Limited space also available at the Aberdeen Location - 250.828.6603
Westsyde Campus
Gorgeous and safe location, full size
gymnasium, excellent programs and big
private playground.
myworldofdiscoverychildcare.weebly.com
2826 Bank Road,Kamloops, B.C.778.472.3303
Find us on Facebook!www.facebook.com/pages/My-World-of-Discovery-Childcare
![Page 82: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/82.jpg)
8080
Get in Sync with the SunraysSynchronized swimming combines athleticism, artistry and teamwork in a challenging, supportive and fun environment• A range of programs, from recreational to competitive, start at age 6• Excellent athlete to coach ratios• Train at Canada Games Pool
For more info, please see our website www.kamloopssynchro.com or email [email protected]
www.kamloopssynchro.com
Call for FREETrial Class!
See It Try ItRegular classes throughout the year, check our website for dates and times!
Regular Classes Began September 8th - If you are interested in joining please Call 250.377.1249
YMCA YWCA Violence Against Women Intervention
and Support Services
• Y Women’s Emergency Shelter 250.374.6162Text: 250.682.7931
• Children Who Witness Abuse Program
250.376.7800
• Outreach Services Program 250.320.3110
Building healthy communities
653 Victoria St. • highcountrystainedglass.com
For more info or to register for a class, call 250-851-0876
High Country Stained Glass
Looking for a Winter Escape?
Come in this Winter and Learn how to Brighten your Life with Stained Glass!
No experience necessary classes for all ages!
Cafe withSupervisedPlay Area
Drop in Childcare
SchoolLunchProgram+ +
sweethomecafeforyou.com / Phone 778-471-5579 / #2 1380 Hillside Drive Sweet Home Cafe
Makes Both Parents and Kids Happy
Before/After school care - licensed group care - exceptional educators for children who attend South Sahali Elementary
We operate Mon-Fri 7:30 am- 5:30 pm (including non instructional days)
![Page 83: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/83.jpg)
81kamloops.ca/recreation 250.828.3500 81kamloops.ca/recreation 250.828.3500
Learn to Skate with the Best!
NATIONAL COACHING STAFF• Coach Heather Ansley ~ Team Leader For Skate Canada• Coach Jennifer Yates ~ National Coach• Teaching all levels and disciplines of skating for ages 3 & up• Programs include Learn to Skate, Freestyle, Ice Dance & Pairs • Private, Semi Private & Group lessons
REGISTRATION AT McArthur Island Sports CentreDecember 8 • 4:30 pm - 6:00 pmDecember 9 • 5:30 pm - 7:00 pmJanuary 5 • 4:00 pm - 6:00 pmNext program starts Jan. 6 & 7Visa, Mastercard or Debit
Call 250-554-4944 Download registration form at [email protected]
Check our website forcoaching updates!
at at omom
Find us on Facebook!
![Page 84: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/84.jpg)
8282
real women. real harmony. real fun.rreeaall wwoomen.nn rreeaall hhaarrmmoonnyyy.r rrreeeaaalll fffuuunnn..
We invite you to come and experience Desert Sounds Harmony Chorus
during a weekly rehearsal - you can sing 4-part A Cappella
harmony with this exciting group of women who share a common goal of musical and performance excellence.
Curious?Come and join the fun on Tuesday evenings!
Rehearsals at St. Andrews Presbyterian Church, 1136 6th Avenue, 6:30pm
Contact Leanna @ 778.220.0325 or Deb @ 250.318.7290
Visit us at dshchorus.ca
2014 Desert Sounds Harmony celebrates 35 years
www.KamloopsMontessori.ca
OPEN HOUSE
Feb. 28th 10am - 2pm
ACCEPTING NEW STUDENTS!
For January 2015
Visit our website for registration info.
KAMLOOPS VILLAGE GARDEN MONTESSORI EARLY LEARNING CENTRE
700 Hugh Allan Drive 250-372-9915
KAMLOOPS MONTESSORI PRESCHOOL/KINDERGARTEN
920 Greystone Crescent250-372-9945
ABERDEEN HILLS MONTESSORI PRESCHOOL KINDERGARTEN
2191 Van Horn Drive • 250-372-9940 located in Aberdeen Elementary School
SAHALI MONTESSORI PRESCHOOL KINDERGARTEN
700 Hugh Allan Drive250-374-4264
Developing
HarmonyIn Life.
Fostering a
PassionFor Excellence.
Building
Character& Universal Values
Encouraging
ServiceTo Humanity
Providing Excellence in Montessori Education Since 1998
Kamloops
MONTESSORI
D
HD l i F i
PPi
CCCB ildi Encouraging
CHILDCARE • PRESCHOOL / KINDERGARTEN • BEFORE & AFTER SCHOOL CARE PROGRAMS
INVESTING IN THEIR FUTURE MADE EASY.
A Division of Peace Educational Services Corp.
![Page 85: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/85.jpg)
83kamloops.ca/recreation 250.828.3500 83kamloops.ca/recreation 250.828.3500
Junior Lessons - Private$40 for 45 minutes. Lessons included practice time before and after each lesson.
• Voted #1 Golf Instructor in Kamloops• CPGA Professional for 16 years• 2008 Kamloops Sports Council Coach of the Year• 6 years as Head Coach for the TRU WolfPack Golf Team - 2008 National Champions• 17 Professional Wins• Former PGA of BC player of the Year and Order of Merit Winner• NCAA Div. 1 4 Year Letter Award Winner - Golf Scholarship
Short Game Lessons - $45Beginner and intermediate Golfers welcome. Lessons designed for those looking to improve on stroke saving shots from 75 yards and in. 1 hour Free Practice time after each lesson.
6:00-7:30pmClass 1 - Putting - April 22Class 2 - Bunker Play - April 27Class 3 - Chipping and Pitching - April 29Class 4 - Bunker Play - May 4Class 5 - Putting - May 11
Private Lessons - Beginner to Professional golf-ers welcome. All lessons include V1 Video Analysis. Private lessons to accommodate your schedule and time. Unlimited practice time before and after each lesson. All aspects of golf covered. 1 lessons - $60 3 lessons - $160 5 lessons - $250
Group Lessons Put a group together and give me a call or send me an email as these packages are quoted on class size and number of lessons. Free practice time included with each package.
Ladies (19+): 6:00-7:15pmClass 1 - April 21, 23, 28, 30Class 2 - May 5, 7, 12, 14Class 3 - May 19, 21, 26, 28Class 4 - June 2, 5, 9, 11
Active Adults (50+): 10:00-11:00amClass 1 - April 21, 23, 28, 30Class 2 - May 5, 7, 12, 14Class 3 - May 19, 21, 26, 28Class 4 - June 2, 5, 9, 11
Adult Mixed (19+): Mondays 6:00-7:15pm4 week classClass 1 - May 4, 11, 18, 25Class 2 - June 8, 15, 22, 29
FREE CLASS! - Your choice of the following dates. 9:00-10:15amMay 16, June 13 or July 11
LEARN TO GOLF - PLAY BETTER GOLF IN JUST TWO WEEKS! Fee: $99.00Beginner and Intermediate golfers welcome. Lessons designed for those looking to take up the game or sharpen their skills. Small class size ensures maximum personal instruction. Golf lessons covering the full swing, chipping, putting, pitching, sand play, basic rules and etiquette. 15 minute Free Practice before and after each lesson. Sign up today - pay later - and receive a 5th Lesson FREE.
CONTACT: The Dunes Pro Shop250.579.3300 • [email protected] • golfthedunes.com
Golf Lessons
![Page 86: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/86.jpg)
8484
Winter/Spring Sessions start February 2nd• Active Kidz Gymnastics (14 mths- 5 yrs)• Recreational Gymnastics (6+ yrs)• Performance Gymnastics• Developmental Gymnastics (boys & girls)• Competitive Gymnastics & Trampoline• Birthday Parties• 10 and 20 week programs
REGISTER ONLINEDecember 15 th
tt FFrs)
rls)er
FFeebbruaarryy 22nnddd
)
December
www.kgtc.caKamloops Gymnastics | Trampoline | Cheer
P. 250.374.6424 E. [email protected] KGTC - 910 McGill Road (inside TCC)
![Page 87: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/87.jpg)
85kamloops.ca/recreation 250.828.3500 85kamloops.ca/recreation 250.828.3500
FINE ART PAINTING CLASSES
Oil & Acrylicwith
PROFESSIONAL ARTISTDEBBIE MILNER LIVELY
BEGINNER TO ADVANCEDAGES 12 AND UP
debbiemilnerlively.com
Phone: 250-320-3779
Come paint with Debbie in a positive,
encouraging atmosphere!
KAMLOOPS MINOR HOCKEY ASSOCIATION
HOCKEY PROGRAMS FOR BOYS & GIRLS AGED 4 – 17Thank you to all our valued sponsors and volunteers for
helping keep 1350+ kids playing hockey!
2015/2016 SEASON REGISTRATION
Registration for returning players will open online February 2nd, 2015.
New + Transferring player registrations will be accepted starting June 1st, 2015
Join us on Wednesday, March 11th, 2015
at McArthur Island Sports Centre for our
ANNUAL NIGHT OF CHAMPIONS
Check out our website at www.kamloopsminorhockey.com for Weekend Game Schedules, Tournament Dates,
Team and Division information plus more!Phone: 250-376-1788 Email: [email protected]
![Page 88: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/88.jpg)
8686
February 28, 2015
Register For Music Lessons Today.Reg
Why Choose Long & McQuade?Music lessons for all ages, stages and styles.Professional instructors make learning fun.Convenient lesson times for busy families.
No Registration Fees. Affordable Instrument Rentals.No
hW
Where tWhere the music begins!
955 Lorne St., Kamloops 250.828.2315
Yamaha group music classes are available for children 3 and up. Call for a free demo.Yama
Guitar, Piano, Drums, Bass, Sax, Flute, Trumpet, Violin, Clarinet ,Voice and More!
Yamaha Junior Group Classes - Intro to music for Ages 3 & up. FREE DEMOS!
Guitar, Piano, Drums, Bass, Sax, Flute, Trumpet, Mandolin, Clarinet, Dobro, Voice and More!
![Page 89: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/89.jpg)
87kamloops.ca/recreation 250.828.3500 87kamloops.ca/recreation 250.828.3500
Copy
right
201
3, M
ake
Child
ren
Firs
t Kam
loop
s M
CFK-
011
Des
ign
by w
ww
.koc
hink
.com
![Page 90: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/90.jpg)
8888
250-374-6683leesmusic.net•1305 Battle St.
Sales • RepairsLessons • Service
$130 - 16 lessons – 45 MINUTE LESSONS!
Monday & Wednesday January 12th - March 9th • 3:30 or 4:15 pm
Tuesday & Thursday January 13th - March 10th • 3:45pm, 4:30pm or 5:15pm
*No class on February 9th
MINI-MEET FUN DAYWednesday, March 11th – 3:30 - 5:00pm
YOUTHSWIM LESSONS
WINTER SESSIONS 2014(Ages 5-12)
REGISTER NOW!Full registration online at
swimkamloops.com(250) 828-3660
[email protected]/MC Accepted
FREE SWIM ASSESSMENTS!
MASTERS SWIMMINGCertifi ed Coaches • Improve your stroke
Fun, social atmosphere • Recreational to competitiveMONDAY/WEDNESDAY 6:30-7:30PM
FRIDAY 6:00-7:00PM
AGES 18+CLUB SWIMMING
Whether your young athlete is looking for a sport for personal development and fun,
or looking for a competitive sport they can grow into, Club Swimming is a
great choice!
This year-round training program is for all ages and levels. The coaching staff are professionally certifi ed, and athletes have regional/provincial/
national competition opportunities.
FREE ONE-WEEK TRIAL ANY TIME!
AGES 6-19
![Page 91: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/91.jpg)
89kamloops.ca/recreation 250.828.3500 89kamloops.ca/recreation 250.828.3500
We are offering a FREE OPEN SKATE at MacArthur Island Park on Sunday, December 7th, 3 to 4 pm.
Come and try on and try out speed skates on the ice; meet the coaches and some of our more experienced speed skaters; as well as register for the winter sessions.
Kids Learn to Skate: (must be 4 years or older)Winter: 8 classes from January 15 – March 5 2015Thursday’s @ McArthur Island Park5:30 pm – 6 pm$90 with equipment; $70 without equipment
Intro to Speed Skating: (kids and adults welcome!)Winter: 8 classes from January 15 – March 5 2015Thursday’s @ McArthur Island Park4:45 pm – 5:30 pm$100 with equipment; $80 without equipment
Experienced Speed Skaters: September – March 2015McArthur: Thursday: 4:00 pm – 5:30 pm Friday: 6:30 am – 7:30 am Sunday: TBAPrice TBA
Programs: Note – all times are subject to change see website for detailsFor more information please contact Michelle at [email protected] our website www.kamloopsspeedskating.com
The Kamloops River City Racers Club (RCR) offers recreational and competitive programs for the skating enthusiast wishing to learn how to skate or more uniquely, how to speed skate! Qualifi ed coaches & master mentors provide a safe, team oriented, EASY and FUN environment to help YOU learn fundamental techniques & skills through games, drills & interclub competitions.
RCR will be providing the learn to skate + learn to speed skaters with all the equipment needed: helmet, speed skates, neck guard & knee pads. (fi rst come fi rst served!)
Come and be a part of one of Canadian’s favourite pastimes –
SKATING & SPEED SKATING!
Skating Made Fun And Easy - Be A part Of The Uniqueness!
![Page 92: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/92.jpg)
9090
Fresh Prints: Carving CommunityWednesday, January 21, February 4, 18, March 4, 183:00 to 5:00 pm
Youth and Young Adults$50 (Members) / $80 (Public) per five-class course
Fresh Prints is an after-school printmaking program for youth and young adults facilitated by local printmaker and KAG art instructor Melaina Todd. Suitable for beginners and intermediate printmakers, Todd will guide participants to develop their skills as they work to carve their image into a 12”x12” square of linoleum. Registration is required.
465 Victoria Street • 250.377.2400 • kag.bc.ca
![Page 93: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/93.jpg)
91kamloops.ca/recreation 250.828.3500 91kamloops.ca/recreation 250.828.3500
We o� er an introductory program for youths. Beginners learn the fundamentals of diving in a fun and safe environment and
individual’s progress at their own rate. Classes are o� ered Monday through Thursday – Choose a one day or two day a week program.
FunDive is where the emphasis is on fun!
Wth
indthrou
Visit our website @www.riptech.caand register today!250-320-0436
ugughh ThThurursdsdayay – C Chohoososee aa ononononeee e dadayy y y y oror tt ttwowowowo d d dayay aa a ww wweeeeeeekk prprogograramm. eeee isisisis wwwwww wwwheheheherererere ttt thehehehe eee empmpmpmppphahhahahahahahahasisisisisisssss isisisiiis oo onnn ffufufun!n!n!
ththrorouuFuFuFuFunDnDnDnDiviviviveeee
Winter FunDive 2015Age Group Day Time First Class Last Class # Weeks Fee
5-16 years
Monday 6:00-7:30pm January 5 March 9 9 $167
Tuesday 6:00-7:30pm January 6 March 10 10 $185
Wednesday 6:00-7:30pm January 7 March 11 10 $185
Thursday 6:00-7:30pm January 8 March 12 10 $185
Pre-Competitive & Competitive – Invitation OnlyAge Group Day Time First Class Last Class # Weeks Fee
5 - 16 yearsTuesday
Wednesday & Thursday
5:30-7:30pm January 6 March 12 10
Varies based on the level of meets
Please note: All must pay a $25 registration fee
(valid from September 2014-August 2015) • Pool Closure: February 9thParticipants must be comfortable swimming alone in deep water.
Instructors will not be in water with class.
REGISTER BY DECEMBER 1ST AND RECEIVE
$10 OFF!
FREE DIVING LESSONS!
Nov. 25, Dec 2 & 9 6:00-7:30pm
Learn to dive!
![Page 94: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/94.jpg)
9292
YEAR-ROUND TENNISBeginners Welcome!
We have 5 heated, well-lit indoor courts.PLAY NOW WITH REDUCED DROP-IN RATES!
Leagues ~ Lessons ~ Socials ~ Tournaments
Annual, seasonal, monthly memberships and pay-as-you-go punchcards available.
New memberships receive a 20% discount
www.kamloopstennis.com. a ooooooopppppppppppste
250-372-1783748 Front St
![Page 95: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/95.jpg)
93kamloops.ca/recreation 250.828.3500 93kamloops.ca/recreation 250.828.3500
For more informationcall 250.376.3900
Royal Canadian Army Cadets2305 RCAC meets Mondays from 6:00 pm - 9:15 pm
at the Cadet Hall at 169 Briar Ave.Cadets Parade: 6:00pm
Boys & Girls 12 - 18 years old are welcome to enrollUniforms are loaned at no charge
• Map & Compass • Field Craft • Biathlon • Adventure Training • First Aid • Marksmanship • Drill • Band
The purpose of the Cadet Program is to develop the attributes of good citizenship and leadership, to promote physical tness and to stimulate an interest in the
activities of the Canadian Forces.
Our educators will provide:Freedom of choice • Independence
Love for learning • Practice of virtues Pre-Literacy • Science & culture • Concrete
& abstract math concepts • Music & art
3-6 Spaces Available in full day Montessori or Reggio programs
- Limited pre-school spaces available -
We would love to have you join us!
3 LOCATIONS
520 6th Avenue • 250-828-6675 1565 Summit Drive • 250-828-2533
Gingerbread House Daycare • 250-828-2045
Ages 12 months - 12 years Monday - Friday • 7:00 am - 5:30 pm
www.sixthavenuechildcare.com
6TH AVENUE MONTESSORI
Our Summit location has space available in our after school, and 3-5 daycare. Part time
spaces available in our infant and toddler area.
Accepting registration at our downtown location in our
infant/toddler area
KAMLOOPS
KK AA RR AA TT EE CC LL UU BB
1080 Kenora AveKamloops Judo Centre
For more info: 250.573.6063Traditional Karate practiced in Kamloops since 1972.
Tuesdays & Thursdays – 7:00-8:30pm
Take part in Adult Karate Classes (ages 13+), and let Karate bring
out the youth in you!
![Page 96: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/96.jpg)
9494
Kamloops Healthy Weights for Children
Shapedown BCShapedown BC: A FREE program for children and teens
(aged 6-17) and their families
SHAPEDOWN BC is a family based group program that helps children and teens, and their families, achieve a healthier lifestyle.
HOW DOES IT WORK? Through aged based group programs and individualized support, the Kamloops Shapedown team of a Registered Dietitian, Fitness Instructor, Registered Social Worker and Pediatrician, helps families to make positive changes in eating habits, activity level, parenting skills and self-esteem.
HOW DO I JOIN? Ask your family Doctor, Pediatrician, or Nurse Practitioner to send us a referral. Or contact us for more information.
Kamloops Healthy Weights for Children
Shapedown BCPublic Health519 Columbia Street, Kamloops, BC V2C 2T8PH: 250.851.7300 | FAX: 250.851.7301www.interiorhealth.ca/Shapedown
Sha
Kafoo
en and teens
Station Plaza 5-510 Lorne Street
Music programs for students of all ages that include preparation for:> recitals> festival performances> conservatory exams> post-secondary entrance auditions
GROUP CLASSESSunrise Program for ages 2-3Music for Young Children Program for ages 3-8Chamber MusicYouth String Orchestra
PRIVATE LESSONSPianoTh eoryVoice
Strings Bass Cello Violin
Woodwinds & Brass Bassoon Clarinet Flute French Horn
Oboe Saxophone Trombone Trumpet
![Page 97: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/97.jpg)
95kamloops.ca/recreation 250.828.3500 95kamloops.ca/recreation 250.828.3500
Winter CanSkate Sessions
Starting week of January 5, 2015
Registration days: Wednesday, December 3rd from 5-7pm
Monday, December 8th from 5-7pm at Valleyview Arena , or register anytime by mail
Registration for those skaters currently registered in the Fall CanSkate sessions will be available at the CanSkate Table during the last two weeks of Fall CanSkate sessions.
for more information, including Winter CanSkate sessions, other programs offered by VVSC, and
registration forms please visit
www.vvsc.caor email: [email protected]
![Page 98: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/98.jpg)
96
Let our caring sta� and §
volunteers help you achieve
SUCCESS!
An unbeatable package of §
programs and services at an
a� ordable price.
Over 70 � tness classes a §
week included FREE in your
membership. *(Does not apply to fee-based classes.)
NEW § state of the art
equipment
kamloopsy.org §
New John Tod Centre Y now open!Building healthy communities
TRY THE Y FOR A WEEK
Downtown Y400 Battle StreetTel: 250-372-7725
John Tod Centre Y150 Wood StreetTel: 250-554-9622
Valid for ONE WEEK PASS ENTRY to the Downtown or John Tod Centre Y for an adult, youth or child.**Children and youth under 13 must be accompanied by a parent/guardian to redeem pass in fitness area. Age restrictions also apply to pool admissions. No cash value. One coupon per person per calendar year.
kamloopsy.org
STAY FIT.GET CONNECTED.FEEL SUPPORTED.BELONG.
![Page 99: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/99.jpg)
BU
ILDIN
G STR
ON
G CO
MM
UN
ITIES
Village of Lytton
CUPE fi ghts for these CUPE fi ghts for these issues that aff ect workers - issues that aff ect workers -
Locally, Provincially, Locally, Provincially, Nationally & GloballyNationally & Globally
Aboriginal IssuesAboriginal Issues
Child CareChild Care
Collective BargainingCollective Bargaining
Disability rightsDisability rights
EnvironmentEnvironment
Global JusticeGlobal Justice
Health & SafetyHealth & Safety
Health CareHealth Care
LGBTTILGBTTI
LiteracyLiteracy
MunicipalitiesMunicipalities
Pay EquityPay Equity
PensionsPensions
TradeTrade
Racial EqualityRacial Equality
Post Secondary Education Post Secondary Education
WaterWater
WomenWomen
CUPE members are CUPE members are proudproud to to work, live and pay taxes in work, live and pay taxes in
the communities they serve.the communities they serve.
![Page 100: City of Kamloops Winter Activity Guide](https://reader036.fdocuments.in/reader036/viewer/2022081512/568ca77a1a28ab186d95855d/html5/thumbnails/100.jpg)
. . . always putting children fi rst & always going several steps beyond!
25O.319.9O44 • www.kamloopskidz.com
“A lifetime of learning begins here”Valleyview Campus1764 Valleyview DrivePreschoolChildcare - Ages 1 to 12
Sahali Campus1585 Summit Drive PreschoolChildcare - Ages 5 to 12
Pineview Campus 1711 Copperhead DrivePreschoolChildcare - Ages 1 to 12
PROGRAMS WE OFFER ARE:• Infant/Toddler: 7:30 am to 5:30 pm• Preschool: 8:45 am to 11:15 am OR 11:45 am to 2:15 pm • 3-5 Preschool / Childcare: 7:30 am to 5:30 pm• School Age Care: Before and after school care (including kindergarten children) 7:30 am to 5:30 pm.
Pick up from Juniper, Marion Schilling, Lloyd George, Beattie, South Sahali, Summit, McGowan, Pacifi c Way, Aberdeen, Dufferin.
Our Montessori Enhanced program includes: Montessori prepared environment• Practical Life - activities to aid in developing independence for the child• Sensorial - physical development of the senses• Language - speaking, listening, reading and writing• Mathematics - concepts of number, shape and space• Cultural Studies - enrich the child’s understanding of the world through the study of zoology, botany,
geography, history, art and music
Enhanced environment• Block area and dramatic play area - helps children learn socially, physically, intellectually and creatively• Extensive theme, phonics, art and music program
REGISTER NOW FOR PRESCHOOLCHILDCARE REGISTRATION ONGOING
REGISTERING NOW!
OPEN HOUSE FOR SEPTEMBER 2015 PRESCHOOL REGISTRATIONFEBRUARY 7TH – Visit our website for times...
Mark your calendar, don’t miss out!