Post on 06-Apr-2018
8/3/2019 v3 Mail Server
1/32
CHAPTER 1
OVERVIEW OF PROJECT
1.1 ABOUT THE PROJECT
V3 mailserver is an easy way of transferring mails.The working of the project is as
follows.
In the Login link a user have to login for transferring mails. Next page provides several
links. The Home page contains several links such as my settings, Inbox, Compose, Trash, My folder,
Sent Items, Address Book and Logout.
An already registered user can simply type in -his\her valid username and password, and
then click the "submit" button. But those visitors who are not registered have to go to the registration
page before they login. In that page user have to enter First name, Last name, Address, Postal Code,
City, Phone number, Username and password.
After registration user can sign in and check or send mail .User can add new contacts and
signature. Logout link will help the user to logout from the site.
8/3/2019 v3 Mail Server
2/32
CHAPTER 2
TOOLS
2.1.J2EE SERVER
Java Platform, Enterprise Edition or Java EE (formerly known as Java 2 Platform,
Enterprise Edition or J2EE until the name was changed to Java EE in version 1.5), is a programming
platformpart of the Java Platformfor developing and running distributed multitier architecture Java
applications, based largely on modular software components running on an application server. The Java
EE platform is defined by a specification. Similar to other Java Community Process specifications, Java
EE is also considered informally to be a standard because providers must agree to certain conformance
requirements in order to declare their products as Java EE compliant; albeit with no ISO or ECMA
standard.
Java EE includes several API specifications, such as JDBC, RMI, e-mail, JMS, web
services, XML, etc, and defines how to coordinate them. Java EE also features some specifications unique
to Java EE for components. These include Enterprise JavaBeans,servlets,portlets(following the Java
Portlet specification), JavaServer Pages and several web service technologies. This allows the developer
to create an enterprise application that is portable between platforms and scalable, while integrating with
legacy technologies. Other added bonuses are, for example, that the application server can handle the
transactions, security, scalability, concurrency and management of the components that are deployed to it,
meaning that the developers can concentrate more on the business logic of the components rather than
infrastructure and integration tasks.
Java Platform, Enterprise Edition (Java EE) is the industry standard for developing
portable, robust, scalable and secure server-side Java applications. Building on the solid foundation of the
Java Platform, Standard Edition (Java SE), Java EE provides web services, component model,
management, and communications APIs that make it the industry standard for implementing enterprise-
class service-oriented architecture (SOA) and next-generation web applications.
2.1.1 J2EE Sever And Prepared Statement
When the J2EE server gives your application a connection, it isn't giving you the actual
connection; you're getting a wrapper. You can verify this by looking at the name of the class for the
connection you are given. It won't be a database JDBC connection, it'll be a class created by your
application server. Normally, if you called close on a connection then the jdbc driver closes the
connection. We want the connection to be returned to the pool when close is called by a J2EE application.
We do this by making a proxy jdbc connection class that looks like a real connection. It has a reference to
the actual connection. When we invoke any method on the connection then the proxy forwards the call to
the real connection. But, when we call methods such as close instead of calling close on the real
connection, it simply returns the connection to the connection pool and then marks the proxy connection
as invalid so that if it is used again by the application we'll get an exception.
8/3/2019 v3 Mail Server
3/32
Wrapping is very useful as it also helps J2EE application server implementers to add
support for prepared statements in a sensible way. When an application calls
Connection.prepareStatement, it is returned a PreparedStatement object by the driver. The application
then keeps the handle while it has the connection and closes it before it closes the connection when the
request finishes. However, after the connection is returned to the pool and later reused by the same, or
another application, , then ideally, we want the same PreparedStatement to be returned to the application.
2.1.2.The advantages of J2EE
The J2EE framework today provides the standard platform for distributed applications. It
creates a standard in which application components can be distributed and reused.
The evolution of component frameworks has matured to provide significant benefits for
application development:
Code reusability
Simplification of the development process
Faster maintenance due to smaller units of code
Better performance through load-balancing and distribution of components
Higher scalability of the application
Technically J2EE is not a language; it is a group of specifications, frameworks,
technologies, etc. for building distributed enterprise systems. J2EE is comprised of a number of
programming and scripting languages including Java, XML, JSP, HTML, SQL, and others. Some of the
advantages of J2EE include cross-platform portability, availability of open-source libraries, a huge server-
side deployment base..
EJBs have become today the widely accepted open standard for components. They
provide all the benefits described above and add the important concept of portability. There are numerous
providers of J2EE servers today, all conforming to open standards, thus enabling the customer
to freely choose the environment.
2.2 JAVA SERVER PAGE
Java Server technology consists of Java-based frameworks and APIs that together
provide a versatile combination, capable of building many kinds of server applications that are portable
and scalable.
Front-end servers::- The most visible portion of servers are the front-end Java provides
server APIs for the following:
Message exchanges Java Message Services (JMS) provides message queuing services and
can be used for message business-to-business (B2B) communication or communication between
8/3/2019 v3 Mail Server
4/32
applications (A2A or EAI) JMS provides both point-to-point and publish/subscribe asynchronous
message queuing.
Back-end servers::- built with Enterprise JavaBeans technology provide distributed
business and transaction processing. EJB provides containers for two types of Enterprise JavaBeans,
Session Beans and Entity Beans:
Session Beans provide control over interaction with users. Session Beans can be
"stateless" or "stateful" (such as for shopping carts).
Entity Beans represent persistent entities (such as accounts, product inventory) that are
stored in databases or in external applications.Entity Beans can be managed by the container in what is
called Container Managed Persistence (CMP), or by the bean itself in Bean Managed Persistence (BMP).Both CMP and BMP can use Object Relational Mapping Tools to map beans to database entitites.
Communication with EJB containers uses Java Naming and Directory Services (JNDI) plus Remote
Method Invocation (RMI), and possibly SOAP or JMS. J2EE-branded servers supply a Deployment Tool
that automates the configuration process between the front-end servers and EJB containers and between
containers.
2.2.1 Advantages Of JSP
vs. Active Server Pages (ASP). ASP is a similar technology from Microsoft. The advantages of
JSP are twofold. First, the dynamic part is written in Java, not Visual Basic or other MS-specific
language, so it is more powerful and easier to use. Second, it is portable to other operating
systems and non-Microsoft Web servers.
vs. Pure Servlets. JSP doesn't give you anything that you couldn't in principle do with a servlet.
But it is more convenient to write (and to modify!) regular HTML than to have a zillion println
statements that generate the HTML. Plus, by separating the look from the content you can put
different people on different tasks: your Web page design experts can build the HTML, leaving
places for your servlet programmers to insertthedynamic content.
vs. Server-Side Includes (SSI). SSI is a widely-supported technology for including externally-
defined pieces into a static Web page. JSP is better because it lets you use servlets instead of a
separate program to generate that dynamic part. Besides, SSI is really only intended for simple
inclusions, not for "real" programs that use form data, make database connections, and the like.
vs. JavaScript. JavaScript can generate HTML dynamically on the client. This is a useful
capability, but only handles situations where the dynamic information is based on the client's
environment. With the exception of cookies, HTTP and form submission data is not available to
JavaScript.
vs. Static HTML. Regular HTML, of course, cannot contain dynamic information. JSP is so easy
and convenient that it is quite feasible to augment HTML pages that only benefit marginally by
the insertion of small amounts of dynamic data. Previously, the cost of using dynamic data would
preclude its use in all but the most valuable instances.
http://www.javaskyline.com/learnejb.htmlhttp://www.javaskyline.com/learnejb.htmlhttp://www.javaskyline.com/learnejb.html8/3/2019 v3 Mail Server
5/32
2.3 CLOUDSCAPE DATABASE
A Cloudscape database contains dictionary objects such as tables, columns, indexes, and
jar files. A Cloudscape database can also store its own configuration information.
The Database Directory:- A Cloudscape database is stored in files that live in a directory
of the same name as the database. Database directories typically live insystem directories.
Connecting to Databases:- You connect to a database using a form of the Cloudscape
connection URL as an argument to the DriverManager.getConnection call (see Cloudscape JDBC
Database Connection URL). You specify a path to the database within this connection URL.
2.3.1 Cloudscape Security Features
Because Cloudscape does not support traditional grant and revoke features, the security
model has some basic limitations. For both embedded and client/server systems, it assumes that users are
trusted. You must trust your full-access users not to perform undesirable actions. You lock out non full-
access users with database properties, which are stored in the database (and in an encrypted database
these properties are also encrypted).
Note, however, for a distributed/embedded system that a sophisticated user with the database encryption
key might be able to physically change those properties in the database files.
In addition, in the Cloudscape system, it is not necessary to have a specific connection (or
permission to access a particular database) to shut down the system. Any authenticated user can shut
down the system.
2.3.2 Value-Added Features
Zero administration: IBM Cloudscape can be easily deployed by adding the core database
server with your Java application.
Multiple platform compatibility: IBM Cloudscape fully supports Sun Microsystems Java
technology standards and runs on any standard JVM V1.3, or later. It supports Java 2 and
J2EE.
Full-featured database in compact design: IBM Cloudscape is fine-tuned for efficient use of
resources and a high number of concurrent users. Other features
Read-committed, read-uncommitted, serializable, and repeatable-read isolation
levels
Row-level locking
Optimal transaction performance
Low memory overhead for connections
Fast access time and space reclamation for long rows
Cost-based optimizer that supports hash joins, sort avoidance,
and row-level or tablelevel locking based on percent of data selected
http://publib.boulder.ibm.com/infocenter/cldscp10/topic/com.ibm.cloudscape.doc/develop11.htm%23sii-develop-17453http://publib.boulder.ibm.com/infocenter/cldscp10/topic/com.ibm.cloudscape.doc/develop11.htm%23sii-develop-17453http://publib.boulder.ibm.com/infocenter/cldscp10/topic/com.ibm.cloudscape.doc/develop11.htm%23sii-develop-17453http://publib.boulder.ibm.com/infocenter/cldscp10/topic/com.ibm.cloudscape.doc/develop11.htm%23sii-develop-17453http://publib.boulder.ibm.com/infocenter/cldscp10/topic/com.ibm.cloudscape.doc/develop11.htm%23sii-develop-174538/3/2019 v3 Mail Server
6/32
Fast query compilation
Multiple user support
Built-in performance diagnostics: query statistics, locks, and space usage
Advanced security features Signed Java Archive (JAR) files
LDAP or application-defined secure user authentication
8/3/2019 v3 Mail Server
7/32
CHAPTER 3
PROTOCOLS
3.1 INTRODUCTION
The Java Mail API has been used to implement notification services in J2EE applications.
Emails were an easy way to notify end-users of business events in an application. With the emergence of
new notification channels (such as WAP Phones, Instant Messaging applications, and SMS Pagers),
sending notifications has become more complicated. Now, applications have to support an ever- changing
set of communication channels that end users would like to be notified on. Each of these channels has a
separate API that must be used to communicate with it, so a considerable amount of time will be needed
by developers to code these API's into their applications. Additionally, once developers have finished
building the communication mechanisms, they will also need a way of determining where to contact an
end user at what time (i.e. should an email be sent to the users PC, or should a SMS page be sent to the
users cell phone, or both?).
3.2. SMTP
SMTP or Simple Mail Transfer Protocol is a way to transfer email reliably and
efficiently. SMTP is a relatively simple, text-based protocol, where one or more recipients of a message
are specified (and in most cases verified to exist) and then the message text is transferred. You can think
of SMTP as the language that mail servers use to communicate among themselves.
Since this protocol started out as purely ASCII text-based, it did not deal well with binary
files. When the user wants to send a message to someone, the sender-SMTP establishes a two-way
transmission channel to a receiver-SMTP. SMTP commands are generated by the sender-SMTP and sent
to the receiver-SMTP. SMTP replies are sent from the receiver-SMTP to the sender-SMTP in response to
the commands. In case a direct connection does not exist between the sender and the final destination, the
message may be sent via one or more relay SMTP-servers. The relay SMTP-servers first act as receivers
and then relays the message to the next SMTP. To be able to provide the relay capability the
SMTP-server must be supplied with the name of the ultimate destination host as well as the destination
mailbox name.
Once the transmission channel is established, the SMTP-sender sends a MAIL command
indicating the sender of the mail. If the SMTP-receiver can accept mail it responds with an OK reply. The
SMTP-sender then sends a RCPT command identifying a recipient of the mail. If the SMTP-receiver can
accept mail for that recipient it responds with an OK reply; if not, it responds with a reply rejecting that
recipient (but not the whole mail transaction). The SMTP-sender and SMTP-receiver may negotiate
several recipients. When the recipients have been negotiated the SMTP-sender sends the mail data,
terminating with a special sequence. If the SMTP-receiver successfully processes the mail data it
responds with an OK reply. The dialog is purposely lock-step, one-at-a-time.
8/3/2019 v3 Mail Server
8/32
SMTP uses TCP port 25. SMTP started becoming widely used in the early 1980s. At the
time, it was a complement to UUCP (Unix to Unix CoPy) which was better suited to handle e-mail
transfers between machines that were intermittently connected. SMTP, on the other hand, works best
when both the sending and receiving machines are connected to the network all the time.
Sendmail was one of the first (if not the first) mail transfer agent to implement SMTP.
Since this protocol started out as purely ASCII text-based, it did not deal well with binary files. Standards
such as Multipurpose Internet Mail Extensions MIME were developed to encode binary files for transfer
through SMTP. MTAs developed after sendmail also tended to be implemented 8-bit-clean, so that the
alternate "just send eight" strategy could be used to transmit arbitrary data via SMTP.
Receiver-
SMTP
SMTP
Commands/Replies
and Mail
+------+
| File
| |System|
+
Sender-SMTP
Fig: 3.1 Model for SMTP Use
8/3/2019 v3 Mail Server
9/32
3.2.1. SMTP Commands
Given below are some basic commands with their brief descriptions. The SMTP standard
defines many more commands, most of which are optional to implement.
HELLO (HELO)
This is the first command that is sent when a connection is established. It is used to identify the
sender-SMTP to the receiver-SMTP. The argument field contains the host name of the sender-
SMTP.
HELO
Note: stands for a space and stands for a combination of Carriage Return and
Linefeed.
The receiver-SMTP identifies itself to the sender-SMTP in the connection greeting reply and in
the response to this command.
MAIL (MAIL)
There are three steps to SMTP mail transactions. The transaction is started with a MAIL
command which gives the sender identification. A series of one or more RCPT commands
follows giving the receiver information. Then a DATA command gives the mail data. And finally,
the end of mail data indicator confirms the transaction.
The first step in the procedure is the MAIL command. The contains the source
mailbox.
MAIL FROM:
If accepted, the receiver-SMTP returns a 250 OK reply. The can contain more
than just a mailbox. The is a reverse source routing list of hosts and source
mailbox. The first host in the should be the host sending this command.
RECIPIENT (RCPT)
This command gives a forward-path identifying one recipient. If accepted, the receiver-SMTP returns a
250 OK reply, and stores the forward-path. If the recipient is unknown the receiver-SMTP returns a 550
Failure reply. This second step of the procedure can be repeated any number of times.
RCPT TO:
The can contain more than just a mailbox. The is a source routing list of
hosts and the destination mailbox. The first host in the should be the host receiving this
command.
DATA (DATA)
8/3/2019 v3 Mail Server
10/32
The third step in the procedure is the DATA command.
DATA
If accepted, the receiver-SMTP returns a 354 Intermediate reply and considers all succeeding lines to be
the message text. When the end of text is received and stored the SMTP-receiver sends a 250 OK reply.
Since the mail data is sent on the transmission channel the end of the mail data must be indicated so that
the command and reply dialog can be resumed. SMTP indicates the end of the mail data by sending a line
containing only a period.
The mail data includes the memo header items such as Date, Subject, To, Cc, From etc.
VERIFY (VRFY)
This command asks the receiver to confirm that the argument identifies a user. If it is a user name, the full
name of the user (if known) and the fully specified mailbox are returned.
VRFY
RESET (RSET)
This command specifies that the current mail transaction is to be aborted. The receiver must send
an OK reply.
RSET
NOOP (NOOP)
This command does not affect any parameters or previously entered commands. It specifies noaction other than that the receiver send an OK reply.
NOOP
QUIT (QUIT)
This command specifies that the receiver must send an OK reply, and then close the transmission
channel.
QUIT
In order to make SMTP workable, the following minimum implementation is required for all receivers:
RCPT
DATA
RSET
8/3/2019 v3 Mail Server
11/32
NOOP
QUIT
3.3. POP3
Post Office Protocol, a protocol used to retrieve e-mail from a mail server. Most e-mail
applications (sometimes called an e-mail client) use the POP protocol, although some can use the newer
IMAP (Internet Message Access Protocol). There are two versions of POP. The first, called POP2,
became a standard in the mid-80's and requires SMTP to send messages. The newer version, POP3, can
be used with or without SMTP.
POP3 (Post Office Protocol 3) is the most recent version of a standard protocol for
receiving e-mail. POP3 is a client/server protocol in which e-mail is received and held for you by your
Internet server. Periodically, you (or your client e-mail receiver) check your mail-box on the server and
download any mail, probably using POP3. This standard protocol is built into most popular e-mail
products, such as Eudora and Outlook Express. It's also built into the Netscape and Microsoft Internet
Explorer browsers.
POP3 is designed to delete mail on the server as soon as the user has downloaded it.
However, some implementations allow users or an administrator to specify that mail be saved for some
period of time. POP can be thought of as a "store-and-forward" service. An alternative protocol is Internet
Message Access Protocol (IMAP). IMAP provides the user more capabilities for retaining e-mail on the
server and for organizing it in folders on the server. IMAP can be thought of as a remote file server.
POP and IMAP deal with the receiving of e-mail and are not to be confused with the
Simple Mail Transfer Protocol (SMTP), a protocol for transferring e-mail across the Internet. You send e-
mail with SMTP and a mail handler receives it on your recipient's behalf. Then the mail is read using POP
or IMAP. .
Fig 3.2 Working of
protocol
8/3/2019 v3 Mail Server
12/32
CHAPTER 4
SYSTEM STUDY
4.1 INTRODUCTIONAll projects are feasible when given unlimited resources and
infinite time. It is both necessary and prudent to evaluate the feasibility of a project at the earliest possible
time. A feasible study is not warranted for system in which economic justification is observed, technical
risk is low, few legal problems are expected and no reasonable alternative exists. An estimate is made of
whether the identified user needs may be satisfied using our recent software and hardware technologies.
The study will decide if the proposed system will be cost effective, from the business point of view and itcan be developed in the existing budgetary constraints. The feasibility study should be relatively sharp ad
quick. The gesture should inform the decision of whether to go ahead with a more detailed analysis.
Feasibility study may be documented as a separated report to higher officials of the top-
level management and can be included as appendices to the system specification. Feasibility and risk
analysis is detailed in many worries. If there is more project risk then the feasibility of producing the
quality software is reduced. The study is done in two phase
4.1.1 Operational Feasibility
In the proposed System named V3mailserver the operational feasibility study is
performed with the help of the users of the system and the management. The first challenge was whether
the system meets the organizational requirement. This is checked by the system requirement collected
from the users and the management and the operational feasibility proved that the system is capable to
meet its functional requirements.
During the operational feasibility study the proposed system, is checked whether it can
run with universal standards.
All the business methods implemented in the system is selected according to increase the
user acceptance. There was no difficulty in implemented the software and proposed system is so effective,
user friendly, functionally reliable so that the users in the company will find that the new system reduces
the hard steps.
4.1.2 Technical Feasibility
In the proposed system named V3mailserver the technical feasibility study is conducted
by considering the risk related to developing the system, the resources available to develop the system
and the availability of the technology to develop the system. The development risk considered the factors
like whether the system can implement using existing technology and the design of the system can run on
the real environment. The resource availability checks the availability of resources like time, human,
hardware etc. The technology using to implement the system is selected according to the technical
8/3/2019 v3 Mail Server
13/32
feasibility study. The technical feasibility study on the technology found that it can implement all the
functional requirements of the proposed system. The technology selected according to accept the system
globally and the development of the system according to the universal standards.
Technical feasibility study of V3mailserver covered the hardware as well as the software
requirements. The scope was whether the work for the project is done with the current equipments and the
existing software technology has to be examined in the feasibility study. The outcome was found to be
positive.
8/3/2019 v3 Mail Server
14/32
CHAPTER 5
SYSTEM ANALYSIS
Requirement analysis can be defined as a detailed study of various operations performed
by a system and their relationship within and outside of the system. One aspect of the analysis is
designing the boundaries of the system and determining whether or not a candidate system should other
related systems. During analysis data are collected on the available files, decision points and transactions
handled by the present system. The common tools used in the analysis phase are Data Flow Diagram,
interviews and on site observations.
We can say Analysis as the process of taking known facts concerning a system, breaking
these into their elements and establishing logical relationships between the laments, with objective of
producing a specification of requirements. Analysis can be done in a disciplined way, using appropriate
tools in all stages of the project. During fact-finding, the use of standard forms will help to ensure that
nothing conflicts or is omitted. The tool of analysis consists of lists, structure charts, grid charts and flow
charts. The steps in the analysis are:
Defining system objectives and results.
Trace back to the actions required for the achievement of objectives and results.
Carry out instructions, which prompt the achievement of objectives and must be analyzed In
relation to the decisions, which produce them.
Confirm the notifications that have been carried out.
The information based on the decisions can be analyzed into the data and procedures required to
produce it.
At each step it is necessary to:
Identify the relevant facts, and establish the relationship between them.
Compare that set of facts with the sets at each adjoining steps and establish the relationship
between the facts in these sets.
8/3/2019 v3 Mail Server
15/32
CHAPTER 6
SYSTEM DESIGN
6.1 FUNDAMENTAL DESIGN CONCEPTS
A set of fundamental design concepts are evolved over the past decades, although the
degree of interest in each concept has varied over the years, each has stood the test of time. Each one
provides the software designer with a foundation from which more sophisticated design methods can be
applied. Fundamental design concepts provide the necessary frame work for "getting it right".
6.2 MODULARITY
Modularity is the single attribute software that allows a program to be intellectually
manageable. Software architecture embodies modularity, that is , software is divided into named and
addressable component called modules that are integrated to satisfy problem requirements. We have
divided our project into four modules. Administrator, Inbox, My settings and Protocol.
6.3 DATA STRUCTURE
Data structure is a representation of logical relationship among individual elements of
data. Because the structure of information will invariably affect the final procedural design, data structure
is very important as the program structure to the representation of the software architecture. Data
structure dictates the organization, methods of access, degree of associatively, and processing alternatives
for information. The organization and complexity of a data structure are limited only by ingenuity of the
designer. Scalar item array and Array list and Vectors are some of the representations of the data structure
used in our project.
8/3/2019 v3 Mail Server
16/32
CHAPTER 7
DATABASE DESIGN
The overall objective in the development of database technology has been to treat data as
an organizational resource and as an integrated whole. DBMS allow data to be protected and organized
separately from other resources. Database is an integrated collection of data. The most significant form of
data as seen by the programmers is data as stored on the direct access storage devices. This is the
difference between logical and physical data.
Database files are the key source of information into the system. It is the process of
designing database files, which are the key source of information to the system. The files should be
properly designed and planned for collection, accumulation, editing and retrieving the requiredinformation.
The organization of data in database aims to achieve three major objectives:-
Data integration.
Data integrity.
Data independence.
The proposed system stores the information relevant for processing in the MS SQL
SERVER database. This database contains tables, where each table corresponds to one particular type of
information. Each piece of information in table is called a field or column. A table also contains records,
which is a set of fields. All records in a table have the same set of fields with different information. There
are primary key fields that uniquely identify a record in a table. There are also fields that contain primary
key from another table called foreign keys.
7.1 NORMALIZATION
Normalization is a technique of separating redundant fields and braking up a large table
in to a smaller one. It is also used to avoid insertion, deletion and updating anomalies. All the tables have
been normalized up to the third normal form. In short the rules for each of the three normal forms are as
below.
First Normal Form
A relation is said to be in 1NF if all the underlying domain of attributes contain simpleindividual values.
Second Normal Form
The 2NF is based on the concept of full functional dependency. A relation said to be in
2NF if and only if it is in 1NF and every non-key attribute is fully functionally dependent on candidate
key of the table.
Third Normal Form
8/3/2019 v3 Mail Server
17/32
The 3NF is based on the concept of transitive dependency. A relation in 2NF is said to be
in 3NF if every non-key attribute is non-transitively.
7.2 TABLES
Table 7.1 REGISTER
FIELD DATATYPE CONSTRAINTS
FNAME VARCHAR
LNAME VARCHAR
GENDER VARCHAR
MAHLHD VARCHAR PRIMARY KEY
PASSWD VARCHAR
SQUES VARCHAR
ANS VARCHAR
BDAY VARCHAR OCCUPATION VARCHAR
EDUCATION VARCHAR
ZIP VARCHAR
ALTID VARCHAR
MOBILE VARCHAR
ROLL VARCHAR
The above table stores the details of registered user such as user name, password, etc. The entries
in the table all inserted during the new user registration process.
OFFPHONE VARCHAR
MOB VARCHAR
ADDRESS VARCHAR
BDAY VARCHAR
MAILID VARCHAR
The above table stores the details of friends such as user name, mailid, etc. The entries in the
table all inserted during adding friends to addressbook.
Table 7.3 INBOX
FIELD DATATYPE CONSTRAINTS
MSGID LONGINT PRIMARY KEY
SENDER VARCHAR
SUBJECT VARCHAR
DAT VARCHAR
MSG VARCHAR
SIZ VARCHAR
MAILID VARCHAR
FIELDDATATYPECONSTRAINTSFNAMEVARCHARMNAMEVARCHARLNAMEVARC
HARNNAMEVARCHARPRIMARY
KEYEMAILVARCHARALTIDVARCHARHPHONEVARCHAR
Table 7.2
ADDRESSBOOK
8/3/2019 v3 Mail Server
18/32
STATUS INT
The above table stores the details of message such as message id, sender, data etc. The entries in
the table all inserted during the retrieving of mails
The above table stores the details of mail such as message id, sender, data, etc. The entries in the
table all inserted when user move mail to myfolder
Table 7.5 SENT FOLDER
FIELD DATATYPE PRIMARY KEY
MSGID LONGINT
MAILID VARCHAR
SENDER VARCHAR
SUBJECT VARCHAR
DAT VARCHAR
MSG VARCHAR
STATUS I NT
The above table stores the details of mail such as message id, sender, data, etc. The entries in the
table are inserted when user send mails.
Table 7.6 SIGNATURE
FIELD DATATYPE CONSTRAINTS
SIGNID INT PRIMARY KEY
SIGNATURE VARCHAR
MAILID VARCHAR
FIELDDATATYPECONSTRAINTSMSGIDLONGINTPRIMARY
KEYSENDERVARCHARSUBJECTVARCHARDATVARCHARMSGVARCHARSIZVA
RCHARMAILIDVARCHAR
Table 7.4MYFOLDER
8/3/2019 v3 Mail Server
19/32
The above table stores the details of signature of the user. The entries in the table all
inserted when user add signature
The above table stores the details of mails deleted from inbox such as message id, sender,
data, etc. The entries in the table all inserted when user delete mail.
7.3 DATA FLOW DIAGRAMS
Data Flow Diagram is the graphical description of the system's data and how the
processes transform the data. Data Flow diagram depicts information flow, the information flow and the
transforms that are applied as data move from the input to output. It is the starting point of the design
phase that functionally decomposes the requirement specifications down to the lowest level of details.
Thus a DFD describes what data flows (logical) rather than how they are processed.
Unlike detailed flowchart, Data Flow Diagrams do no supply detailed description of the
modules but graphically describes a system's data and how the data interacts with the system. To
construct a Data Flow Diagram, we use
> Arrows
> Circles
> Open End Box
> Squares
An arrow identifies the dataflow in motion. It is a pipeline through which information is flown like the
rectangle in the flowchart. A circle stands for process that
converts data into information. An open-ended box represents a data store, data at rest or a temporary
repository of data. A square defines a source or destination of system data.
Rules for constructing a Data Flow Diagram
> Arrows should not cross each other.
> Squares, circles and files must bear names.
> Decomposed data flow squares and circles can have same names.
> Choose meaningful names for data flow
> Draw all data flows around the outside of the diagram.
FIELDDATATYPECONSTRAINTSMSGIDLONGINTPRIMARY
KEYSENDERVARCHARSUBJECTVARCHARDATVARCHARMSGVARCHARSIZVARCHARMAHLHDVARCHAR
Table 7.7
TRASH
8/3/2019 v3 Mail Server
20/32
CHAPTER 8
CODING
The goal of coding phase is to translate the design of the system in to code in a given
programming language. For a given design, the aim in this phase is to implement the design in the best
possible manner. Well-written code can reduce the resting and maintenance effort. During coding, the
focus should on developing programs that are easy to read and understand and not simply on developing
programs that are easy to write. Simplicity and clarity should be strived for during the code phase.
An important concept that helps the understandability of programs is structured
programming. The program that should be organized as a sequence of statements
and during execution the statements are executed in the sequence given in the program. There are many
different criteria for judging of the program, execution time and required memory.
8/3/2019 v3 Mail Server
21/32
CHAPTER 9
SYSTEM IMPLEMENTATION
Implementation includes all those activities that take place to convert from the old system
to the new. The old system consists of manual operations, which is operated in a very different
manner from the proposed new system. A proper implementation is essential to provide a reliable
system to meet the requirements of the organizations. An improper installation may affect the success
of the computerized system.
9.1 IMPLEMENTATION METHODS
There are several methods for handling the implementation and the consequent
conversion from the old to the new computerized system.
The most secure method for conversion from the old system to the new system is to run
the old and new system in parallel. In this approach, a person may operate in the manual older processing
system as well as start operating the new computerized system. This method offers high security, because
even if there is a flaw in the computerized system, we can depend upon the manual system. However, the
cost for maintaining two systems in parallel is very high. This outweighs its benefits.
Another commonly method is a direct cut over from the existing manual system to the
computerized system. The change may be with in a week or with in a day. There are no parallel activities.
However, there is no remedy in case of a problem. This strategy requires careful planning. A working
version of the system can also be implemented in one part of the organization and the personnel will be
piloting the system and changes can be made as and when required. But this method is less preferable due
to the loss of entirety of the system.
9.2 IMPLEMENTATION PLAN
The implementation plan includes a description of all the activities that must occur to
implement the new system and to put it into operation. It identifies the personnel responsible for the
activities and prepares a time chart for implementing the system.
The implementation plan consists of the following steps.
List all files required for implementation.
Identify all data required to build new files during the implementation.
List all new documents and procedures that go into the new system.
8/3/2019 v3 Mail Server
22/32
CHAPTER 10
SYSTEM TESTING
Testing is the major quality measure employed during software development. After the
coding phase, computer programs are available that can be executed for testing purposes. Testing not only
has to uncover errors introduced during coding, but also locates errors committed during the previous
phases. Thus the aim of testing is to uncover requirements, design or coding errors in the program.
10.1 TYPES OF TESTING
This is the phase where bug in the program was to be found and corrected. One of the
goals during dynamic testing is to produce a test suite. This is applied to ensure that the modification of
the program does not have any side effects. This type of testing is called regression testing. Testing
generally removes all the residual bugs and improves the reliability of the program. The basic testing
types are
> Unit testing
> Integration testing
> Validation testing
> Output testing
> User acceptance testing
10.1.1 Unit Testing
This is the first level of testing. In this different modules are tested against the
specifications produced during the design of the modules. Unit testing is done for the verification of the
code produced during the coding of the single module in an isolated environment. Unit testing first
focuses on the modules independently of one another to locate errors.
After coding, each dialogue is tested and run individually. All unnecessary coding were removed and it
was ensured that all the modules worked, as the programmer would expect. Logical errors found were
corrected.
So, by working all the modules independently and verifying the outputs of each module in the presence
of staff was conducted that the program was functioning as expected.
10.1.2 Integration Testing
Data can be lost access an interface, one module can have as adverse effect on another
sub-functions when combined, may not produce the desired major functions. Integration testing is a
systematic testing for constructing the program structure, while at the same time conducting test to
uncover errors associated within the interface. The objectives are to take unit tested as a whole. Here
8/3/2019 v3 Mail Server
23/32
correction is difficult because the vast expenses of the entire program complicate the isolation of causes.
Thus in the integration testing step, all the errors uncovered are corrected for the next testing stages.
10.1.3 Validation Testing
This provides the final assurance that the software meets all the functional, behavioral
and performance requirements. The software is completely assembled as a package. Validation succeeds
when the software functions in a manner in which the user expects. Validation refers to the process of
using software in a live environment in order to find errors. During the course of validating the system,
failures may occur and sometimes the coding has to be changed according to the environment.
Once the application was free all the logical and interface errors, inputting dummy data
ensured that the software developed satisfied all the requirements of the user.
10.1.4 Output Testing
After performing the validation testing, the next step is the output testing of the proposed
system since no system could be useful if it does not produces the required output generated or considered
into two ways; one is on screen and another is printed format.
The output format on the screen is found to be correct as the format was designed in the
system design phase according to the user needs.
For the hard copy also the output comes out as the specified requirements by the user. Hence output
testing does not result in any correction in the system.
10.1.5 User Acceptance Testing
User acceptance of a system is the key factor for the success of any system. The system
under consideration is tested for user acceptance by constantly keeping in touch with the prospective
system users at the time of developing and making changes whenever required.
Preparation of test data plays a vital role in the system testing. After preparing g the test
data the system under study is tested using the test data. While testing the system by using the test data,
errors are again uncovered and corrected and the corrections are also noted for the future.
8/3/2019 v3 Mail Server
24/32
CHAPTER 11
SYSTEM SPECIFICATION
11.1 HARDWARE REQUIREMENTS
Client machine:
Processor : Intel Pentium I or higher.
Monitor : Min 14" color monitor
RAM : 64 MB
Hard Disk : 40 GB
Keyboard : Standard 104 keys
Modem : 56 KBPS
Mouse : Serial mouse.
NIC : 10/100 Ethernet LAN
Server Machine
Processor : Intel Pentium IV or higher with minimum 1 GHz Speed.
Monitor : Min 14" color monitor
RAM : 1 GB
Hard Disk : 40 GB (Or higher for Code backup)
Keyboard : Standard 104 keys
Modem : 56 KBPS
Mouse : Serial mouse
NIC : 10/100 Ethernet LAN
11.2 SOFTWARE REQUIREMENTS
Client's Machine
Operating system : Windows, Linux
Browser : Internet Explorer 5.5 or any http Browser
Internet connection with a valid internet service provider
Server Machine
Operating system : Redhat Linux Enterprise Edition
Scripting : Java Script
Database Layer : Cloudscape
Server : J2ee Server
11.3 TECHNOLOGY SPECIFICATION
Client-Server Architecture
Typical client-server systems are based on the 2-tiered architecture, whereby there is a
clear separation between the data and the presentation/business logic. These are generally data driven,
with the application existing entirely on the client machine while the database server is deployed
somewhere in the organization.
8/3/2019 v3 Mail Server
25/32
2-Tier Architecture
In a traditional 2- Tiered application, the processing load is given to the client PC while
the server simply acts as a traffic controller between the application and data. As a result, not only does
the application performance suffer due to the limited resources of the PC, but the network traffic tends
increase as well.
Client
Fig 11.1: 2 Tier Architecture
3 - Tier Architecture
In 3- Tier architecture an application is broken into three separate logical layers, each
with a well - defined set of interfaces. The first tier is referred to as the presentation layer and typically
consists of graphical user interface of some kind.
The middle tier, or business layer, consists of application or business layer and the third layer- the datalayer contains the data that is needed for the application. The middle tier is basically the code that the user
calls upon to retrieve the desired data. The presentation layer then receives the data and formats it for
display. This separation of application logic from the user interface adds enormous flexibility to the
design of application. The third tier contains the data that is needed for the application.
n- Tier Architecture
In an n - tier architecture the application logic is divided by function rather than
physically. N - Tier architecture then breaks down like this:
> A user interface that handle the user's interaction with the application; this can be web browser
running through a firewall, a heavier desktop application or even a wireless device
> Presentation logic that defines what the user interface displays and how a user's requests are handled-
depending on what user interfaces are supported we need to have slightly different versions of the
presentation logic to handle the client appropriately.
> Business logic that models the application's business rules, often through the interaction with theapplication's data.
> Interface services that provide additional functionality required by the application components, such
as messaging, transactional support etc.
> The Data layer where the enterprise's data resides.
8/3/2019 v3 Mail Server
26/32
Fig: 12.1 L:ogin Form
Using the above form you can login into theV3mailserver
CHAPTER 12
FORMS
8/3/2019 v3 Mail Server
27/32
Fig: 12.2 Forgot Password
Using the above form you can get the password if you forget it.
8/3/2019 v3 Mail Server
28/32
Fig: 12.3 Registration Form
Using the above form you can register to the V3mailserver.
Using the above form you can see your mails in the V3mailserver
Fig:12.4
8/3/2019 v3 Mail Server
29/32
Using the above form you can add and view your contacts from the V3mailserver.
Fig: 12.5 Address Book
Form
8/3/2019 v3 Mail Server
30/32
Using the above form you can compose mail.
Fig: 12.6 Compose
Form
8/3/2019 v3 Mail Server
31/32
Using the above form you can add signature and change your password.
Fig:12.7 MysettingsForm
8/3/2019 v3 Mail Server
32/32
CHAPTER 13
CONCLUSION
The project report entitled "V3 MAILSERVER" has come to its final stage. The
system has been developed with much care that it is free of errors and at the same time it is efficient and
less time consuming. The important thing is that the system is robust. Also provision is provided for
future developments in the system. The entire system is secured. This online system will be approved and
implemented soon.
RESUME
The developed system is flexible and changes can be made easily. The system is
developed with an insight into the necessary modification that may be required in the future. Hence the
system can be maintained successfully without much rework.
Our future plan is to provide an option to attach files. V3MAILSERVER can also be
improved by providing mobile alerts and chatting facility.
In our project we also plan to add AJAX. Ajax (also known as AJAX), shorthand for
"Asynchronous JavaScript and XML", is a web development technique for creating interactive web
applications. The intent is to make web pages feel more responsive by exchanging small amounts of data
with the server behind the scenes, so that the entire web page does not have to be reloaded each time the
user requests a change. This is meant to increase the web page's interactivity, speed, and usability.
REFERENCES
1. Roger.S.Pressman (2005)'Software Engineering: A Practitioner's Approach',
McGraw Hill Professional, Fifth Edition. 2. Herbert Schildt (2002) Java 2: The Complete
Reference, Fifth Edition;
Tata McGraw Hill.
3 www.magicwinmail.net
4. http://java.sun.com.5. www.infoworld.com
http://en.wikipedia.org/wiki/Asynchronoushttp://en.wikipedia.org/wiki/JavaScripthttp://en.wikipedia.org/wiki/XMLhttp://en.wikipedia.org/wiki/XMLhttp://en.wikipedia.org/wiki/Web_developmenthttp://en.wikipedia.org/wiki/Web_developmenthttp://en.wikipedia.org/wiki/Web_applicationhttp://en.wikipedia.org/wiki/Web_applicationhttp://en.wikipedia.org/wiki/Usabilityhttp://www.magicwinmail.net/http://java.sun.com/http://www.infoworld.com/http://en.wikipedia.org/wiki/Asynchronoushttp://en.wikipedia.org/wiki/JavaScripthttp://en.wikipedia.org/wiki/XMLhttp://en.wikipedia.org/wiki/Web_developmenthttp://en.wikipedia.org/wiki/Web_applicationhttp://en.wikipedia.org/wiki/Web_applicationhttp://en.wikipedia.org/wiki/Usabilityhttp://www.magicwinmail.net/http://java.sun.com/http://www.infoworld.com/