GS-FLX Technology – How Does it Work? Deborah J. Hollingshead, MS Genomics Manager Genomics & Proteomics Core Laboratories University of Pittsburgh.
Comparative genomics
Supplemental Figure 1: Genomic region targeted in lemurs Schematic of the candidate human X inactivation center region is shown below the chromosome ideogram.
Sequence Alignment Goal: line up two or more sequences An alignment of two amino acid sequences: 123456789…. Seq1: HKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITN-EYMKEDFLIKIETWHKP.
Research in the Verspoor Lab
MEME homework: probability of finding GAGTCA at a given position in the yeast genome, based on a background model of A = 0.3, T = 0.3, G = 0.2, C = 0.2.
