Social ontology: Understanding Public Orgainisation
Unit 1 – Diversity of Living Things The international year of Biodiversity 2010 YmpTikgw International day of Biodiversity.
Taxonomy and Phylogeny and Evolution How do we as biologists classify life?
Biological diversity is usually the sign of a healthy ecosystem. The greater the diversity of organisms with in an ecosystem, the greater is the chance.
Sequence Alignment Goal: line up two or more sequences An alignment of two amino acid sequences: 123456789…. Seq1: HKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITN-EYMKEDFLIKIETWHKP.
Evolutionary Psychology
Unit 1 – Diversity of Living Things
TAXONOMY Unit 4 – Microbiology. H ANDS - ON O RGANIZING PASTA (10-12 MIN ) 6 pieces of pasta Devise a scheme to group them based on their shared characteristics.
Underwater View
Biodiversity and Classification
What links can you think of between the photos?
Understanding public organisations: collective intentionality as cooperation Social ontology – particularly its leading concept, collective intentionality.
