[XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg...

340
CodeTablesIndex 0 33 26/8/2011 Code List Also used as AccountingCostCode AccountTypeCode ActionCode ActivityLevel ActivityValueCode AdditionalDocumentTypeCode AdditionalItemPropertyNameCode AdditionalParentDocumentTypeCode AddressFormatCode AllowanceChargeReasonCode AttachmentTypeCode BinaryObjectMimeCode CatalogueDocumentTypeCode CommodityCode CoreTransactionCustomisationID CountryIdentificationCode CountrySubentityCode CurrencyCode DeliveryTerms/ID icationCode OriginalDepartureCou ntryIdentificationCo de DestinationCountry DestinationCountryId entificationCode ExportCountryIdentif icationCode FinalDestinationCoun tryIdentificationCod e TransitCountryIdenti ficationCode DocumentCurrencyCode RequestedInvoiceCurr encyCode TaxCurrencyCode SourceCurrencyCode TargetCurrencyCode PricingCurrencyCode @currencyID

Transcript of [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg...

Page 1: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

CodeTablesIndex0

3326/8/2011

Code List Also used asAccountingCostCode

AccountTypeCode

ActionCode

ActivityLevel

ActivityValueCode

AdditionalDocumentTypeCode

AdditionalItemPropertyNameCode

AdditionalParentDocumentTypeCode

AddressFormatCode

AllowanceChargeReasonCode

AttachmentTypeCode

BinaryObjectMimeCode

CatalogueDocumentTypeCode

CommodityCode

CoreTransactionCustomisationID

CountryIdentificationCode

CountrySubentityCode

CurrencyCode

DeliveryTerms/ID

OriginCountryOriginCountryIdentificationCodeOriginalDepartureCountryIdentificationCodeDestinationCountryDestinationCountryIdentificationCodeExportCountryIdentificationCodeFinalDestinationCountryIdentificationCodeTransitCountryIdentificationCode

DocumentCurrencyCodeRequestedInvoiceCurrencyCodeTaxCurrencyCodeSourceCurrencyCodeTargetCurrencyCodePricingCurrencyCode@currencyID

Export CodeLists to XML

Page 2: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Dimension Attribute ID

Discrepancy/Response Code

DocumentTypeCode

ExtensionReasonCode

FullTransactionCustomisationID

InvoiceTypeCode

ItemClassificationCode

ItemNameCode

LanguageCode LanguageID

LifeCycleStatusCode

LineResponseCode

LineStatusCode

LocationID (for Delivery Terms)

ModeCode

ParentDocumentTypeCode

PartyIdentificationSchemeID

PaymentChannelCode

PaymentMeansCode

PriceTypeCode

ProfileID

ProfileLevelCode

ProfileValueCode

ReferenceEventCode

RequestForQuotationPropertyCode

RequestForQuotationTypeCode

ResponseDocumentTypeCode

ResponseCode

StatusCode

SubstitutionStatusCode

SummaryDescriptionCode

TaxCategory/ID

TaxExemptionReasonCode

TaxScheme/ID

TaxTypeCode

UnitOfMeasureCode

List of closed IDsFinancialInstitutionIDFinancialAccountIDEndpointIDUBLVersionID

Page 3: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

List of Open ended IDsUBLExtensionIDExtensionAgencyIDExtensionVersionIDCatalogueIDOrderCancelationIDOrderChangeIDContractIDCustomizationIDInvoiceIDDeliveryLocationIDOrderReferenceIDInvoiceDocumentReferenceIDCreditNoteDocumentReferenceIDBilingReferenceLineIDOriginatorDocumentReferenceIDContractDocumentReferenceIDAdditionalDocumentReferenceIDCustomerAssignedAccountIDPartyIdentificationIDPostalAddressIDCompanyIDRegistrationAddressIDContactIDAddressIDApplicableAddressIDCatalogueLineIDComplementaryRelatedItemIDAccessoryRelatedItemIDReplacementRelatedItemIDRequiredRelatedItemIDComponentRelatedItemIDInstructionIDPaymentIDPayeeFinancialAccountIDFinancialInstiturionBranchIDFinancialInstiturionIDAccountIDInvoiceLineIDLineIDBuyersItemIdentificationIDSellersItemIdentificationIDStandardItemIdentificationIDClassifiedTaxCategoryIDItemPropertyGroupID

Page 4: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ProductTraceIDRegistrationIDSerialIDLotNumberIDAttachedDocumentIDParentDocumentIDParentDocumentTypeCodeEmbeddedDocumentBinaryObject\mimeCodeEmbeddedDocumentBinaryObject\characterSetCodeEmbeddedDocumentBinaryObject\encodingCodeCreditNoteIDReferenceIDCreditNoteDocumentReferenceIDCreditNoteLineIDUUIDAccountingCostCodeDocumentReferenceIDApplicableTaxCategoryIDApplicationResponseIDOrderResponseSimpleIDOrderResponseIDSalesOrderIDOrderDocumentReferenceIDLineItemIDShipmentIDShipmentStageIDGoodsItemContainerIDGoodsItemIDSequenceNumberIDRequiredCustomsIDTransportEquipmentIDTransportEquipmentSealIDAttributeIDContainedGoodsItemIDContainedPackageIDOriginAddressIDHandlingUnitDespatchLineActualPackageIDJourneyIDTransportContractIDTransportHandlingUnitIDRegistrationNationalityIDLicensePlateIDPackageIDAircraftIDRailCarID

Page 5: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

VesselIDReceivedHandlingUnitReceiptLineIDTrainIDApplicableTerritoryAddressIDSellerProposedSubsituteLineIDSellerSubstitudedLineItemIDItemSpecificationDocumentReferenceIDCatalogueDocumentReferenceIDCatalogueItemIdentificationIDTransactionConditionsIDLoadingPortLocationIDUnLoadingPortLocationIDTransshipPortLocationIDFirstArrivalPortLocationIDLastExitPortLocationIDQuotationDocumentReferenceIDPayerFinancialAccountIDOrderIDLocationID (Stowage)BuyerProposedSubstituteLineItemLoadingLocationIDReferencedContractIDPreviousVersionIDVersionIDConsigmentID

List of other CodesErrorCodeContractTypeCodeCustomsStatusCodeDirectionCodeDispositionTypeCodeFreightRateClassCodeFullnessIndicationCodeHandlingCodeHazardousRegulationCodeInhalationToxicityZoneCodeInspectionMethodCodeOwnerTypeCodePackLevelCodePackageLevelCodePackagingTypeCodePackingCriteriaCodePreferenceCriterionCodeProviderTypeCodeRejectActionCodeRejectReasonCode

Page 6: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

SealIssuerTypeCodeSealStatusCodeShortageActionCodeShippingPriorityLevelCodeSizeTypeCodeTariffClassCodeTariffCodeTimingComplainCodeTransitDirectionCodeTransportAuthorizationCodeTransportEmergencyCardCodeTransportEquipmentTypeCodeTransportHandlingUnitTypeCodeTransportMeansTypeCodeTransportModeCodeTransportServiceCode

Page 7: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

List in this document? EC Invoice v0.1 EC Attachment v0.1No

Yes xYes

No

No

Yes

No

Yes xYes x xYes xNo xYes

Yes

Yes xYes

Yes x x

Yes

Yes x

Yes x

Export CodeLists to XML

Page 8: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Yes

Yes

Yes x xNo xYes

Yes xYes xNo

Yes x xYes

Yes

Yes

Yes

No

Yes xYes x xYes xYes xYes

Yes xNo

No

No xNo

No

Yes

Yes

Yes

No

No

Yes xYes xYes x xYes x xYes x

EC Invoice v0.1 EC Attachment v0.1BIC

IBANNo x x

x x

http://www.swift.com/biconline

Page 9: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Invoice v0.1 EC Attachment v0.1xxx

x xx

xxxxxxxxx xx xx xx xx xx

xxxxxxxxxxxxx

Page 10: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

xxxx

xxxxx

Page 11: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Invoice v0.1 EC Attachment v0.1

NoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNo

Page 12: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

NoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNo

Page 13: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Credit Note v0.1 EC Application Response v0.1 EC Order v0.1xxx

x xx x

x x

x x

x

x x

x

Page 14: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

xx x xx x x

x x

x x x

x xx

x x xxxx

x x

x

x x

x

x xx xx xx xx x

EC Credit Note v0.1 EC Application Response v0.1 EC Order v0.1xx

x xx x x

Page 15: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Credit Note v0.1 EC Application Response v0.1 EC Order v0.1x x xx x xx x x

x x xx

x xx

xx

x xx

x xx xx xx xx xx xx x

xxxxxxx

x xx xx xx xx xx x

Page 16: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

x xx xx xx x

xx xxxx xx xx x xx x

x

xxxxxxxxxxxxxxxxxxxxxxxxx

Page 17: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

xxxxxxxxxxxxxxxxxxxxx

x

EC Credit Note v0.1 EC Application Response v0.1 EC Order v0.1

xxxxxxxxxxx

xxxxxxx

Page 18: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

xxxxxxxxxxxxxxxx

Page 19: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Order Response Simple v0.1 EC Order Response v0.1 EC OrderCancelation v0.1x x

xx

x x xx

x

x x x

x x x

x

x

Page 20: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

x

x x xx x x

x

x x x

xx

x x xxx

x x x

x

x

xx

x x xx x x

x x

EC Order Response Simple v0.1 EC Order Response v0.1 EC OrderCancelation v0.1xx

x x xx x x

Page 21: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Order Response Simple v0.1 EC Order Response v0.1 EC OrderCancelation v0.1x x xx x xx x x

x

x x x

x x x

x xx x

x x xx x xx x xx xx xx x xx x xx x

xxxxxxxxxxxxx

Page 22: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

xxxx

x x xxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxx

Page 23: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

xxxxxxxxxxxxxxx

x

EC Order Response Simple v0.1 EC Order Response v0.1 EC OrderCancelation v0.1

x xxxxxxxxxxx

xxxxxxx

Page 24: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

xxxxxxxxxxxxxxxx

Page 25: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Order Change v0.1 EC Catalogue v0.1 EC Request For Quotation v0.1xxx x

xxxx

x xx x

x

x x

x x

x x

x x x

x

Page 26: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

x x xx x

x xx

x xx

xx

x

x x xxx

x xxx

xxx

x

x xx xx xx xx x x

EC Order Change v0.1 EC Catalogue v0.1 EC Request For Quotation v0.1

x xx x

Page 27: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Order Change v0.1 EC Catalogue v0.1 EC Request For Quotation v0.1x xx xx x

x

xxx x

xx

xx xxx xx xx xx xx xx xx

xxxxxxx

xxxxxxxxx xx xx xx xx x

Page 28: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

x xx xx xx x

x x

x xx x

x

xxxxxxxxxxxxxxxxxxxxxxx

Page 29: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

xxxx xxxx xx xx xxxxxxxxx

xxx

xxx

x

EC Order Change v0.1 EC Catalogue v0.1 EC Request For Quotation v0.1

x x xx

xxxxxxxx

xxxxxxxx

Page 30: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

xxxxxxxxxxxxxxxx

Page 31: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Acknowledgement v0.1 EC Willingness v0.1

x x

Page 32: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

x x

x x

x xx x

EC Acknowledgement v0.1 EC Willingness v0.1

Page 33: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Acknowledgement v0.1 EC Willingness v0.1

Page 34: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price
Page 35: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Acknowledgement v0.1 EC Willingness v0.1

x x

Page 36: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price
Page 37: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Proposal Request v0.1 EC Proposal v0.1

xx

x xx

x x

x

Page 38: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

x x

x

x x

xx

x xx x

x

x

EC Proposal Request v0.1 EC Proposal v0.1

Page 39: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Proposal Request v0.1 EC Proposal v0.1

Page 40: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price
Page 41: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Proposal Request v0.1 EC Proposal v0.1

x x

Page 42: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price
Page 43: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Quotation Request v0.1 EC Quotation v0.1

x xx xx xx x

x x

x x

Page 44: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

x x

x x

x x

x xx x

x xx x

x

x x

EC Quotation Request v0.1 EC Quotation v0.1

Page 45: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Quotation Request v0.1 EC Quotation v0.1

Page 46: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price
Page 47: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Quotation Request v0.1 EC Quotation v0.1

x x

Page 48: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price
Page 49: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Adhoc S2C v0.1 EC Adhoc C2S v0.1

x x

x x

Page 50: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

x x

x x

x xx x

x x

EC Adhoc S2C v0.1 EC Adhoc C2S v0.1

Page 51: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Adhoc S2C v0.1 EC Adhoc C2S v0.1

Page 52: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price
Page 53: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

EC Adhoc S2C v0.1 EC Adhoc C2S v0.1

x x

Page 54: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price
Page 55: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

Code123

Note:

1

2

Page 56: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

AccountTypeCodeAccount Type Code

D06BPlaceholderPlaceholder

United Nations Economic Commission for Europe6en

ValueCurrent AccountSavings AccountInvestment Account

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/AccountTypeCode-2.0.gc

The Account Type Code is used to identify the type of the financial accountused; it is not to identify the method of depositing into the account or theformat of the account number.

NES country members also have specific Account Type Codes. In cases wherethese are used, NES prefixes the domestic code with an ISO Country Code (ISO3166-1) and a colon (:) separator, e.g. IS:05, IS:13.

Page 57: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

CodeAddDeleteUpdate

Page 58: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ActionCodeAction CodeCWA ???1PlaceholderPlaceholder

CEN/ISSS WS/BII

en

ValueThe Catalogue Line should be added to the Catalogue referenced. In the case of a new Catalogue, all Catalogue Lines have an Action Code ‘Add’.The Catalogue Line should be deleted from the Catalogue referenced.The Catalogue Line should replace the existing Catalogue line in its entirety.

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/ActionCode-2.0.gc

Page 59: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

The Catalogue Line should be added to the Catalogue referenced. In the case of a new Catalogue, all Catalogue Lines have an Action Code ‘Add’.

Page 60: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

CodeADT1ADT2ADT3ADT4ADT5ADT6

Page 61: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

AdditionalDocumentTypeCodeAdditional Document Type Code

0.1PlaceholderPlaceholder

European Commission

ValueWillingness DocumentProposal RequestProposalQuotation RequestAdhocS2CAdhocC2S

Page 62: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

CodeADT2ADT3ADT4ADT5ADT6

Page 63: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

AdditionalParentDocumentTypeCodeAdditional Parent Document Type Code

0.1PlaceholderPlaceholder

European Commission

en

ValueProposal RequestProposalQuotation RequestAdhocS2CAdhocC2S

Page 64: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortName AddressFormatCodeLongName Address Format CodeListID UN/ECE 3477Version D08BCanonicalUri PlaceholderCanonicalVersionUri PlaceholderLocationUriAgencyLongName United Nations Economic Commission for EuropeAgencyIdentifier 6Locale en

Code Value1 Street name followed by number2 Number, road type, road name in this sequence3 Road type, road name, number in this sequence4 Post office box.5 Unstructured address6 Street name followed by number, building, suite7 Rural route number8 Post office drawer number9 Building name followed by suite

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/AddressFormatCode-2.0.gc

Page 65: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

Code123456789

1011121314151617181920212223242526272829303132333435363738394041

Page 66: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

4243444546474849505152535455565758596061626364656667686970717273747576777879808182838485868788899091929394

Page 67: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

959697

Page 68: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

AllowanceChargeReasonCodeAllowance Charge Reason CodeUN/ECE 4465D08BPlaceholderPlaceholder

United Nations Economic Commission for Europe6en

ValueAgreed settlementBelow specification goodsDamaged goodsShort deliveryPrice queryProof of delivery requiredPayment on accountReturnable container charge includedInvoice errorCosts for draftBank chargesAgent commissionCounter claimWrong deliveryGoods returned to agentGoods partly returnedTransport damageGoods on consignmentTrade discountDeduction for late deliveryAdvertising costsCustoms dutiesTelephone and postal costsRepair costsAttorney feesTaxesReclaimed deductionSee separate adviceBuyer refused to take deliveryDirect payment to sellerBuyer disagrees with due dateGoods not deliveredLate deliveryQuoted as paid to youGoods returnedInvoice not receivedCredit note to debtor/not to usDeducted bonusDeducted discountDeducted freight costsDeduction against other invoices

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/AllowanceChargeReasonCode-2.0.gc

Page 69: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Credit balance(s)Reason unknownAwaiting message from sellerDebit note to sellerDiscount beyond termsSee buyer's letterAllowance/charge errorSubstitute productTerms of sale errorRequired data missingWrong invoiceDuplicate invoiceWeight errorAdditional charge not authorizedIncorrect discountPrice changeVariationChargebackOffsetIndirect paymentFinancial reassignmentReinstatement of chargeback/offsetExpecting new termsSettlement to agentCash discountDelcredere costsEarly payment allowance adjustmentIncorrect due date for monetary amountWrong monetary amount resulting from incorrect free goodsRack or shelf replenishment service by a supplierTemporary special promotionDifference in tax rateQuantity discountPromotion discountCancellation deadline passedPricing discountVolume discountSundry discountCard holder signature missingCard expiry date missingCard number errorCard expiredTest card transactionPermission limit exceededWrong authorisation codeWrong authorised amountAuthorisation failedCard acceptor data errorTreasury management service chargeAgreed discountExpediting feeInvoicing feeFreight charge

Page 70: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Small order processing service chargeCurrency exchange differencesInsolvency

Page 71: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

Codeapplication/activemessageapplication/andrew-insetapplication/applefileapplication/atom+xmlapplication/atomicmailapplication/atomcat+xmlapplication/atomsvc+xmlapplication/auth-policy+xmlapplication/batch-SMTPapplication/beep+xmlapplication/cals-1840application/ccxml+xmlapplication/cellml+xmlapplication/cnrp+xmlapplication/commonground

application/conference-info+xmlapplication/cpl+xmlapplication/csta+xmlapplication/CSTAdata+xmlapplication/cybercashapplication/davmount+xmlapplication/dca-rftapplication/dec-dxapplication/dialog-info+xmlapplication/dicomapplication/dnsapplication/dvcsapplication/ecmascriptapplication/EDI-Consentapplication/EDIFACTapplication/EDI-X12application/epp+xmlapplication/eshopapplication/exampleapplication/fastinfosetapplication/fastsoapapplication/fitsapplication/font-tdpfrapplication/H224application/http

Page 72: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

application/hyperstudioapplication/iges

application/im-iscomposing+xmlapplication/indexapplication/index.cmdapplication/index.objapplication/index.responseapplication/index.vndapplication/iotpapplication/ippapplication/isupapplication/javascriptapplication/jsonapplication/kpml-request+xmlapplication/kpml-response+xmlapplication/mac-binhex40application/macwriteiiapplication/marcapplication/mathematica

application/mbms-envelope+xml

application/mbms-msk+xml

application/mbms-register+xml

application/mboxapplication/media_control+xml

application/mikeyapplication/moss-keysapplication/moss-signatureapplication/mosskey-dataapplication/mosskey-requestapplication/mpeg4-genericapplication/mpeg4-iodapplication/mpeg4-iod-xmtapplication/mp4application/mswordapplication/mxfapplication/nasdata

application/mbms-associated-procedure-description+xmlapplication/mbms-deregister+xml

application/mbms-msk-response+xml

application/mbms-protection-description+xmlapplication/mbms-reception-report+xmlapplication/mbms-register-response+xml

application/mbms-user-service-description+xml

application/mediaservercontrol+xml

Page 73: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

application/news-message-idapplication/news-transmissionapplication/nssapplication/ocsp-requestapplication/ocsp-responseapplication/octet-streamapplication/odaapplication/oebps-package+xmlapplication/oggapplication/parityfecapplication/pdfapplication/pgp-encryptedapplication/pgp-keysapplication/pgp-signatureapplication/pidf+xmlapplication/pkcs10application/pkcs7-mimeapplication/pkcs7-signatureapplication/pkix-certapplication/pkixcmpapplication/pkix-crlapplication/pkix-pkipathapplication/pls+xmlapplication/poc-settings+xmlapplication/postscript

application/prs.cwwapplication/prs.nprendapplication/prs.pluckerapplication/rdf+xmlapplication/qsigapplication/reginfo+xml

application/remote-printingapplication/resource-lists+xmlapplication/riscosapplication/rlmi+xmlapplication/rls-services+xmlapplication/rtfapplication/rtxapplication/samlassertion+xmlapplication/samlmetadata+xmlapplication/sbml+xmlapplication/scvp-cv-requestapplication/scvp-cv-responseapplication/scvp-vp-requestapplication/scvp-vp-responseapplication/sdpapplication/set-payment

application/prs.alvestrand.titrax-sheet

application/relax-ng-compact-syntax

application/set-payment-initiation

Page 74: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

application/set-registration

application/sgmlapplication/sgml-open-catalogapplication/shf+xmlapplication/sieveapplication/simple-filter+xml

application/slateapplication/smil (OBSOLETE)application/smil+xmlapplication/soap+fastinfosetapplication/soap+xmlapplication/sparql-queryapplication/sparql-results+xmlapplication/spirits-event+xmlapplication/srgsapplication/srgs+xmlapplication/ssml+xmlapplication/timestamp-queryapplication/timestamp-replyapplication/tve-triggerapplication/ulpfecapplication/vemmiapplication/vnd.3gpp.bsf+xml

application/vnd.3gpp.pic-bw-varapplication/vnd.3gpp.sms

application/vnd.3gpp2.smsapplication/vnd.3gpp2.tcap

application/vnd.3M.Post-it-Notes

application/vnd.acucobolapplication/vnd.acucorpapplication/vnd.adobe.xdp+xmlapplication/vnd.adobe.xfdfapplication/vnd.aether.imp

application/set-registration-initiation

application/simple-message-summaryapplication/simpleSymbolContainer

application/vnd.3gpp.pic-bw-largeapplication/vnd.3gpp.pic-bw-small

application/vnd.3gpp2.bcmcsinfo+xml

application/vnd.accpac.simply.asoapplication/vnd.accpac.simply.imp

application/vnd.americandynamics.acc

Page 75: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

application/vnd.amiga.ami

application/vnd.audiographapplication/vnd.autopackageapplication/vnd.avistar+xml

application/vnd.bmiapplication/vnd.businessobjectsapplication/vnd.cab-jscriptapplication/vnd.canon-cpdlapplication/vnd.canon-lips

application/vnd.chemdraw+xml

application/vnd.cinderellaapplication/vnd.cirpack.isdn-extapplication/vnd.claymoreapplication/vnd.clonk.c4group

application/vnd.commonspaceapplication/vnd.cosmocallerapplication/vnd.contact.cmsgapplication/vnd.crick.clicker

application/vnd.ctc-posmlapplication/vnd.ctct.ws+xmlapplication/vnd.cups-pdfapplication/vnd.cups-postscriptapplication/vnd.cups-ppdapplication/vnd.cups-rasterapplication/vnd.cups-rawapplication/vnd.curlapplication/vnd.cybankapplication/vnd.data-vision.rdz

application/vnd.anser-web-certificate-issue-initiationapplication/vnd.antix.game-componentapplication/vnd.apple.installer+xml

application/vnd.blueice.multipass

application/vnd.cendio.thinlinc.clientconf

application/vnd.chipnuts.karaoke-mmd

application/vnd.commerce-battelle

application/vnd.crick.clicker.keyboardapplication/vnd.crick.clicker.paletteapplication/vnd.crick.clicker.templateapplication/vnd.crick.clicker.wordbankapplication/vnd.criticaltools.wbs+xml

Page 76: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

application/vnd.dnaapplication/vnd.dpgraphapplication/vnd.dreamfactory

application/vnd.dxrapplication/vnd.ecdis-updateapplication/vnd.ecowin.chart

application/vnd.ecowin.series

application/vnd.enlivenapplication/vnd.epson.esfapplication/vnd.epson.msf

application/vnd.epson.saltapplication/vnd.epson.ssf

application/vnd.eszigno3+xmlapplication/vnd.eudora.dataapplication/vnd.ezpix-albumapplication/vnd.ezpix-packageapplication/vnd.fdfapplication/vnd.ffsnsapplication/vnd.fintsapplication/vnd.FloGraphItapplication/vnd.fluxtime.clipapplication/vnd.framemakerapplication/vnd.frogans.fncapplication/vnd.frogans.ltfapplication/vnd.fsc.weblaunchapplication/vnd.fujitsu.oasysapplication/vnd.fujitsu.oasys2application/vnd.fujitsu.oasys3application/vnd.fujitsu.oasysgpapplication/vnd.fujitsu.oasysprsapplication/vnd.fujixerox.ART4

application/vnd.fujixerox.ddd

application/vnd.denovo.fcselayout-link

application/vnd.dvb.esgcontainerapplication/vnd.dvb.ipdcesgaccess

application/vnd.ecowin.filerequestapplication/vnd.ecowin.fileupdate

application/vnd.ecowin.seriesrequestapplication/vnd.ecowin.seriesupdate

application/vnd.epson.quickanime

application/vnd.ericsson.quickcall

application/vnd.fujixerox.ART-EX

Page 77: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

application/vnd.fujixerox.HBPLapplication/vnd.fut-misnetapplication/vnd.fuzzysheet

application/vnd.grafeqapplication/vnd.gridmpapplication/vnd.groove-accountapplication/vnd.groove-help

application/vnd.groove-injector

application/vnd.groove-vcard

application/vnd.hbciapplication/vnd.hcl-bireports

application/vnd.hp-HPGLapplication/vnd.hp-hpidapplication/vnd.hp-hpsapplication/vnd.hp-jlytapplication/vnd.hp-PCLapplication/vnd.hp-PCLXLapplication/vnd.httphone

application/vnd.ibm.afplinedata

application/vnd.ibm.MiniPayapplication/vnd.ibm.modcap

application/vnd.iccprofileapplication/vnd.igloaderapplication/vnd.immervision-ivpapplication/vnd.immervision-ivu

application/vnd.fujixerox.docuworksapplication/vnd.fujixerox.docuworks.binder

application/vnd.genomatix.tuxedoapplication/vnd.google-earth.kml+xmlapplication/vnd.google-earth.kmz

application/vnd.groove-identity-message

application/vnd.groove-tool-messageapplication/vnd.groove-tool-template

application/vnd.HandHeld-Entertainment+xml

application/vnd.hhe.lesson-player

application/vnd.hzn-3d-crossword

application/vnd.ibm.electronic-media

application/vnd.ibm.rights-managementapplication/vnd.ibm.secure-container

Page 78: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

application/vnd.intercon.formnet

application/vnd.intertrust.digiboxapplication/vnd.intertrust.nncpapplication/vnd.intu.qboapplication/vnd.intu.qfx

application/vnd.is-xprapplication/vnd.jam

application/vnd.jisp

application/vnd.kahootzapplication/vnd.kde.karbonapplication/vnd.kde.kchartapplication/vnd.kde.kformulaapplication/vnd.kde.kivioapplication/vnd.kde.kontourapplication/vnd.kde.kpresenterapplication/vnd.kde.kspreadapplication/vnd.kde.kwordapplication/vnd.kenameaappapplication/vnd.kidspirationapplication/vnd.Kinarapplication/vnd.koan

application/vnd.kodak-descriptor

application/vnd.informedcontrol.rms+xmlapplication/vnd.informix-visionary

application/vnd.ipunplugged.rcprofileapplication/vnd.irepository.package+xml

application/vnd.japannet-directory-serviceapplication/vnd.japannet-jpnstore-wakeupapplication/vnd.japannet-payment-wakeupapplication/vnd.japannet-registrationapplication/vnd.japannet-registration-wakeupapplication/vnd.japannet-setstore-wakeupapplication/vnd.japannet-verificationapplication/vnd.japannet-verification-wakeupapplication/vnd.jcp.javame.midlet-rms

application/vnd.joost.joda-archive

Page 79: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

application/vnd.lotus-1-2-3application/vnd.lotus-approachapplication/vnd.lotus-freelanceapplication/vnd.lotus-notesapplication/vnd.lotus-organizer

application/vnd.lotus-screencamapplication/vnd.lotus-wordpro

application/vnd.marlin.drm.mdcfapplication/vnd.mcdapplication/vnd.medcalcdata

application/vnd.MFERapplication/vnd.mfmpapplication/vnd.micrografx.floapplication/vnd.micrografx.igxapplication/vnd.mif

application/vnd.Mobius.DAFapplication/vnd.Mobius.DISapplication/vnd.Mobius.MBKapplication/vnd.Mobius.MQYapplication/vnd.Mobius.MSLapplication/vnd.Mobius.PLCapplication/vnd.Mobius.TXF

application/vnd.liberty-request+xmlapplication/vnd.llamagraphics.life-balance.desktopapplication/vnd.llamagraphics.life-balance.exchange+xml

application/vnd.macports.portpkgapplication/vnd.marlin.drm.actiontoken+xmlapplication/vnd.marlin.drm.conftoken+xml

application/vnd.mediastation.cdkeyapplication/vnd.meridian-slingshot

application/vnd.minisoft-hp3000-saveapplication/vnd.mitsubishi.misty-guard.trustweb

application/vnd.mophun.applicationapplication/vnd.mophun.certificateapplication/vnd.motorola.flexsuiteapplication/vnd.motorola.flexsuite.adsi

Page 80: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

application/vnd.mozilla.xul+xmlapplication/vnd.ms-artgalryapplication/vnd.ms-asf

application/vnd.mseqapplication/vnd.ms-excelapplication/vnd.ms-fontobjectapplication/vnd.ms-htmlhelpapplication/vnd.msignapplication/vnd.ms-imsapplication/vnd.ms-lrm

application/vnd.ms-powerpointapplication/vnd.ms-projectapplication/vnd.ms-tnef

application/vnd.ms-worksapplication/vnd.ms-wpl

application/vnd.multiad.creator

application/vnd.musicianapplication/vnd.music-niffapplication/vnd.muvee.styleapplication/vnd.ncd.controlapplication/vnd.ncd.referenceapplication/vnd.nervanaapplication/vnd.netfpx

application/vnd.motorola.flexsuite.fisapplication/vnd.motorola.flexsuite.gotapapplication/vnd.motorola.flexsuite.kmrapplication/vnd.motorola.flexsuite.ttcapplication/vnd.motorola.flexsuite.wem

application/vnd.ms-cab-compressed

application/vnd.ms-playready.initiator+xml

application/vnd.ms-wmdrm.lic-chlg-reqapplication/vnd.ms-wmdrm.lic-respapplication/vnd.ms-wmdrm.meter-chlg-reqapplication/vnd.ms-wmdrm.meter-resp

application/vnd.ms-xpsdocument

application/vnd.multiad.creator.cif

application/vnd.neurolanguage.nluapplication/vnd.noblenet-directory

Page 81: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

application/vnd.noblenet-sealerapplication/vnd.noblenet-webapplication/vnd.nokia.catalogs

application/vnd.nokia.conml+xml

application/vnd.nokia.ncd

application/vnd.nokia.pcd+xml

application/vnd.novadigm.EDMapplication/vnd.novadigm.EDXapplication/vnd.novadigm.EXT

application/vnd.nokia.conml+wbxml

application/vnd.nokia.iptv.config+xmlapplication/vnd.nokia.iSDS-radio-presetsapplication/vnd.nokia.landmark+wbxmlapplication/vnd.nokia.landmark+xmlapplication/vnd.nokia.landmarkcollection+xml

application/vnd.nokia.n-gage.ac+xmlapplication/vnd.nokia.n-gage.dataapplication/vnd.nokia.n-gage.symbian.installapplication/vnd.nokia.pcd+wbxml

application/vnd.nokia.radio-presetapplication/vnd.nokia.radio-presets

application/vnd.oasis.opendocument.chartapplication/vnd.oasis.opendocument.chart-templateapplication/vnd.oasis.opendocument.formulaapplication/vnd.oasis.opendocument.formula-templateapplication/vnd.oasis.opendocument.graphicsapplication/vnd.oasis.opendocument.graphics-templateapplication/vnd.oasis.opendocument.imageapplication/vnd.oasis.opendocument.image-templateapplication/vnd.oasis.opendocument.presentation

Page 82: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

application/vnd.obnapplication/vnd.olpc-sugar

application/vnd.oma.bcast.ltkm

application/vnd.oma.bcast.sgdu

application/vnd.oma.bcast.stkmapplication/vnd.oma.dd2+xml

application/vnd.oasis.opendocument.presentation-templateapplication/vnd.oasis.opendocument.spreadsheetapplication/vnd.oasis.opendocument.spreadsheet-templateapplication/vnd.oasis.opendocument.textapplication/vnd.oasis.opendocument.text-masterapplication/vnd.oasis.opendocument.text-templateapplication/vnd.oasis.opendocument.text-web

application/vnd.oma.bcast.associated-procedure-parameter+xmlapplication/vnd.oma.bcast.drm-trigger+xmlapplication/vnd.oma.bcast.imd+xml

application/vnd.oma.bcast.notification+xmlapplication/vnd.oma.bcast.sgbootapplication/vnd.oma.bcast.sgdd+xml

application/vnd.oma.bcast.simple-symbol-containerapplication/vnd.oma.bcast.smartcard-trigger+xmlapplication/vnd.oma.bcast.sprov+xml

application/vnd.oma.drm.risd+xmlapplication/vnd.oma.group-usage-list+xmlapplication/vnd.oma.poc.detailed-progress-report+xmlapplication/vnd.oma.poc.final-report+xmlapplication/vnd.oma.poc.groups+xmlapplication/vnd.oma.poc.invocation-descriptor+xmlapplication/vnd.oma.poc.optimized-progress-report+xml

Page 83: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

application/vnd.omads-file+xml

application/vnd.omaloc-supl-init

application/vnd.oma-scws-config

application/vnd.osa.netdeployapplication/vnd.osgi.bundleapplication/vnd.osgi.dpapplication/vnd.otps.ct-kip+xmlapplication/vnd.palmapplication/vnd.paos.xmlapplication/vnd.pg.formatapplication/vnd.pg.osasli

application/vnd.picsel

application/vnd.pocketlearnapplication/vnd.powerbuilder6application/vnd.powerbuilder6-sapplication/vnd.powerbuilder7application/vnd.powerbuilder75

application/vnd.powerbuilder7-sapplication/vnd.preminet

application/vnd.pvi.ptid1application/vnd.pwg-multiplexed

application/vnd.rapid

application/vnd.oma.xcap-directory+xmlapplication/vnd.omads-email+xml

application/vnd.omads-folder+xml

application/vnd.oma-scws-http-requestapplication/vnd.oma-scws-http-responseapplication/vnd.openofficeorg.extension

application/vnd.piaccess.application-licence

application/vnd.poc.group-advertisement+xml

application/vnd.powerbuilder75-s

application/vnd.previewsystems.boxapplication/vnd.proteus.magazineapplication/vnd.publishare-delta-tree

application/vnd.pwg-xhtml-print+xmlapplication/vnd.qualcomm.brew-app-resapplication/vnd.Quark.QuarkXPress

Page 84: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

application/vnd.RenLearn.rlprint

application/vnd.ruckus.downloadapplication/vnd.s3smsapplication/vnd.sbm.mid2application/vnd.scribusapplication/vnd.sealed.3dfapplication/vnd.sealed.csfapplication/vnd.sealed.docapplication/vnd.sealed.emlapplication/vnd.sealed.mhtapplication/vnd.sealed.netapplication/vnd.sealed.pptapplication/vnd.sealed.tiffapplication/vnd.sealed.xls

application/vnd.seemailapplication/vnd.semaapplication/vnd.semdapplication/vnd.semf

application/vnd.smaf

application/vnd.solent.sdkm+xmlapplication/vnd.spotfire.dxpapplication/vnd.spotfire.sfsapplication/vnd.sss-codapplication/vnd.sss-dtfapplication/vnd.sss-ntfapplication/vnd.street-streamapplication/vnd.sun.wadl+xmlapplication/vnd.sus-calendarapplication/vnd.svdapplication/vnd.swiftview-ics

application/vnd.recordare.musicxmlapplication/vnd.recordare.musicxml+xml

application/vnd.sealedmedia.softseal.htmlapplication/vnd.sealedmedia.softseal.pdf

application/vnd.shana.informed.formdataapplication/vnd.shana.informed.formtemplateapplication/vnd.shana.informed.interchangeapplication/vnd.shana.informed.packageapplication/vnd.SimTech-MindMapper

application/vnd.syncml.dm+wbxml

Page 85: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

application/vnd.syncml.dm+xml

application/vnd.syncml+xml

application/vnd.tmobile-livetvapplication/vnd.trid.tptapplication/vnd.triscape.mxsapplication/vnd.trueappapplication/vnd.truedocapplication/vnd.ufdlapplication/vnd.uiq.themeapplication/vnd.umajinapplication/vnd.unityapplication/vnd.uoml+xmlapplication/vnd.uplanet.alert

application/vnd.uplanet.cacheop

application/vnd.uplanet.channel

application/vnd.uplanet.listapplication/vnd.uplanet.listcmd

application/vnd.uplanet.signalapplication/vnd.vcxapplication/vnd.vectorworksapplication/vnd.vd-study

application/vnd.visioapplication/vnd.visionary

application/vnd.vsfapplication/vnd.wap.sicapplication/vnd.wap.slcapplication/vnd.wap.wbxmlapplication/vnd.wap.wmlcapplication/vnd.wap.wmlscriptcapplication/vnd.webturbo

application/vnd.syncml.ds.notification

application/vnd.tao.intent-module-archive

application/vnd.uplanet.alert-wbxmlapplication/vnd.uplanet.bearer-choiceapplication/vnd.uplanet.bearer-choice-wbxml

application/vnd.uplanet.cacheop-wbxml

application/vnd.uplanet.channel-wbxml

application/vnd.uplanet.listcmd-wbxmlapplication/vnd.uplanet.list-wbxml

application/vnd.vidsoft.vidconference

application/vnd.vividence.scriptfile

Page 86: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

application/vnd.wfa.wscapplication/vnd.wmcapplication/vnd.wmf.bootstrapapplication/vnd.wordperfectapplication/vnd.wqd

application/vnd.wt.stfapplication/vnd.wv.csp+xmlapplication/vnd.wv.csp+wbxmlapplication/vnd.wv.ssp+xmlapplication/vnd.xaraapplication/vnd.xfdlapplication/vnd.xmpie.cpkgapplication/vnd.xmpie.dpkgapplication/vnd.xmpie.planapplication/vnd.xmpie.ppkgapplication/vnd.xmpie.xlimapplication/vnd.yamaha.hv-dic

application/vnd.zzazz.deck+xmlapplication/voicexml+xmlapplication/watcherinfo+xmlapplication/whoispp-queryapplication/whoispp-responseapplication/witaapplication/wordperfect5.1application/wsdl+xmlapplication/wspolicy+xmlapplication/x400-bpapplication/xcap-att+xmlapplication/xcap-caps+xmlapplication/xcap-el+xmlapplication/xcap-error+xmlapplication/xcap-ns+xmlapplication/xenc+xml

application/xhtml+xmlapplication/xmlapplication/xml-dtd

application/xmpp+xml

application/vnd.wrq-hp3000-labelled

application/vnd.yamaha.hv-scriptapplication/vnd.yamaha.hv-voiceapplication/vnd.yamaha.smaf-audioapplication/vnd.yamaha.smaf-phraseapplication/vnd.yellowriver-custom-menu

application/xhtml-voice+xml (Obsolete)

application/xml-external-parsed-entity

Page 87: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

application/xop+xmlapplication/xv+xmlapplication/zipaudio/32kadpcmaudio/3gppaudio/3gpp2audio/ac3audio/AMRaudio/AMR-WBaudio/amr-wb+audio/ascaudio/basicaudio/BV16audio/BV32audio/clearmodeaudio/CNaudio/DAT12audio/dlsaudio/dsr-es201108audio/dsr-es202050audio/dsr-es202211audio/dsr-es202212audio/eac3audio/DVI4audio/EVRCaudio/EVRC0audio/EVRC1audio/EVRCBaudio/EVRCB0audio/EVRCB1audio/EVRC-QCPaudio/EVRCWBaudio/EVRCWB0audio/EVRCWB1audio/exampleaudio/G722audio/G7221audio/G723audio/G726-16audio/G726-24audio/G726-32audio/G726-40audio/G728audio/G729audio/G7291audio/G729Daudio/G729Eaudio/GSMaudio/GSM-EFRaudio/iLBCaudio/L8audio/L16audio/L20

Page 88: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

audio/L24audio/LPCaudio/mobile-xmfaudio/MPAaudio/mp4audio/MP4A-LATMaudio/mpa-robustaudio/mpegaudio/mpeg4-genericaudio/parityfecaudio/PCMAaudio/PCMUaudio/prs.sidaudio/QCELPaudio/REDaudio/rtp-enc-aescm128audio/rRFC2045tp-midiaudio/rtxaudio/SMVaudio/SMV0audio/SMV-QCPaudio/sp-midiaudio/t140caudio/t38audio/telephone-eventaudio/toneaudio/ulpfecaudio/VDVIaudio/VMR-WBaudio/vnd.3gpp.iufpaudio/vnd.4SBaudio/vnd.audiokozaudio/vnd.CELPaudio/vnd.cisco.nseaudio/vnd.cmles.radio-eventsaudio/vnd.cns.anp1audio/vnd.cns.inf1audio/vnd.digital-windsaudio/vnd.dlna.adtsaudio/vnd.dolby.mlpaudio/vnd.everad.pljaudio/vnd.hns.audioaudio/vnd.lucent.voiceaudio/vnd.nokia.mobile-xmfaudio/vnd.nortel.vbkaudio/vnd.nuera.ecelp4800audio/vnd.nuera.ecelp7470audio/vnd.nuera.ecelp9600audio/vnd.octel.sbc

audio/vnd.rhetorex.32kadpcm

audio/vnd.qcelp - DEPRECATED - Please use audio/qcelp

Page 89: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

audio/vnd.vmx.cvsdimage/cgmimage/exampleimage/fitsimage/g3faximage/gifimage/iefimage/jp2image/jpegimage/jpmimage/jpximage/naplpsimage/pngimage/prs.btifimage/prs.ptiimage/t38image/tiffimage/tiff-fximage/vnd.adobe.photoshopimage/vnd.cns.inf2image/vnd.djvuimage/vnd.dwgimage/vnd.dxfimage/vnd.fastbidsheetimage/vnd.fpximage/vnd.fst

image/vnd.fujixerox.edmics-mmrimage/vnd.fujixerox.edmics-rlcimage/vnd.globalgraphics.pgbimage/vnd.microsoft.iconimage/vnd.miximage/vnd.ms-modiimage/vnd.net-fpximage/vnd.sealed.png

image/vnd.svfimage/vnd.wap.wbmpimage/vnd.xiffmessage/CPIMmessage/delivery-status

message/disposition-notificationmessage/examplemessage/external-bodymessage/httpmessage/newsmessage/partial

audio/vnd.sealedmedia.softseal.mpeg

image/vnd.sealedmedia.softseal.gifimage/vnd.sealedmedia.softseal.jpg

Page 90: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

message/rfc822message/s-httpmessage/sipmessage/sipfragmessage/tracking-statusmessage/vnd.si.simpmodel/examplemodel/igesmodel/meshmodel/vnd.dwfmodel/vnd.flatland.3dmlmodel/vnd.gdlmodel/vnd.gs-gdlmodel/vnd.gtwmodel/vnd.moml+xmlmodel/vnd.mts

model/vnd.vtumodel/vrmlmultipart/alternativemultipart/appledoublemultipart/byterangesmultipart/digestmultipart/encryptedmultipart/examplemultipart/form-datamultipart/header-setmultipart/mixedmultipart/parallelmultipart/relatedmultipart/reportmultipart/signedmultipart/voice-messagetext/calendartext/csstext/csvtext/directorytext/dnstext/ecmascript (obsolete)text/enrichedtext/exampletext/htmltext/javascript (obsolete)text/parityfectext/plaintext/prs.fallenstein.rsttext/prs.lines.tagtext/REDtext/rfc822-headerstext/richtext

model/vnd.parasolid.transmit.binarymodel/vnd.parasolid.transmit.text

Page 91: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

text/rtftext/rtp-enc-aescm128text/rtxtext/sgmltext/t140text/tab-separated-valuestext/trofftext/ulpfectext/uri-listtext/vnd.abctext/vnd.curltext/vnd.DMClientScript

text/vnd.flytext/vnd.fmi.flexstortext/vnd.in3d.3dmltext/vnd.in3d.spottext/vnd.IPTC.NewsMLtext/vnd.IPTC.NITFtext/vnd.latex-ztext/vnd.motorola.reflextext/vnd.ms-mediapackage

text/vnd.si.uricatalogue

text/vnd.trolltech.linguisttext/vnd.wap.sitext/vnd.wap.sltext/vnd.wap.wmltext/vnd.wap.wmlscripttext/xmltext/xml-external-parsed-entityvideo/3gppvideo/3gpp2video/3gpp-ttvideo/BMPEGvideo/BT656video/CelBvideo/DVvideo/examplevideo/H261video/H263video/H263-1998video/H263-2000video/H264video/JPEGvideo/MJ2video/MP1Svideo/MP2Pvideo/MP2T

text/vnd.esmertec.theme-descriptor

text/vnd.net2phone.commcenter.command

text/vnd.sun.j2me.app-descriptor

Page 92: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

video/mp4video/MP4V-ESvideo/MPVvideo/mpegvideo/mpeg4-genericvideo/nvvideo/parityfecvideo/pointervideo/quicktimevideo/rawvideo/rtp-enc-aescm128video/rtxvideo/SMPTE292Mvideo/ulpfecvideo/vc1video/vnd.dlna.mpeg-ttsvideo/vnd.fvtvideo/vnd.hns.video

video/vnd.iptvforum.ttsavcvideo/vnd.iptvforum.ttsmpeg2video/vnd.motorola.videovideo/vnd.motorola.videopvideo/vnd.mpegurl

video/vnd.nokia.videovoipvideo/vnd.objectvideovideo/vnd.sealed.mpeg1video/vnd.sealed.mpeg4video/vnd.sealed.swf

video/vnd.vivo

video/vnd.iptvforum.1dparityfec-1010video/vnd.iptvforum.1dparityfec-2005video/vnd.iptvforum.2dparityfec-1010video/vnd.iptvforum.2dparityfec-2005

video/vnd.nokia.interleaved-multimedia

video/vnd.sealedmedia.softseal.mov

Page 93: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

BinaryObjectMimeCodeBinary Object Mime CodeMIME Media Types2008-11-12PlaceholderPlaceholder

IANA

en

Valueactivemessageandrew-insetapplefileatom+xmlatomicmailatomcat+xmlatomsvc+xmlauth-policy+xmlbatch-SMTPbeep+xmlcals-1840ccxml+xmlcellml+xmlcnrp+xmlcommonground

conference-info+xmlcpl+xmlcsta+xmlCSTAdata+xmlcybercashdavmount+xmldca-rftdec-dxdialog-info+xmldicomdnsdvcsecmascriptEDI-ConsentEDIFACTEDI-X12epp+xmleshopexamplefastinfosetfastsoapfitsfont-tdpfrH224http

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/cefact/BinaryObjectMimeCode-2.0.gc

Page 94: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

hyperstudioiges

im-iscomposing+xmlindexindex.cmdindex.objindex.responseindex.vndiotpippisupjavascriptjsonkpml-request+xmlkpml-response+xmlmac-binhex40macwriteiimarcmathematica

mbms-associated-procedure-description+xml

mbms-deregister+xmlmbms-envelope+xml

mbms-msk-response+xmlmbms-msk+xml

mbms-protection-description+xml

mbms-reception-report+xml

mbms-register-response+xmlmbms-register+xml

mbms-user-service-description+xmlmboxmedia_control+xml

mediaservercontrol+xmlmikeymoss-keysmoss-signaturemosskey-datamosskey-requestmpeg4-genericmpeg4-iodmpeg4-iod-xmtmp4mswordmxfnasdata

Page 95: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

news-message-idnews-transmissionnssocsp-requestocsp-responseoctet-streamodaoebps-package+xmloggparityfecpdfpgp-encryptedpgp-keyspgp-signaturepidf+xmlpkcs10pkcs7-mimepkcs7-signaturepkix-certpkixcmppkix-crlpkix-pkipathpls+xmlpoc-settings+xmlpostscript

prs.alvestrand.titrax-sheetprs.cwwprs.nprendprs.pluckerrdf+xmlqsigreginfo+xml

relax-ng-compact-syntaxremote-printingresource-lists+xmlriscosrlmi+xmlrls-services+xmlrtfrtxsamlassertion+xmlsamlmetadata+xmlsbml+xmlscvp-cv-requestscvp-cv-responsescvp-vp-requestscvp-vp-responsesdpset-payment

set-payment-initiation

Page 96: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

set-registration

set-registration-initiationsgmlsgml-open-catalogshf+xmlsievesimple-filter+xml

simple-message-summary

simpleSymbolContainerslatesmil (OBSOLETE)smil+xmlsoap+fastinfosetsoap+xmlsparql-querysparql-results+xmlspirits-event+xmlsrgssrgs+xmlssml+xmltimestamp-querytimestamp-replytve-triggerulpfecvemmivnd.3gpp.bsf+xml

vnd.3gpp.pic-bw-large

vnd.3gpp.pic-bw-small

vnd.3gpp.pic-bw-varvnd.3gpp.sms

vnd.3gpp2.bcmcsinfo+xmlvnd.3gpp2.smsvnd.3gpp2.tcap

vnd.3M.Post-it-Notes

vnd.accpac.simply.aso

vnd.accpac.simply.impvnd.acucobolvnd.acucorpvnd.adobe.xdp+xmlvnd.adobe.xfdfvnd.aether.imp

vnd.americandynamics.acc

Page 97: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

vnd.amiga.ami

vnd.anser-web-certificate-issue-initiation

vnd.antix.game-component

vnd.apple.installer+xmlvnd.audiographvnd.autopackagevnd.avistar+xml

vnd.blueice.multipassvnd.bmivnd.businessobjectsvnd.cab-jscriptvnd.canon-cpdlvnd.canon-lips

vnd.cendio.thinlinc.clientconfvnd.chemdraw+xml

vnd.chipnuts.karaoke-mmdvnd.cinderellavnd.cirpack.isdn-extvnd.claymorevnd.clonk.c4group

vnd.commerce-battellevnd.commonspacevnd.cosmocallervnd.contact.cmsgvnd.crick.clicker

vnd.crick.clicker.keyboard

vnd.crick.clicker.palette

vnd.crick.clicker.template

vnd.crick.clicker.wordbank

vnd.criticaltools.wbs+xmlvnd.ctc-posmlvnd.ctct.ws+xmlvnd.cups-pdfvnd.cups-postscriptvnd.cups-ppdvnd.cups-rastervnd.cups-rawvnd.curlvnd.cybankvnd.data-vision.rdz

Page 98: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

vnd.denovo.fcselayout-linkvnd.dnavnd.dpgraphvnd.dreamfactory

vnd.dvb.esgcontainer

vnd.dvb.ipdcesgaccessvnd.dxrvnd.ecdis-updatevnd.ecowin.chart

vnd.ecowin.filerequest

vnd.ecowin.fileupdatevnd.ecowin.series

vnd.ecowin.seriesrequest

vnd.ecowin.seriesupdatevnd.enlivenvnd.epson.esfvnd.epson.msf

vnd.epson.quickanimevnd.epson.saltvnd.epson.ssf

vnd.ericsson.quickcallvnd.eszigno3+xmlvnd.eudora.datavnd.ezpix-albumvnd.ezpix-packagevnd.fdfvnd.ffsnsvnd.fintsvnd.FloGraphItvnd.fluxtime.clipvnd.framemakervnd.frogans.fncvnd.frogans.ltfvnd.fsc.weblaunchvnd.fujitsu.oasysvnd.fujitsu.oasys2vnd.fujitsu.oasys3vnd.fujitsu.oasysgpvnd.fujitsu.oasysprsvnd.fujixerox.ART4

vnd.fujixerox.ART-EXvnd.fujixerox.ddd

Page 99: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

vnd.fujixerox.docuworks

vnd.fujixerox.docuworks.bindervnd.fujixerox.HBPLvnd.fut-misnetvnd.fuzzysheet

vnd.genomatix.tuxedo

vnd.google-earth.kml+xml

vnd.google-earth.kmzvnd.grafeqvnd.gridmpvnd.groove-accountvnd.groove-help

vnd.groove-identity-messagevnd.groove-injector

vnd.groove-tool-message

vnd.groove-tool-templatevnd.groove-vcard

vnd.HandHeld-Entertainment+xmlvnd.hbcivnd.hcl-bireports

vnd.hhe.lesson-playervnd.hp-HPGLvnd.hp-hpidvnd.hp-hpsvnd.hp-jlytvnd.hp-PCLvnd.hp-PCLXLvnd.httphone

vnd.hzn-3d-crosswordvnd.ibm.afplinedata

vnd.ibm.electronic-mediavnd.ibm.MiniPayvnd.ibm.modcap

vnd.ibm.rights-management

vnd.ibm.secure-containervnd.iccprofilevnd.igloadervnd.immervision-ivpvnd.immervision-ivu

Page 100: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

vnd.informedcontrol.rms+xml

vnd.informix-visionary

vnd.intercon.formnet

vnd.intertrust.digiboxvnd.intertrust.nncpvnd.intu.qbovnd.intu.qfx

vnd.ipunplugged.rcprofile

vnd.irepository.package+xmlvnd.is-xprvnd.jam

vnd.japannet-directory-service

vnd.japannet-jpnstore-wakeup

vnd.japannet-payment-wakeup

vnd.japannet-registration

vnd.japannet-registration-wakeup

vnd.japannet-setstore-wakeup

vnd.japannet-verification

vnd.japannet-verification-wakeup

vnd.jcp.javame.midlet-rmsvnd.jisp

vnd.joost.joda-archivevnd.kahootzvnd.kde.karbonvnd.kde.kchartvnd.kde.kformulavnd.kde.kiviovnd.kde.kontourvnd.kde.kpresentervnd.kde.kspreadvnd.kde.kwordvnd.kenameaappvnd.kidspirationvnd.Kinarvnd.koan

vnd.kodak-descriptor

Page 101: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

vnd.liberty-request+xml

vnd.llamagraphics.life-balance.desktop

vnd.llamagraphics.life-balance.exchange+xmlvnd.lotus-1-2-3vnd.lotus-approachvnd.lotus-freelancevnd.lotus-notesvnd.lotus-organizer

vnd.lotus-screencamvnd.lotus-wordpro

vnd.macports.portpkg

vnd.marlin.drm.actiontoken+xml

vnd.marlin.drm.conftoken+xml

vnd.marlin.drm.mdcfvnd.mcdvnd.medcalcdata

vnd.mediastation.cdkey

vnd.meridian-slingshotvnd.MFERvnd.mfmpvnd.micrografx.flovnd.micrografx.igxvnd.mif

vnd.minisoft-hp3000-save

vnd.mitsubishi.misty-guard.trustwebvnd.Mobius.DAFvnd.Mobius.DISvnd.Mobius.MBKvnd.Mobius.MQYvnd.Mobius.MSLvnd.Mobius.PLCvnd.Mobius.TXF

vnd.mophun.application

vnd.mophun.certificate

vnd.motorola.flexsuite

vnd.motorola.flexsuite.adsi

Page 102: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

vnd.motorola.flexsuite.fis

vnd.motorola.flexsuite.gotap

vnd.motorola.flexsuite.kmr

vnd.motorola.flexsuite.ttc

vnd.motorola.flexsuite.wemvnd.mozilla.xul+xmlvnd.ms-artgalryvnd.ms-asf

vnd.ms-cab-compressedvnd.mseqvnd.ms-excelvnd.ms-fontobjectvnd.ms-htmlhelpvnd.msignvnd.ms-imsvnd.ms-lrm

vnd.ms-playready.initiator+xmlvnd.ms-powerpointvnd.ms-projectvnd.ms-tnef

vnd.ms-wmdrm.lic-chlg-req

vnd.ms-wmdrm.lic-resp

vnd.ms-wmdrm.meter-chlg-req

vnd.ms-wmdrm.meter-respvnd.ms-worksvnd.ms-wpl

vnd.ms-xpsdocumentvnd.multiad.creator

vnd.multiad.creator.cifvnd.musicianvnd.music-niffvnd.muvee.stylevnd.ncd.controlvnd.ncd.referencevnd.nervanavnd.netfpx

vnd.neurolanguage.nlu

vnd.noblenet-directory

Page 103: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

vnd.noblenet-sealervnd.noblenet-webvnd.nokia.catalogs

vnd.nokia.conml+wbxml

vnd.nokia.conml+xml

vnd.nokia.iptv.config+xml

vnd.nokia.iSDS-radio-presets

vnd.nokia.landmark+wbxml

vnd.nokia.landmark+xml

vnd.nokia.landmarkcollection+xmlvnd.nokia.ncd

vnd.nokia.n-gage.ac+xml

vnd.nokia.n-gage.data

vnd.nokia.n-gage.symbian.install

vnd.nokia.pcd+wbxmlvnd.nokia.pcd+xml

vnd.nokia.radio-preset

vnd.nokia.radio-presetsvnd.novadigm.EDMvnd.novadigm.EDXvnd.novadigm.EXT

vnd.oasis.opendocument.chart

vnd.oasis.opendocument.chart-template

vnd.oasis.opendocument.formula

vnd.oasis.opendocument.formula-template

vnd.oasis.opendocument.graphics

vnd.oasis.opendocument.graphics-template

vnd.oasis.opendocument.image

vnd.oasis.opendocument.image-template

vnd.oasis.opendocument.presentation

Page 104: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

vnd.oasis.opendocument.presentation-template

vnd.oasis.opendocument.spreadsheet

vnd.oasis.opendocument.spreadsheet-template

vnd.oasis.opendocument.text

vnd.oasis.opendocument.text-master

vnd.oasis.opendocument.text-template

vnd.oasis.opendocument.text-webvnd.obnvnd.olpc-sugar

vnd.oma.bcast.associated-procedure-parameter+xml

vnd.oma.bcast.drm-trigger+xml

vnd.oma.bcast.imd+xmlvnd.oma.bcast.ltkm

vnd.oma.bcast.notification+xml

vnd.oma.bcast.sgboot

vnd.oma.bcast.sgdd+xmlvnd.oma.bcast.sgdu

vnd.oma.bcast.simple-symbol-container

vnd.oma.bcast.smartcard-trigger+xml

vnd.oma.bcast.sprov+xmlvnd.oma.bcast.stkmvnd.oma.dd2+xml

vnd.oma.drm.risd+xml

vnd.oma.group-usage-list+xml

vnd.oma.poc.detailed-progress-report+xml

vnd.oma.poc.final-report+xml

vnd.oma.poc.groups+xml

vnd.oma.poc.invocation-descriptor+xml

vnd.oma.poc.optimized-progress-report+xml

Page 105: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

vnd.oma.xcap-directory+xml

vnd.omads-email+xmlvnd.omads-file+xml

vnd.omads-folder+xmlvnd.omaloc-supl-init

vnd.oma-scws-config

vnd.oma-scws-http-request

vnd.oma-scws-http-response

vnd.openofficeorg.extensionvnd.osa.netdeployvnd.osgi.bundlevnd.osgi.dpvnd.otps.ct-kip+xmlvnd.palmvnd.paos.xmlvnd.pg.formatvnd.pg.osasli

vnd.piaccess.application-licencevnd.picsel

vnd.poc.group-advertisement+xmlvnd.pocketlearnvnd.powerbuilder6vnd.powerbuilder6-svnd.powerbuilder7vnd.powerbuilder75

vnd.powerbuilder75-svnd.powerbuilder7-svnd.preminet

vnd.previewsystems.box

vnd.proteus.magazine

vnd.publishare-delta-treevnd.pvi.ptid1vnd.pwg-multiplexed

vnd.pwg-xhtml-print+xml

vnd.qualcomm.brew-app-res

vnd.Quark.QuarkXPressvnd.rapid

Page 106: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

vnd.recordare.musicxml

vnd.recordare.musicxml+xml

vnd.RenLearn.rlprint

vnd.ruckus.downloadvnd.s3smsvnd.sbm.mid2vnd.scribusvnd.sealed.3dfvnd.sealed.csfvnd.sealed.docvnd.sealed.emlvnd.sealed.mhtvnd.sealed.netvnd.sealed.pptvnd.sealed.tiffvnd.sealed.xls

vnd.sealedmedia.softseal.html

vnd.sealedmedia.softseal.pdfvnd.seemailvnd.semavnd.semdvnd.semf

vnd.shana.informed.formdata

vnd.shana.informed.formtemplate

vnd.shana.informed.interchange

vnd.shana.informed.package

vnd.SimTech-MindMappervnd.smaf

vnd.solent.sdkm+xmlvnd.spotfire.dxpvnd.spotfire.sfsvnd.sss-codvnd.sss-dtfvnd.sss-ntfvnd.street-streamvnd.sun.wadl+xmlvnd.sus-calendarvnd.svdvnd.swiftview-ics

vnd.syncml.dm+wbxml

Page 107: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

vnd.syncml.dm+xml

vnd.syncml.ds.notificationvnd.syncml+xml

vnd.tao.intent-module-archivevnd.tmobile-livetvvnd.trid.tptvnd.triscape.mxsvnd.trueappvnd.truedocvnd.ufdlvnd.uiq.themevnd.umajinvnd.unityvnd.uoml+xmlvnd.uplanet.alert

vnd.uplanet.alert-wbxml

vnd.uplanet.bearer-choice

vnd.uplanet.bearer-choice-wbxml

vnd.uplanet.cacheop

vnd.uplanet.cacheop-wbxmlvnd.uplanet.channel

vnd.uplanet.channel-wbxmlvnd.uplanet.listvnd.uplanet.listcmd

vnd.uplanet.listcmd-wbxml

vnd.uplanet.list-wbxmlvnd.uplanet.signalvnd.vcxvnd.vectorworksvnd.vd-study

vnd.vidsoft.vidconferencevnd.visiovnd.visionary

vnd.vividence.scriptfilevnd.vsfvnd.wap.sicvnd.wap.slcvnd.wap.wbxmlvnd.wap.wmlcvnd.wap.wmlscriptcvnd.webturbo

Page 108: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

vnd.wfa.wscvnd.wmcvnd.wmf.bootstrapvnd.wordperfectvnd.wqd

vnd.wrq-hp3000-labelledvnd.wt.stfvnd.wv.csp+xmlvnd.wv.csp+wbxmlvnd.wv.ssp+xmlvnd.xaravnd.xfdlvnd.xmpie.cpkgvnd.xmpie.dpkgvnd.xmpie.planvnd.xmpie.ppkgvnd.xmpie.xlimvnd.yamaha.hv-dic

vnd.yamaha.hv-script

vnd.yamaha.hv-voice

vnd.yamaha.smaf-audio

vnd.yamaha.smaf-phrase

vnd.yellowriver-custom-menuvnd.zzazz.deck+xmlvoicexml+xmlwatcherinfo+xmlwhoispp-querywhoispp-responsewitawordperfect5.1wsdl+xmlwspolicy+xmlx400-bpxcap-att+xmlxcap-caps+xmlxcap-el+xmlxcap-error+xmlxcap-ns+xmlxenc+xml

xhtml-voice+xml (Obsolete)xhtml+xmlxmlxml-dtd

xml-external-parsed-entityxmpp+xml

Page 109: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

xop+xmlxv+xmlzip32kadpcm3gpp3gpp2ac3AMRAMR-WBamr-wb+ascbasicBV16BV32clearmodeCNDAT12dlsdsr-es201108dsr-es202050dsr-es202211dsr-es202212eac3DVI4EVRCEVRC0EVRC1EVRCBEVRCB0EVRCB1EVRC-QCPEVRCWBEVRCWB0EVRCWB1exampleG722G7221G723G726-16G726-24G726-32G726-40G728G729G7291G729DG729EGSMGSM-EFRiLBCL8L16L20

Page 110: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

L24LPCmobile-xmfMPAmp4MP4A-LATMmpa-robustmpegmpeg4-genericparityfecPCMAPCMUprs.sidQCELPREDrtp-enc-aescm128rtp-midirtxSMVSMV0SMV-QCPsp-midit140ct38telephone-eventtoneulpfecVDVIVMR-WBvnd.3gpp.iufpvnd.4SBvnd.audiokozvnd.CELPvnd.cisco.nsevnd.cmles.radio-eventsvnd.cns.anp1vnd.cns.inf1vnd.digital-windsvnd.dlna.adtsvnd.dolby.mlpvnd.everad.pljvnd.hns.audiovnd.lucent.voicevnd.nokia.mobile-xmfvnd.nortel.vbkvnd.nuera.ecelp4800vnd.nuera.ecelp7470vnd.nuera.ecelp9600vnd.octel.sbc

vnd.qcelp - DEPRECATED - Please use audio/qcelpvnd.rhetorex.32kadpcm

Page 111: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

vnd.sealedmedia.softseal.mpegvnd.vmx.cvsdcgmexamplefitsg3faxgifiefjp2jpegjpmjpxnaplpspngprs.btifprs.ptit38tifftiff-fxvnd.adobe.photoshopvnd.cns.inf2vnd.djvuvnd.dwgvnd.dxfvnd.fastbidsheetvnd.fpxvnd.fst

vnd.fujixerox.edmics-mmrvnd.fujixerox.edmics-rlcvnd.globalgraphics.pgbvnd.microsoft.iconvnd.mixvnd.ms-modivnd.net-fpxvnd.sealed.png

vnd.sealedmedia.softseal.gif

vnd.sealedmedia.softseal.jpgvnd.svfvnd.wap.wbmpvnd.xiffCPIMdelivery-status

disposition-notificationexampleexternal-bodyhttpnewspartial

Page 112: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

rfc822s-httpsipsipfragtracking-statusvnd.si.simpexampleigesmeshvnd.dwfvnd.flatland.3dmlvnd.gdlvnd.gs-gdlvnd.gtwvnd.moml+xmlvnd.mts

vnd.parasolid.transmit.binary

vnd.parasolid.transmit.textvnd.vtuvrmlalternativeappledoublebyterangesdigestencryptedexampleform-dataheader-setmixedparallelrelatedreportsignedvoice-messagecalendarcsscsvdirectorydnsecmascript (obsolete)enrichedexamplehtmljavascript (obsolete)parityfecplainprs.fallenstein.rstprs.lines.tagREDrfc822-headersrichtext

Page 113: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

rtfrtp-enc-aescm128rtxsgmlt140tab-separated-valuestroffulpfecuri-listvnd.abcvnd.curlvnd.DMClientScript

vnd.esmertec.theme-descriptorvnd.flyvnd.fmi.flexstorvnd.in3d.3dmlvnd.in3d.spotvnd.IPTC.NewsMLvnd.IPTC.NITFvnd.latex-zvnd.motorola.reflexvnd.ms-mediapackage

vnd.net2phone.commcenter.commandvnd.si.uricatalogue

vnd.sun.j2me.app-descriptorvnd.trolltech.linguistvnd.wap.sivnd.wap.slvnd.wap.wmlvnd.wap.wmlscriptxmlxml-external-parsed-entity3gpp3gpp23gpp-ttBMPEGBT656CelBDVexampleH261H263H263-1998H263-2000H264JPEGMJ2MP1SMP2PMP2T

Page 114: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

mp4MP4V-ESMPVmpegmpeg4-genericnvparityfecpointerquicktimerawrtp-enc-aescm128rtxSMPTE292Mulpfecvc1vnd.dlna.mpeg-ttsvnd.fvtvnd.hns.video

vnd.iptvforum.1dparityfec-1010

vnd.iptvforum.1dparityfec-2005

vnd.iptvforum.2dparityfec-1010

vnd.iptvforum.2dparityfec-2005vnd.iptvforum.ttsavcvnd.iptvforum.ttsmpeg2vnd.motorola.videovnd.motorola.videopvnd.mpegurl

vnd.nokia.interleaved-multimediavnd.nokia.videovoipvnd.objectvideovnd.sealed.mpeg1vnd.sealed.mpeg4vnd.sealed.swf

vnd.sealedmedia.softseal.movvnd.vivo

Page 115: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortName CatalogueDocumentTypeCodeLongName Catalogue Document Type CodeListID CWA ???Version 1CanonicalUri PlaceholderCanonicalVersionUri PlaceholderLocationUriAgencyLongName CEN/ISSS WS/BIIAgencyIdentifierLocale en

Code ValueBrochure BrochureDrawing DrawingPicture PictureProductSheet Product Sheet

Page 116: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

CodeAAABACADAEAFAGAHAIAJAKALAMANAOAPAQARASATAUCAEIEMEXFTFXGMIEIMMAPBPSSWTETGTLTMTTTXXF

Page 117: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

XGXHXIXJ

Page 118: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ChannelCodeChannel CodeUN/ECE 3155D08BPlaceholderPlaceholder

United Nations Economic Commission for Europe6en

ValueCircuit switchingSITAARINCAT&T mailboxPeripheral deviceU.S. Defense Switched NetworkU.S. federal telecommunications systemWorld Wide WebInternational calling country codeAlternate telephoneVideotex numberCellular phoneInternational telephone direct lineO.F.T.P. (ODETTE File Transfer Protocol)Uniform Resource Location (URL)Very High Frequency (VHF) radio telephoneX.400 address for mail textAS1 addressAS2 addressAS3 addressFile Transfer ProtocolCable addressEDI transmissionElectronic mailExtensionFile transfer access methodTelefaxGEIS (General Electric Information Service) mailboxIBM information exchangeInternal mailMailPostbox numberPacket switchingS.W.I.F.T.TelephoneTelegraphTelexTelemailTeletextTWXX.400 address

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/ChannelCode-2.0.gc

Page 119: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

PagerInternational telephone switchboardNational telephone direct lineNational telephone switchboard

Page 120: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortName CommodityCodeLongName Commodity CodeListID CWA ???Version 1CanonicalUri PlaceholderCanonicalVersionUri PlaceholderLocationUriAgencyLongName CEN/ISSS WS/BIIAgencyIdentifierLocale en

Code ValueCV Customs Article NumberGN National Product Group CodeHS Harmonised System

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/CommodityCode-2.0.gc

Page 121: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

CodeADAEAFAGAIALAMANAOAQARASATAUAWAXAZBABBBDBEBFBGBHBIBLBJBMBNBOBRBSBTBVBWBYBZCACCCDCF

Page 122: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

CGCHCICKCLCMCNCOCRCUCVCXCYCZDEDJDKDMDODZECEEEGEHERESETFIFJFKFMFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGUGWGYHK

Page 123: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

HMHNHRHTHUIDIEILIMINIOIQIRISITJEJMJOJPKEKGKHKIKMKNKPKRKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMDMEMFMGMHMKMLMMMNMO

Page 124: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

MPMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPRPSPTPWPYQARORSRURWSASBSCSDSESGSHSISJSK

Page 125: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

SLSMSNSOSRSTSVSYSZTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWTZUAUGUMUSUYUZVAVCVEVGVIVNVUWFWSYEYTZAZMZW

Page 126: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

CountryIdentificationCodeCountry Identification CodeISO 3166second edition 2006 with modifications dated 2008-09-30PlaceholderPlaceholder

International Organization of Standardization5en

ValueANDORRAUNITED ARAB EMIRATESAFGHANISTANANTIGUA AND BARBUDAANGUILLAALBANIAARMENIANETHERLANDS ANTILLESANGOLAANTARCTICAARGENTINAAMERICAN SAMOAAUSTRIAAUSTRALIAARUBAÅLAND ISLANDSAZERBAIJANBOSNIA AND HERZEGOVINABARBADOSBANGLADESHBELGIUMBURKINA FASOBULGARIABAHRAINBURUNDISAINT BARTHELEMYBENINBERMUDABRUNEI DARUSSALAMBOLIVIABRAZILBAHAMASBHUTANBOUVET ISLANDBOTSWANABELARUSBELIZECANADACOCOS (KEELING) ISLANDSCONGO, THE DEMOCRATIC REPUBLIC OF THECENTRAL AFRICAN REPUBLIC

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/CountryIdentificationCode-2.0.gc

Page 127: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

CONGOSWITZERLANDCOTE D'IVOIRECOOK ISLANDSCHILECAMEROONCHINACOLOMBIACOSTA RICACUBACAPE VERDECHRISTMAS ISLANDCYPRUSCZECH REPUBLICGERMANYDJIBOUTIDENMARKDOMINICADOMINICAN REPUBLICALGERIAECUADORESTONIAEGYPTWESTERN SAHARAERITREASPAINETHIOPIAFINLANDFIJIFALKLAND ISLANDS (MALVINAS)MICRONESIA, FEDERATED STATES OFFAROE ISLANDSFRANCEGABONUNITED KINGDOMGRENADAGEORGIAFRENCH GUIANAGUERNSEYGHANAGIBRALTARGREENLANDGAMBIAGUINEAGUADELOUPEEQUATORIAL GUINEAGREECESOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDSGUATEMALAGUAMGUINEA-BISSAUGUYANAHONG KONG

Page 128: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

HEARD ISLAND AND MCDONALD ISLANDSHONDURASCROATIAHAITIHUNGARYINDONESIAIRELANDISRAELISLE OF MANINDIABRITISH INDIAN OCEAN TERRITORYIRAQIRAN, ISLAMIC REPUBLIC OFICELANDITALYJERSEYJAMAICAJORDANJAPANKENYAKYRGYZSTANCAMBODIAKIRIBATICOMOROSSAINT KITTS AND NEVISKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OFKOREA, REPUBLIC OFKUWAITCAYMAN ISLANDSKAZAKHSTANLAO PEOPLE'S DEMOCRATIC REPUBLICLEBANONSAINT LUCIALIECHTENSTEINSRI LANKALIBERIALESOTHOLITHUANIALUXEMBOURGLATVIALIBYAN ARAB JAMAHIRIYAMOROCCOMONACOMOLDOVAMONTENEGROSAINT MARTINMADAGASCARMARSHALL ISLANDSMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMALIMYANMARMONGOLIAMACAO

Page 129: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

NORTHERN MARIANA ISLANDSMARTINIQUEMAURITANIAMONTSERRATMALTAMAURITIUSMALDIVESMALAWIMEXICOMALAYSIAMOZAMBIQUENAMIBIANEW CALEDONIANIGERNORFOLK ISLANDNIGERIANICARAGUANETHERLANDSNORWAYNEPALNAURUNIUENEW ZEALANDOMANPANAMAPERUFRENCH POLYNESIAPAPUA NEW GUINEAPHILIPPINESPAKISTANPOLANDSAINT PIERRE AND MIQUELONPITCAIRNPUERTO RICOPALESTINIAN TERRITORY, OCCUPIEDPORTUGALPALAUPARAGUAYQATARROMANIASERBIARUSSIAN FEDERATIONRWANDASAUDI ARABIASOLOMON ISLANDSSEYCHELLESSUDANSWEDENSINGAPORESAINT HELENASLOVENIASVALBARD AND JAN MAYENSLOVAKIA

Page 130: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

SIERRA LEONESAN MARINOSENEGALSOMALIASURINAMESAO TOME AND PRINCIPEEL SALVADORSYRIAN ARAB REPUBLICSWAZILANDTURKS AND CAICOS ISLANDSCHADFRENCH SOUTHERN TERRITORIESTOGOTHAILANDTAJIKISTANTOKELAUTIMOR-LESTETURKMENISTANTUNISIATONGATURKEYTRINIDAD AND TOBAGOTUVALUTAIWAN, PROVINCE OF CHINATANZANIA, UNITED REPUBLIC OFUKRAINEUGANDAUNITED STATES MINOR OUTLYING ISLANDSUNITED STATESURUGUAYUZBEKISTANHOLY SEE (VATICAN CITY STATE)SAINT VINCENT AND THE GRENADINESVENEZUELAVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.VIET NAMVANUATUWALLIS AND FUTUNASAMOAYEMENMAYOTTESOUTH AFRICAZAMBIAZIMBABWE.

Page 131: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

Codeurn:www.cenbii.eu:transaction:biicoretrdm034:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm035:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm036:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm037:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm038:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm039:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm046:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm047:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm048:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm049:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm050:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm018:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm055:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm054:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm019:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm057:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm058:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm020:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm059:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm060:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm021:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm061:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm062:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm022:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm023:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm024:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm025:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm056:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm001:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm002:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm003:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm004:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm005:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm006:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm010:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm013:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm014:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm015:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm011:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm012:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm007:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm008:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm009:ver1.0

Page 132: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

urn:www.cenbii.eu:transaction:biicoretrdm052:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm053:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm063:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm016:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm017:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm026:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm051:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm027:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm029:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm031:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm028:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm033:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm030:ver1.0urn:www.cenbii.eu:transaction:biicoretrdm032:ver1.0

urn:www.cenbii.eu:transaction:BiiCoreTrdm010:ver1.0:extensionId

Transaction data model used for each document instance is identified by using the customization element with a urn in the following format where the last part is an identifier for a possible extension.

Above are the identificators for the transaction data models against which the message instance should be validated. If extensions are used their identifier should be added at the end of which.

Page 133: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

CoreTransactionCustomisationIDCore Transaction Customisation IDCWA ???1PlaceholderPlaceholder

CEN/ISSS WS/BII

en

ValuePriorInformationNoticePriorInformationNoticePublicationConfirmationPriorInfomationNoticePublicationRejectionContractNoticeContractNoticePublicationConfirmationContractNoticePublicationRejectionContractAwardNoticeConfirmContracAwardNoticePublicationConfirmationContractAwardNoticePublicationRejectionContractWonNotificationContractLostNotificationCatalogueRequestCatalogueRequestRejectionMultiPartyCatalogueCatalogueCatalogueAcceptanceCatalogueRejectionCatalogueItemUpdateCatalogueItemUpdateRejectionCatalogueItemUpdateAcceptanceCataloguePriceUpdateCataloguePriceUpdateRejectionCataloguePriceUpdateAcceptanceCatalogueDeleteRequestCatalogueDeleteConfirmationQuoteRequestQuoteRequestRejectionQuoteOrderOrderRejectionOrderAcceptanceCounterOfferCounterOfferRejectionCounterOfferAcceptanceInvoiceInvoiceDisputeCreditNoteCorrectiveInvoiceInvoiceAcceptanceNoticeInvoiceDisputeNoticeCustomsBillCustomsCreditNoteCustomsCorrectiveBill

Page 134: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ScannedInvoiceScannedCreditNoteRescanRequestDispatchAdviceReminderStatementStatementRejectionStatusRequestStatusResponseRetrieveRequestRetrieveResponseSubmitAttachedDocumentAcceptAttachedDocumentRejectAttachedDocument

Transaction data model used for each document instance is identified by using the customization element with a urn in the following format where the last part is an identifier for a possible extension.

Above are the identificators for the transaction data models against which the message instance should be validated. If extensions are

Page 135: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

Code

Page 136: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

CountrySubentityCodeCountry Subentity CodeISO 3166-2

PlaceholderPlaceholder

International Organization of Standardization5en

Value

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/CountrySubentityCode-2.0.gc

Page 137: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

CodeAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBOVBRLBSDBTNBWPBYRBZDCADCDFCHECHFCHWCLFCLPCNYCOPCOUCRCCUPCVECZKDJF

Page 138: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

DKKDOPDZDEEKEGPERNETBEURFJDFKPGBPGELGHSGIPGMDGNFGTQGWPGYDHKDHNLHRKHTGHUFIDRILSINRIQDIRRISKJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLTLLVLLYDMADMDLMGA

Page 139: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

MKDMMKMNTMOPMROMURMVRMWKMXNMXVMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSKKSLLSOSSRDSTDSVCSYPSZLTHBTJSTMMTNDTOPTRYTTD

Page 140: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

TWDTZSUAHUGXUSDUSNUSSUYIUYUUZSVEFVNDVUVWSTXAFXAGXAUXBAXBBXBCXBDXCDXDRXFUXOFXPDXPFXTSXXXYERZARZMKZWRZWD

Page 141: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

CurrencyCodeCurrency CodeISO 42172008-11-12PlaceholderPlaceholder

International Organization of Standardization5en

ValueUAE DirhamAfghaniLekArmenian DramNetherlands Antillian GuilderKwanzaArgentine PesoAustralian DollarAruban GuilderAzerbaijanian ManatConvertible MarksBarbados DollarTakaBulgarian LevBahraini DinarBurundi FrancBermudian Dollar (customarily known as Bermuda Dollar)Brunei DollarBolivianoMvdolBrazilian RealBahamian DollarNgultrumPulaBelarussian RubleBelize DollarCanadian DollarCongolese FrancWIR EuroSwiss FrancWIR FrancUnidades de fomentoChilean PesoYuan RenminbiColombian PesoUnidad de Valor RealCosta Rican ColonCuban PesoCape Verde EscudoCzech KorunaDjibouti Franc

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/cefact/CurrencyCode-2.0.gc

Page 142: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Danish KroneDominican PesoAlgerian DinarKroonEgyptian PoundNakfaEthiopian BirrEuroFiji DollarFalkland Islands PoundPound SterlingLariCediGibraltar PoundDalasiGuinea FrancQuetzalGuinea-Bissau PesoGuyana DollarHong Kong DollarLempiraCroatian KunaGourdeForintRupiahNew Israeli SheqelIndian RupeeIraqi DinarIranian RialIceland KronaJamaican DollarJordanian DinarYenKenyan ShillingSomRielComoro FrancNorth Korean WonWonKuwaiti DinarCayman Islands DollarTengeKipLebanese PoundSri Lanka RupeeLiberian DollarLotiLithuanian LitasLatvian LatsLibyan DinarMoroccan DirhamMoldovan LeuMalagasy Ariary

Page 143: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

DenarKyatTugrikPatacaOuguiyaMauritius RupeeRufiyaaKwachaMexican PesoMexican Unidad de Inversion (UDI)Malaysian RinggitMeticalNamibia DollarNairaCordoba OroNorwegian KroneNepalese RupeeNew Zealand DollarRial OmaniBalboaNuevo SolKinaPhilippine PesoPakistan RupeeZlotyGuaraniQatari RialNew LeuSerbian DinarRussian RubleRwanda FrancSaudi RiyalSolomon Islands DollarSeychelles RupeeSudanese PoundSwedish KronaSingapore DollarSaint Helena PoundSlovak KorunaLeoneSomali ShillingSurinam DollarDobraEl Salvador ColonSyrian PoundLilangeniBahtSomoniManatTunisian DinarPa'angaTurkish LiraTrinidad and Tobago Dollar

Page 144: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

New Taiwan DollarTanzanian ShillingHryvniaUganda ShillingUS DollarUS Dollar (Next day)US Dollar (Same day)Uruguay Peso en Unidades IndexadasPeso UruguayoUzbekistan SumBolivar FuerteDongVatuTalaCFA Franc BEACSilverGoldBond Markets Units European Composite Unit (EURCO)European Monetary Unit (E.M.U.-6)European Unit of Account 9(E.U.A.-9)European Unit of Account 17(E.U.A.-17)East Caribbean DollarSDRUIC-FrancCFA Franc BCEAOPalladiumCFP FrancReserved for testing purposesAssigned for transactions where no currency is involvedYemeni RialRandZambian KwachaZimbabwe DollarZimbabwe Dollar

Page 145: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

CodeEXWFCAFASFOBCFRCIFCPTCIPDAFDESDEQDDUDDP

Page 146: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

DeliveryTermsIDDelivery Terms IDINCOTERMS 20001PlaceholderPlaceholder

International Chamber of Commerce4en

ValueEX WORKS (named place)*FREE CARRIER (named place)FREE ALONGSIDE SHIP (named port of shipment)*FREE ON BOARD (named port of shipment)COST AND FREIGHT (named port of destination)COST, INSURANCE AND FREIGHT (named port of destination)*CARRIAGE PAID TO (named place of destination)CARRIAGE AND INSURANCE PAID TO (named place of destination)*DELIVERED AT FRONTIER (named place)*DELIVERED EX SHIP (named port of destination)DELIVERED EX QUAY (named port of destination)*DELIVERED DUTY UNPAID (named place of destination)*DELIVERED DUTY PAID (named place of destination)*

http://www.iccwbo.org/incoterms/id3040/index.html

Page 147: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortName DimensionAttributeIDLongName Dimension Attribute IDListID UN/ECE 6313Version D08BCanonicalUri PlaceholderCanonicalVersionUri PlaceholderLocationUriAgencyLongName United Nations Economic Commission for EuropeAgencyIdentifier 6Locale en

Code ValueA Consolidated weightAAA Unit net weightAAB Unit gross weightAAC Total net weightAAD Total gross weightAAE Item gross weightAAF Net net weightAAG Stern thrustAAH Bow thrustAAI Hydrate content of an alcoholic product at bottlingAAJ Number of units per palletAAK Fat contentAAL Net weightAAM Gross tonnage of the vesselAAN Net tonnage of the vesselAAO HumidityAAP VoltageAAQ Power consumptionAAR Heat dissipationAAS Air flowAAT Shock impactAAU Operative temperatureAAV Non operative temperatureAAW Gross volumeAAX Net volumeAAY Water contentAAZ Tensile stressABA FibrosityABB Gauge lengthABC RadiusABD StraightnessABE StrainABF Item width when unrolledABG Item length when unrolledABH Item area when unrolledABI Original wortABJ VolumeABK AngleABL Peg hole horizontal distance from package leftmost edge

Page 148: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ABM Peg hole vertical distance from package topABN Number of layers per palletABO Product strengh, chemicalABP Product strength basis, chemicalABS Item weightABT Payload weight, maximumABX Weight of conveyanceABY Conveyance summer dead weightABZ Containerized cargo on vessel's weightACA Non-containerized cargo on vessel's weightACE Weight ascertainedACG Chargeable weightACN Estimated gross weightACP Estimated volumeACS Vessel overall lengthACV Loading metersACW Number of axlesACX PayloadADR Start position in the lengthADS End position in the lengthADT Start position in the widthADU End position in the widthADV Start position in the thicknessADW End position in the thicknessADX Transport container actual filling weightADY Transport container maximum capacityADZ Declared net weightAEA Loading heightAEB Stacking heightAEC Calculated weightAED FerriteAEE ImpurityAEF Grain sizeAEG LanthanidesAEH ElasticityAEI Drained weightAEJ GalliumAEK StrontiumAEL AreaAEM Equipment storage limitationAEN Radioactive index of transportAEO RadioactivityAEP Average gross weightAEQ Forward draftAER After draftAES AcidityAET Transport equipment gross weightAEU Total transport equipment gross weightAEV Acidity of juiceAEW PenetrometryAEX DurofelAEY Juice weight per 100 grams

Page 149: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

AEZ Fruit skin colourAF Angle of bendAFA Fixed incremental measurementAFB Durofel D10AFC Durofel D25AFD Durofel D50AFE Maximum stacking weightAFF Gross measure cubeAFG Percentage fat content in dry matterAFH Saccharometric contentAFI Hydrate content of an alcoholic product after bottlingAFJ Anhydrous contentAFK Certified weightAFL FreeboardAFM Maximum vessel draughtAFN Net explosive weightAFO Radioactive criticality safety indexAFP Waste currently on boardAFQ Waste to be delivered at waste reception facilityAFR Waste to be generated until next port of call, estimatedAFS Waste remaining on board at departureAFT Colour depthAFU Colour depth, maximumAFV Image resolutionAFW Device resolution, maximumAFX Acoustic absorption coefficientB Billed weightBL Breaking loadBMY PlatinumBMZ SilverBNA ListBNB TrimBNC Free waterBND BandsBNE API (American Petroleum Institute) gravityBNF Petroleum gross observed volumeBNG Petroleum gross standard volumeBNH Volume varianceBNI Petroleum net standard volumeBNJ Material on-board quantity, after dischargeBNK Petroleum total calculated volumeBNL Petroleum total observed volumeBNM Innage gauge distanceBNN Petroleum net standard weightBNO Sediment and water in petroleumBNP Observed reference height, tankBNQ Reference height, tankBNR Ullage gauge distanceBNS Trim correctionBNT Bow to bridge distanceBNU Peg hole number

Page 150: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

BNV Number of inner packsBNW Number of next level trade items within inner packBNX Number of trade items per pallet layerBNY Packed items layer heightBNZ Packing material weight, skin tight coveringBR BrightnessBRA BrakesBRE BreakBS Breaking strengthBSW Breaking strength wetBW Basis weightCHN ChangeCM ColourCT Contents of packageCV Commercial weightCZ Core lengthD Destination weight agreementDI DiameterDL Delta value LDN DensityDP DepthDR DenierDS Distance between pointsDW Width, boxcar doorE Estimated new weightEA ElongationF Deficit weightFI Filament countFL Longitudinal flatnessFN FlatnessFV Transverse flatnessG Gross weightGG GaugeGW Gross weight, maximumHF HardnessHM Height, maximumHT Height dimensionIB Impact energyID Inside diameterL Legal weightLM Length, maximumLN Length dimensionLND Lost endM Minimum weightMO MoistureMW Maximum weightN Actual net weightOD Outside diameterPRS Pre stretchPTN Per tonneRA Relative humidityRF Resistivity

Page 151: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

RJ Rockwell CRMW Ream weightRP Reduction of areaRUN Run (process)RY RatioSQ Shipped quantityT Tare weightTC TemperatureTH ThicknessTN Time periodTT TimeU Weight per unitVH Height, van doorVW Width, van doorWA Weight per unit of areaWD Width dimensionWM Width, maximumWT WeightWU Weight per unit of lengthXH Side height, flat bed with removable sidesXQ SquarenessXZ Spool sizeYS Yield stressZAL AluminiumZAS ArsenicZB BoronZBI BismuthZC CarbonZCA CalciumZCB ColumbiumZCE CeriumZCL ChlorineZCO CobaltZCR ChromiumZCU CopperZFE IronZFS Iron plus siliconZGE GermaniumZH HydrogenZK PotassiumZMG MagnesiumZMN ManganeseZMO MolybdenumZN NitrogenZNA SodiumZNB NiobiumZNI NickelZO OxygenZP PhosphorusZPB LeadZS SulphurZSB AntimonyZSE Selenium

Page 152: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ZSI SiliconZSL Silicium oxydZSN TinZTA TantaliumZTE TelluriumZTI TitaniumZV VanadiumZW TungstenZWA Waste contentZZN ZincZZR Zirconium

Page 153: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

CodeBilling1Billing2Billing3Condition1Condition2Condition3Condition4Condition5Condition6Delivery1Delivery2Delivery3Quality1Quality2

Page 154: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

DiscrepancyResponseCodeDiscrepancy Response CodeCWA ???1PlaceholderPlaceholder

CEN/ISSS WS/BII

en

ValueDuplicate billingWrong amount billedRebate / Financial compensationIn a condition other than described on the supporting documentationExpired shelf life ItemDamaged ItemIncomplete Item receivedIncorrect ItemUnacceptable substitute ItemOver-deliveryUnder-deliveryReturn of goodsItem quality deficiencyItem quality defect

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/DiscrepancyResponseCode-2.0.gc

Page 155: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

Code2122

25123

220231301380916

81311312310

9230320406120149

Page 156: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

DocumentTypeCodeDocument Type CodeUN/ECE 1001 SubsetD08BPlaceholderPlaceholder

United Nations Economic Commission for Europe6en

ValueQueryResponse to queryInquiryStatus informationOrderPurchase order responseResponse to registrationCommercial invoiceRelated documentCredit note related to goods or services Request for quoteAcknowledgement messageOffer / quotationPrice/sales cataloguePurchase order change requestAcknowledgement of orderNotification to supplier of contract terminationStores requisitionBasic agreement

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/DocumentTypeCode-2.0.gc

Page 157: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Default ValueQueryResponse to queryInquiryStatus informationOrderOrder ResponseResponse to registrationCommercial invoiceRelated documentCredit note related to goods or services RequestAcknowledgementFormal OfferCatalogue

C13
rodriguf: Retrieve Request
C14
rodriguf: Retrieve Response
C15
rodriguf: Status Request
Page 158: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Long DescriptionRequest information based on defined criteria.Document/message returned as an answer to a question.This is a request for information.Information regarding the status of a related message.Document/message by means of which a buyer initiates a transaction with a seller involving the supply of goods or services as specified, according to conditions set out in an offer, or otherwise known to the buyer.Response to an purchase order already received.Code specifying a response to an occurrence of a registration message.(1334) Document/message claiming payment for goods or services supplied under conditions agreed between seller and buyer.Document that has a relationship with the stated document/message.Document message used to provide credit information related to a transaction for goods or services to the relevant party.Document/message requesting a quote on specified goods or servicesMessage providing acknowledgement information at the business application level concerning the processing of a messageDocument/message which, with a view to concluding a contract, sets out the conditions under which the goods are offeredA document/message to enable the transmission of information regarding pricing and catalogue details for goods and services offered by a seller to a buyer.

Page 159: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

Codeerror.accepted_indicator_check_ackerror.accepted_indicator_check_falseerror.accepted_indicator_check_trueerror.additional_document_reference_checkerror.address_check_citynameerror.address_check_countryerror.address_check_postalzoneerror.address_check_streetnameerror.allowance_charge_checkerror.allowancecharge_check_baseamounterror.allowancecharge_check_multiplierfactornumericerror.allowancecharge_check_sequencenumericerror.allowancecharge_check_vaterror.allowancetotalamount_checkerror.attachment_checkerror.attachment_content_checkerror.chargetotalamount_checkerror.commodityclassification_checkerror.contract_checkerror.contract_document_reference_checkerror.contract_id_checkerror.contract_reference_id_checkerror.contractdocumentreference_checkerror.copyindicator_checkerror.creditnotelinelineextensionamount_checkerror.currency_id_creditnotelinelineextensionamounterror.currency_id_invoicelinelineextensionamounterror.currency_id_legalmonetarytotallineextensionamounterror.currency_id_orderlinelineextensionamounterror.currency_id_payableamounterror.currency_id_priceamounterror.currency_id_taxamounterror.delivery_checkerror.delivery_date_checkerror.delivery_or_invoice_date_checkerror.document_receiverparty_id_checkerror.document_receiverparty_occurence_checkerror.document_reference_checkerror.document_senderparty_id_checkerror.document_senderparty_occurence_checkerror.id_check

Page 160: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

error.id_invalid_charerror.id_length_checkerror.invalid_codetable_value_accounttypecodeerror.invalid_codetable_value_actioncodeerror.invalid_codetable_value_addressformatcodeerror.invalid_codetable_value_allowancechargereasoncodeerror.invalid_codetable_value_binaryobjectmimecodeerror.invalid_codetable_value_cataloguelifecyclestatuscodeerror.invalid_codetable_value_commoditycodeerror.invalid_codetable_value_countryidentificationcodeerror.invalid_codetable_value_currencycodeerror.invalid_codetable_value_deliverytermsiderror.invalid_codetable_value_dimensionattributeiderror.invalid_codetable_value_discrepancyresponsecodeerror.invalid_codetable_value_documenttypecodeerror.invalid_codetable_value_invoicetypecodeerror.invalid_codetable_value_itemrelationshiptypecodeerror.invalid_codetable_value_languagecodeerror.invalid_codetable_value_lifecyclestatuscodeerror.invalid_codetable_value_linestatuscodeerror.invalid_codetable_value_operatorcodeerror.invalid_codetable_value_parentdocumenttypecodeerror.invalid_codetable_value_paymentchannelcodeerror.invalid_codetable_value_paymentmeanscodeerror.invalid_codetable_value_taxcategoryiderror.invalid_codetable_value_taxexemptionreasoncodeerror.invalid_codetable_value_taxschemeiderror.invalid_codetable_value_taxtypecodeerror.invalid_codetable_value_unitofmeasurecodeerror.invalid_date_rangeerror.invoicedocumentreference_checkerror.invoicelinelineextensionamount_checkerror.item_check_classifiedtaxcategoryerror.item_check_name_or_descriptionerror.item_check_sellersitemidentificationerror.item_check_sellersitemidentification_catalogueerror.itemclassificationcodecriterion_checkerror.large_date_rangeerror.lineextensionamount_checkerror.lineitem_check_totaltaxamounterror.lineitemid_checkerror.lineitemlineextensionamount_checkerror.linevalidityperiod_checkerror.order_document_reference_checkerror.order_reference_checkerror.orderableunitfactorrate_checkerror.orderdocumentreference_checkerror.originalitemlocationquantity_check_maximumquantityerror.originalitemlocationquantity_check_minimumquantityerror.originator_document_reference_checkerror.parent_document_id_length_checkerror.party_check_partytaxschemeerror.party_check_postaladdress

Page 161: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

error.party_tax_scheme_check_companyiderror.payableamount_checkerror.period_check_enddateerror.period_check_startdateerror.prepaidamount_checkerror.priceamount_checkerror.quantity_negativity_checkerror.quantity_range_checkerror.referencedcontract_check_iderror.referencedcontract_check_number_errorerror.referencedcontract_check_number_warningerror.relateditemcriterion_checkerror.salesorderid_checkerror.search_parameter_checkerror.sellersitemidentificationid_checkerror.sellersitemidentificationid_invalid_charerror.sellersitemidentificationid_length_checkerror.signature_checkerror.standarditemidentification_check_schemeiderror.tax_category_check_id_percenterror.tax_category_check_percentperunitamounterror.taxexchangerate_checkerror.taxexclusiveamount_checkerror.taxexclusiveamount_presence_checkerror.taxinclusiveamount_checkerror.taxinclusiveamount_negative_checkerror.taxinclusiveamount_presence_checkerror.taxschemeid_checkerror.taxtotal_check_numbererror.taxtotal_check_taxsubtotalerror.taxtotals_checkerror.total_amount_checkerror.totaltaxamount_checkerror.validity_period_checkerror.vattotalamount_checkerror.versionid_checkerror.versionid_invalid_charerror.versionid_length_check

Page 162: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ErrorCodeError Code

0.1PlaceholderPlaceholder

European Commision

en

ValueThere AcceptedIndicator must be true in an Order AcknowledgementThere must be a RejectionNote element when AcceptedIndicator equals falseRejectionNote element should be excluded when AcceptedIndicator equals trueElement AdditionalDocumentReference should include one of following child elements: DocumentType or DocumentTypeCodeElement PostalAddress misses child element CityNameElement PostalAddress misses child element CountryElement PostalAddress misses child element PostalZoneElement PostalAddress should contain either child element StreetNameThe amount of an AllowanceCharge should not be negativeBaseAmount should be present when MultiplierFactorNumeric is used in an AllowanceChargeThe MultiplierFactorNumeric in an AllowanceCharge should not be negativeThe SequenceNumeric in an AllowanceCharge should not be negativeIf the VAT total amount in a document exists then an Allowances Charges amount on document level should have Tax category for VATThe Allowance Total Amount must be equal to the total of all allowances at document levelElement Attachment should not be present in this documentElement Attachment is mandatory, but should not have any content in this documentThe Charge Total Amount must be equal to the total of all charges at document levelBoth ItemClassificationCode and ItemClassificationCode/@listID must be present and not empty in CommodityClassificationExactly one Contract class should be presentElement ContractDocumentReference should include one of following child elements: DocumentType or DocumentTypeCodeThe ID of the contract should not be emptyThe ID of the contract should not be emptyContractDocumentReference should be present and not emptyElement CopyIndicator is not allowed in this documentThe total line amount plus charges minus discounts exclusive of taxes must be equal to the LineExtensionAmount at line levelCurrencyID in CreditNoteLine/LineExtensionAmount differs from DocumentCurrencyCodeCurrencyID in InvoiceLine/LineExtensionAmount differs from DocumentCurrencyCodeCurrencyID in LegalMonetaryTotal/LineExtensionAmount differs from DocumentCurrencyCodeCurrencyID in OrderLine/LineItem/LineExtensionAmount differs from DocumentCurrencyCodeCurrencyID in LegalMonetaryTotal/PayableAmount differs from DocumentCurrencyCodeCurrencyID in PriceAmount differs from PricingCurrencyCodeCurrencyID in TaxAmount differs from TaxCurrencyCodeNo more than one Delivery class should be presentElement Delivery should not contain child element ActualDeliveryDate in this documentNo Invoice period or delivery date is presentThe EndpointID withing the element DocumentReceiverParty must be present and not emptyThe Query Request must have less than 1000 occurrences of the element DocumentReceiverPartyElement DocumentReference should include one of following child elements: DocumentType or DocumentTypeCodeThe EndpointID withing the element DocumentSenderParty must be present and not emptyThe Query Request must have less than 1000 occurrences of the element DocumentSenderPartyThe ID of the message cannot be empty

Page 163: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

The ID of the message contains an invalid characterThe ID of the message cannot be larger than 250 charactersValue supplied is unacceptable for an element controlled by codelist AccountTypeCodeValue supplied is unacceptable for an element controlled by codelist ActionCodeValue supplied is unacceptable for an element controlled by codelist AddressFormatCodeValue supplied is unacceptable for an element controlled by codelist AllowanceChargeReasonCodeValue supplied is unacceptable for an element controlled by codelist BinaryObjectMimeCodeValue supplied is unacceptable for an element controlled by codelist CatalogueLifeCycleStatusCodeValue supplied is unacceptable for an element controlled by codelist CommodityCodeValue supplied is unacceptable for an element controlled by codelist CountryIdentificationCodeValue supplied is unacceptable for an element controlled by codelist CurrencyCodeValue supplied is unacceptable for an element controlled by codelist DeliveryTermsIDValue supplied is unacceptable for an element controlled by codelist DimensionAttributeIDValue supplied is unacceptable for an element controlled by codelist DiscrepancyResponseCodeValue supplied is unacceptable for an element controlled by codelist DocumentTypeCodeValue supplied is unacceptable for an element controlled by codelist InvoiceTypeCodeValue supplied is unacceptable for an element controlled by codelist ItemRelationshipTypeCodeValue supplied is unacceptable for an element controlled by codelist LanguageCodeValue supplied is unacceptable for an element controlled by codelist LifeCycleStatusCodeValue supplied is unacceptable for an element controlled by codelist LineStatusCodeValue supplied is unacceptable for an element controlled by codelist OperatorCodeValue supplied is unacceptable for an element controlled by codelist ParentDocumentTypeCodeValue supplied is unacceptable for an element controlled by codelist PaymentChannelCodeValue supplied is unacceptable for an element controlled by codelist PaymentMeansCodeValue supplied is unacceptable for an element controlled by codelist TaxCategoryIDValue supplied is unacceptable for an element controlled by codelist TaxExemptionReasonCodeValue supplied is unacceptable for an element controlled by codelist TaxSchemeIDValue supplied is unacceptable for an element controlled by codelist TaxTypeCodeValue supplied is unacceptable for an element controlled by codelist UnitOfMeasureCodePeriod startdate is later than enddateInvoice document reference missingThe total line amount plus charges minus discounts exclusive of taxes must be equal to the LineExtensionAmount at line levelElement Item misses child element ClassifiedTaxCategoryAn item should contain a Name or a Description which is not emptySellersItemIdentification should be present for an ItemSellersItemIdentification must be present for an Item in the Catalogue documentWhen ItemClassificationCodeCriterion is provided then the attribute listID must be present and not emptyThe difference between startdate and enddate is larger than one yearThe LineExtensionAmount at document level must be equal to the sum of all LineExtensionAmounts at line levelElement LineItem misses child element TotalTaxAmountLineItem ID should not be emptyThe total line amount plus charges minus discounts exclusive of taxes must be equal to the LineExtensionAmount at line levelThe LineValidityPeriod should fall within the range of the ValidityPeriod defined at document levelElement OrderDocumentReference should include one of following child elements: DocumentType or DocumentTypeCodeNo more than one OrderReference class should be presentThe OrderableUnitFactorRate should be larger than 0OrderReference should be present and not emptyThe amount of a MaximumQuantity should not be negativeThe amount of a MinimumQuantity should not be negativeElement OriginatorDocumentReference should include one of following child elements: DocumentType or DocumentTypeCodeThe ParentDocumentID cannot be larger than 250 charactersElement Party misses child element PartyTaxSchemeElement Party misses child element PostalAddress

Page 164: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Element PartyTaxScheme misses child element CompanyIDThe Payable Amount must be equal to the tax inclusive amount minus the pre-paid amountElement Period misses child element EndDateElement Period misses child element StartDateThe Prepaid Amount must be equal to the total of all Prepaid Payments at document levelElement PriceAmount should not contain a negative valueA Quantity should not be negativeThe MaximumQuantity should be greater or equal to the MinimumQuantity within the same parent elementReferencedContract ID should be present and not emptyA ReferencedContract class must be presentNot more than one ReferencedContract class should be presentThe attribute ItemRelationshipType is mandatory in the element RelatedItemCriterionSalesOrderID should be present and not emptyAt least one optional search parameter must be presentThe SellersItemIdentification ID of the message cannot be emptyThe SellersItemIdentification ID of the message contains an invalid characterThe SellersItemIdentification ID of the message cannot be larger than 250 charactersElement Signature is not allowed in this documentAttribute schemeID should be provided for a StandardItemIdentification/ID elementFor each tax subcategory except in Reverse Charge VAT the category ID and the applicable tax percentage should be providedElement (Classified)TaxCategory should include one of following child elements: Percent or PerUnitAmountDocumentCurrencyCode differs from TaxCurrencyCode, but there is no TaxExchangeRate definedThe Tax Exclusive Amount must be equal to the total line amount plus charges minus discounts exclusive of taxesThe document should specify the total amount without taxesThe Tax Inclusive Amount must be equal to Tax Exclusive Amount plus sum of the total tax amountsThe Tax inclusive amount should not be negativeThe document should specify the total amount with taxes includedWithin one TaxTotal the TaxScheme ID of all TaxSubtotals must be the sameMaximum 1 Tax Total should be present at document levelElement TaxTotal misses child element TaxSubtotalThe Tax Total must be equal to the sum of its Tax SubtotalsThe total amount of the invoice cannot be negativeTotalTaxAmount should not be negativeNo more than one ValidityPeriod class should be presentIf the VAT total amount exists in the document then the sum of taxable amount in sub categories should equal the sum of document tax exclusive amountThe VersionID of the message must be present and cannot be emptyThe VersionID of the message contains an invalid characterThe VersionID of the message cannot be larger than 5 characters

Page 165: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

If the VAT total amount in a document exists then an Allowances Charges amount on document level should have Tax category for VAT

Page 166: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

If the VAT total amount exists in the document then the sum of taxable amount in sub categories should equal the sum of document tax exclusive amount

Page 167: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortName FullTransactionCustomisationIDLongName Full Transaction Customisation IDListID CWA ???Version 1CanonicalUri PlaceholderCanonicalVersionUri PlaceholderLocationUriAgencyLongName CEN/ISSS WS/BIIAgencyIdentifierLocale en

Code Valueurn:www.cenbii.eu:transaction:biifulltrdm034:ver1.0 PriorInformationNoticeurn:www.cenbii.eu:transaction:biifulltrdm035:ver1.0 PriorInformationNoticePublicationConfirmationurn:www.cenbii.eu:transaction:biifulltrdm036:ver1.0 PriorInfomationNoticePublicationRejectionurn:www.cenbii.eu:transaction:biifulltrdm037:ver1.0 ContractNoticeurn:www.cenbii.eu:transaction:biifulltrdm038:ver1.0 ContractNoticePublicationConfirmationurn:www.cenbii.eu:transaction:biifulltrdm039:ver1.0 ContractNoticePublicationRejectionurn:www.cenbii.eu:transaction:biifulltrdm040:ver1.0 CallForTenderurn:www.cenbii.eu:transaction:biifulltrdm041:ver1.0 Qualificationurn:www.cenbii.eu:transaction:biifulltrdm042:ver1.0 QualificationRejectionurn:www.cenbii.eu:transaction:biifulltrdm043:ver1.0 QualificationAcceptanceurn:www.cenbii.eu:transaction:biifulltrdm044:ver1.0 Tenderurn:www.cenbii.eu:transaction:biifulltrdm045:ver1.0 TenderReceptionNotificationurn:www.cenbii.eu:transaction:biifulltrdm046:ver1.0 ContractAwardNoticeurn:www.cenbii.eu:transaction:biifulltrdm047:ver1.0 ConfirmContracAwardNoticePublicationConfirmationurn:www.cenbii.eu:transaction:biifulltrdm048:ver1.0 ContractAwardNoticePublicationRejectionurn:www.cenbii.eu:transaction:biifulltrdm049:ver1.0 ContractWonNotificationurn:www.cenbii.eu:transaction:biifulltrdm050:ver1.0 ContractLostNotificationurn:www.cenbii.eu:transaction:biifulltrdm018:ver1.0 CatalogueRequesturn:www.cenbii.eu:transaction:biifulltrdm055:ver1.0 CatalogueRequestRejectionurn:www.cenbii.eu:transaction:biifulltrdm054:ver1.0 MultiPartyCatalogueurn:www.cenbii.eu:transaction:biifulltrdm019:ver1.0 Catalogueurn:www.cenbii.eu:transaction:biifulltrdm057:ver1.0 CatalogueAcceptanceurn:www.cenbii.eu:transaction:biifulltrdm058:ver1.0 CatalogueRejectionurn:www.cenbii.eu:transaction:biifulltrdm020:ver1.0 CatalogueItemUpdateurn:www.cenbii.eu:transaction:biifulltrdm059:ver1.0 CatalogueItemUpdateRejectionurn:www.cenbii.eu:transaction:biifulltrdm060:ver1.0 CatalogueItemUpdateAcceptanceurn:www.cenbii.eu:transaction:biifulltrdm021:ver1.0 CataloguePriceUpdateurn:www.cenbii.eu:transaction:biifulltrdm061:ver1.0 CataloguePriceUpdateRejectionurn:www.cenbii.eu:transaction:biifulltrdm062:ver1.0 CataloguePriceUpdateAcceptanceurn:www.cenbii.eu:transaction:biifulltrdm022:ver1.0 CatalogueDeleteRequesturn:www.cenbii.eu:transaction:biifulltrdm023:ver1.0 CatalogueDeleteConfirmationurn:www.cenbii.eu:transaction:biifulltrdm024:ver1.0 QuoteRequesturn:www.cenbii.eu:transaction:biifulltrdm025:ver1.0 QuoteRequestRejectionurn:www.cenbii.eu:transaction:biifulltrdm056:ver1.0 Quoteurn:www.cenbii.eu:transaction:biifulltrdm001:ver1.0 Orderurn:www.cenbii.eu:transaction:biifulltrdm002:ver1.0 OrderRejectionurn:www.cenbii.eu:transaction:biifulltrdm003:ver1.0 OrderAcceptanceurn:www.cenbii.eu:transaction:biifulltrdm004:ver1.0 CounterOfferurn:www.cenbii.eu:transaction:biifulltrdm005:ver1.0 CounterOfferRejectionurn:www.cenbii.eu:transaction:biifulltrdm006:ver1.0 CounterOfferAcceptanceurn:www.cenbii.eu:transaction:biifulltrdm010:ver1.0 Invoiceurn:www.cenbii.eu:transaction:biifulltrdm013:ver1.0 InvoiceDisputeurn:www.cenbii.eu:transaction:biifulltrdm014:ver1.0 CreditNote

Page 168: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

urn:www.cenbii.eu:transaction:biifulltrdm015:ver1.0 CorrectiveInvoiceurn:www.cenbii.eu:transaction:biifulltrdm011:ver1.0 InvoiceAcceptanceNoticeurn:www.cenbii.eu:transaction:biifulltrdm012:ver1.0 InvoiceDisputeNoticeurn:www.cenbii.eu:transaction:biifulltrdm007:ver1.0 CustomsBillurn:www.cenbii.eu:transaction:biifulltrdm008:ver1.0 CustomsCreditNoteurn:www.cenbii.eu:transaction:biifulltrdm009:ver1.0 CustomsCorrectiveBillurn:www.cenbii.eu:transaction:biifulltrdm052:ver1.0 ScannedInvoiceurn:www.cenbii.eu:transaction:biifulltrdm053:ver1.0 ScannedCreditNoteurn:www.cenbii.eu:transaction:biifulltrdm063:ver1.0 RescanRequesturn:www.cenbii.eu:transaction:biifulltrdm016:ver1.0 DispatchAdviceurn:www.cenbii.eu:transaction:biifulltrdm017:ver1.0 Reminderurn:www.cenbii.eu:transaction:biifulltrdm026:ver1.0 Statementurn:www.cenbii.eu:transaction:biifulltrdm051:ver1.0 StatementRejectionurn:www.cenbii.eu:transaction:biifulltrdm027:ver1.0 StatusRequesturn:www.cenbii.eu:transaction:biifulltrdm029:ver1.0 StatusResponseurn:www.cenbii.eu:transaction:biifulltrdm031:ver1.0 RetrieveRequesturn:www.cenbii.eu:transaction:biifulltrdm028:ver1.0 RetrieveResponseurn:www.cenbii.eu:transaction:biifulltrdm033:ver1.0 SubmitAttachedDocumenturn:www.cenbii.eu:transaction:biifulltrdm030:ver1.0 AcceptAttachedDocumenturn:www.cenbii.eu:transaction:biifulltrdm032:ver1.0 RejectAttachedDocument

urn:www.cenbii.eu:transaction:BiiCoreTrdm010:ver1.0:extensionId

following format where the last part is an identifier for a possible extension.

extensions are used their identifier should be added at the end of which.

Page 169: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price
Page 170: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

Code380393290386

Page 171: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

InvoiceTypeCodeInvoice Type CodeUN/ECE 1001 SubsetD08BPlaceholderPlaceholder

United Nations Economic Commission for Europe6en

ValueCommercial invoiceFactored invoiceA claim for parts and/or labour changesPrepayment invoice

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/InvoiceTypeCode-2.0.gc

Page 172: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

Code

Page 173: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ItemClassificationCodeItem Classification CodeUNSPSC7.0401PlaceholderPlaceholderhttp://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/ItemClassificationCode-2.0.gcGS1 US113en

Value

Page 174: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortName Language name code LongName Language name code ListID ISO 639-1Version 1998CanonicalUri PlaceholderCanonicalVersionUri PlaceholderLocationUri http://www.loc.gov/standards/iso639-2/AgencyLongName International Organization of StandardizationAgencyIdentifier 5Locale en

Code Valueaa Afar ab Abkhazian af Afrikaans ak Akan sq Albanian am Amharic ar Arabic an Aragonese hy Armenian as Assamese av Avaric ae Avestan ay Aymara az Azerbaijani ba Bashkir bm Bambara eu Basque be Belarusian bn Bengali bh Bihari languages bi Bislama bo Tibetan bs Bosnian br Breton bg Bulgarian my Burmese ca Catalan; Valencian cs Czech ch Chamorro ce Chechen zh Chinese cu Church Slavic; Old Slavonic; Church Slavonic; Old Bulgarian; Old Church Slavonic cv Chuvash kw Cornish co Corsican cr Cree cy Welsh cs Czech da Danish

Page 175: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

de German dv Divehi; Dhivehi; Maldivian nl Dutch; Flemish dz Dzongkha el Greek, Modern (1453-) en English eo Esperanto et Estonian eu Basque ee Ewe fo Faroese fa Persian fj Fijian fi Finnish fr French fr French fy Western Frisian ff Fulah ka Georgian de German gd Gaelic; Scottish Gaelic ga Irish gl Galician gv Manx el Greek, Modern (1453-) gn Guarani gu Gujarati ht Haitian; Haitian Creole ha Hausa he Hebrew hz Herero hi Hindi ho Hiri Motu hr Croatian hu Hungarian hy Armenian ig Igbo is Icelandic io Ido ii Sichuan Yi; Nuosu iu Inuktitut ie Interlingue; Occidental ia Interlingua (International Auxiliary Language Association) id Indonesian ik Inupiaq is Icelandic it Italian jv Javanese ja Japanese kl Kalaallisut; Greenlandic kn Kannada ks Kashmiri ka Georgian

Page 176: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

kr Kanuri kk Kazakh km Central Khmer ki Kikuyu; Gikuyu rw Kinyarwanda ky Kirghiz; Kyrgyz kv Komi kg Kongo ko Korean kj Kuanyama; Kwanyama ku Kurdish lo Lao la Latin lv Latvian li Limburgan; Limburger; Limburgish ln Lingala lt Lithuanian lb Luxembourgish; Letzeburgesch lu Luba-Katanga lg Ganda mk Macedonian mh Marshallese ml Malayalam mi Maori mr Marathi ms Malay mk Macedonian mg Malagasy mt Maltese mn Mongolian mi Maori ms Malay my Burmese na Nauru nv Navajo; Navaho nr Ndebele, South; South Ndebele nd Ndebele, North; North Ndebele ng Ndonga ne Nepali nl Dutch; Flemish nn Norwegian Nynorsk; Nynorsk, Norwegian nb Bokmål, Norwegian; Norwegian Bokmål no Norwegian ny Chichewa; Chewa; Nyanja oc Occitan (post 1500) oj Ojibwa or Oriya om Oromo os Ossetian; Ossetic pa Panjabi; Punjabi fa Persian pi Pali pl Polish

Page 177: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

pt Portuguese ps Pushto; Pashto qu Quechua rm Romansh ro Romanian; Moldavian; Moldovan rn Rundi ru Russian sg Sango sa Sanskrit si Sinhala; Sinhalese sk Slovak sl Slovenian se Northern Sami sm Samoan sn Shona sd Sindhi so Somali st Sotho, Southern es Spanish; Castilian sq Albanian sc Sardinian sr Serbian ss Swati su Sundanese sw Swahili sv Swedish ty Tahitian ta Tamil tt Tatar te Telugu tg Tajik tl Tagalog th Thai bo Tibetan ti Tigrinya to Tonga (Tonga Islands) tn Tswana ts Tsonga tk Turkmen tr Turkish tw Twi ug Uighur; Uyghur uk Ukrainian ur Urdu uz Uzbek ve Venda vi Vietnamese vo Volapük cy Welsh wa Walloon wo Wolof xh Xhosa yi Yiddish

Page 178: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

yo Yoruba za Zhuang; Chuang zh Chinese zu Zulu

Page 179: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Church Slavic; Old Slavonic; Church Slavonic; Old Bulgarian; Old Church Slavonic

Page 180: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

CodeAvailable

DeletedAnnouncementItemDeletedNewAnnouncementNewAvailableItemTemporarilyUnavail

Page 181: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

LifeCycleStatusCodeLife Cycle Status CodeCWA ???1PlaceholderPlaceholder

CEN/ISSS WS/BII

en

ValueAn Item that is available for purchase

An Item that is no longer available for purchaseA new Item not yet available for purchaseA new Item that is available for purchaseAn Item that is temporarily unavailable

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/LifeCycleStatusCode-2.0.gc

Announcement that an Item will be deleted – may still be available for purchase e.g. until stock runs out.

Page 182: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

CodeBusinessAcceptBusinessReject

Page 183: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

LineResponseCodeLine Response CodeCWA ???1PlaceholderPlaceholder

CEN/ISSS WS/BII

en

ValueLine accepted on a business levelLine rejected on a business level

Page 184: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

CodeAddedCancelledDisputedNoStatusRevised

Page 185: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

LineStatusCodeLine Status CodeCWA ???1PlaceholderPlaceholderhttp://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/LineStatusCode-2.0.gcCEN/ISSS WS/BII

en

ValueLine has been addedLine has been cancelledLine is disputedLine has no statusLine has been revised

Page 186: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortName LocationIDLongName Location IDListID UN/ECE rec 16Version 2006.1CanonicalUri PlaceholderCanonicalVersionUri PlaceholderLocationUriAgencyLongName United Nations Economic Commission for EuropeAgencyIdentifier 6Locale en

Code Value

Page 187: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

Code220380

81311310

9320

Page 188: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ParentDocumentTypeCodeParent Document Type CodeUN/ECE 1001 SubsetD08BPlaceholderPlaceholder

United Nations Economic Commission for Europe6en

ValueOrderCommercial invoiceCredit note related to goods or services Request for quoteOffer / quotationPrice/sales catalogueAcknowledgement of order

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/ParentDocumentTypeCode-2.0.gc

Page 189: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortName PartyIdentificationSchemeIDLongName Party Identification SchemeIDListIDVersion 0.1CanonicalUri PlaceholderCanonicalVersionUri PlaceholderLocationUriAgencyLongNameAgencyIdentifier European CommisionLocale en

Code ValueAT:VAT Austrian VAT numberBE:VAT Belgian VAT numberBG:VAT Bulgarian VAT numberCH:VAT Swiss VAT numberCY:VAT Cypriot VAT numberCZ:VAT Czech VAT numberDE:VAT German VAT numberDK:VAT Danish VAT numberEE:VAT Estonian VAT numberEL:VAT Greek VAT numberES:VAT Spanish VAT numberFI:VAT Finnish VAT numberFR:VAT French VAT numberGB:VAT British VAT numberGLN Global Location NumberHU:VAT Hungarian VAT numberIE:VAT Irish VAT numberIT:VAT Italian VAT numberLT:VAT Lithuanian VAT numberLU:VAT Luxembourg VAT numberLV:VAT Latvian VAT numberMT:VAT Maltese VAT numberNL:VAT Dutch VAT numberNO:VAT Norwegian VAT numberPL:VAT Polish VAT numberPT:VAT Portuguese VAT numberRO:VAT Romanian VAT numberSE:VAT Swedish VAT numberSI:VAT Slovenian VAT numberSK:VAT Slovak VAT number

Page 190: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

CodeBBANIBANSWIFTUS

Page 191: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

PaymentChannelCodePayment Channel CodeCWA ???1PlaceholderPlaceholder

CEN/ISSS WS/BII

en

ValueBank account identified by domestic meansInternational Bank Account NumberSWIFT payment to the US

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/PaymentChannelCode.gc

Page 192: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

Code1234567891011121314151617181920212223242526272829303132333435363738394041

Page 193: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

424344454647484950515253606162636465666770747576777891929394959697

Page 194: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

PaymentMeansCodePayment Means CodeUN/ECE 4461D08BPlaceholderPlaceholder

United Nations Economic Commission for Europe6en

ValueInstrument not definedAutomated clearing house creditAutomated clearing house debitACH demand debit reversalACH demand credit reversalACH demand creditACH demand debitHoldNational or regional clearingIn cashACH savings credit reversalACH savings debit reversalACH savings creditACH savings debitBookentry creditBookentry debitACH demand cash concentration/disbursement (CCD) creditACH demand cash concentration/disbursement (CCD) debitACH demand corporate trade payment (CTP) creditChequeBanker's draftCertified banker's draftBank cheque (issued by a banking or similar establishment)Bill of exchange awaiting acceptanceCertified chequeLocal chequeACH demand corporate trade payment (CTP) debitACH demand corporate trade exchange (CTX) creditACH demand corporate trade exchange (CTX) debitCredit transferDebit transferACH demand cash concentration/disbursement plus (CCD+) creditACH demand cash concentration/disbursement plus (CCD+) debitACH prearranged payment and deposit (PPD)ACH savings cash concentration/disbursement (CCD) creditACH savings cash concentration/disbursement (CCD) debitACH savings corporate trade payment (CTP) creditACH savings corporate trade payment (CTP) debitACH savings corporate trade exchange (CTX) creditACH savings corporate trade exchange (CTX) debitACH savings cash concentration/disbursement plus (CCD+) credit

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/PaymentMeansCode-2.0.gc

Page 195: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Payment to bank accountACH savings cash concentration/disbursement plus (CCD+) debitAccepted bill of exchangeReferenced home-banking credit transferInterbank debit transferHome-banking debit transferBank cardDirect debitPayment by postgiroFR, norme 6 97-Telereglement CFONB (French Organisation for Banking Standards) - Option AUrgent commercial paymentUrgent Treasury PaymentPromissory notePromissory note signed by the debtorPromissory note signed by the debtor and endorsed by a bankPromissory note signed by the debtor and endorsed by a third partyPromissory note signed by a bankPromissory note signed by a bank and endorsed by another bankPromissory note signed by a third partyPromissory note signed by a third party and endorsed by a bankBill drawn by the creditor on the debtorBill drawn by the creditor on a bankBill drawn by the creditor, endorsed by another bankBill drawn by the creditor on a bank and endorsed by a third partyBill drawn by the creditor on a third partyBill drawn by creditor on third party, accepted and endorsed by bankNot transferable banker's draftNot transferable local chequeReference giroUrgent giroFree format giroRequested method for payment was not usedClearing between partners

Page 196: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

CodeAAAAABAACAADAAEAAFAAGAAHAAIAAJAAKAALAAMAANAAOAAPAAQAARAASAATAAUAAVAAWAAXAAYAAZABAABBABCABDABEABFABGABHABIABJABKABLABM

Page 197: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ABNABOABPABQABRABSABTABUABVABWABXABYABZAIALTAPBRCATCDVCONCPCUCUPCUSDAPDISDPRDRDSCECESEUPFCRGRPINVLBLMAXMINMNRMSRMXRNENQTNTPNWOFRPAQPBQPPDPPRPROPRP

Page 198: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

PWQTERESRTPSHDSRPSWTBTRFTUTWWH

Page 199: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

PriceTypeCodePrice Type CodeUN/ECE 5387D08BPlaceholderPlaceholder

United Nations Economic Commission for Europe6en

ValueReference pricePrice includes taxBuyer suggested retail priceOcean charges rateNot subject to fluctuationSubject to escalationSubject to price adjustmentSubject to escalation and price adjustmentFluctuation conditions not specifiedAll in priceNew priceOld pricePer weekPrice on applicationUnpacked priceTrade priceFirm priceMaterial share of item priceLabour share of item priceTransport share of item pricePacking share of item priceTooling share of item priceTemporary vehicle chargePrice component due to interestPrice component due to management servicesPrice component due to maintenanceIndividual buyer priceGroup buying priceGroup member buying pricePre-payment priceRetail price - excluding taxesSuggested retail price - excluding taxesAgreed minimum priceStatutory minimum retail priceCost reimbursement priceMarket priceOpen tender priceBase priceBase price difference

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/PriceTypeCode-2.0.gc

Page 200: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Adjustable price prior to acceptanceRevisable price after acceptanceProvisional ceiling priceAdjustable provisional ceiling priceRevisable provisional ceiling priceRevisable provisional priceAdjustable provisional priceArea priceArea system priceSpecial balance regulation priceBalance regulation priceUpward balance regulation priceDownward balance regulation priceActive ingredientAlternate priceAdvice priceBroker priceCatalogue priceCurrent domestic valueContract priceCurrent priceConsumer unitConfirmed unit priceDeclared customs unit valueDealer adjusted priceDistributor priceDiscount priceDealer priceDiscount amount allowedECSC priceEstimated priceExpected unit priceFreight/charge rateGross unit priceInvoice priceLabelling priceMaximum order quantity priceMinimum order quantity priceMinimum release quantity priceManufacturer's suggested retailMaximum release quantity priceNot-to-exceed priceNo quoteNet unit priceNet weightOcean freight ratePrice break quantity(s)Unit price beginning quantityPrepaid freight chargesProvisional priceProducer's pricePromotional price

Page 201: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Gross weightQuote priceResale priceRetail priceShip and debitSuggested retail priceGross weight without wooden palletsTo be negotiatedTransferTraded unitTheoretical weightWholesale price

Page 202: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

Codeurn:www.cenbii.eu:profile:bii01:ver1.0urn:www.cenbii.eu:profile:bii02:ver1.0urn:www.cenbii.eu:profile:bii03:ver1.0urn:www.cenbii.eu:profile:bii04:ver1.0urn:www.cenbii.eu:profile:bii05:ver1.0urn:www.cenbii.eu:profile:bii06:ver1.0urn:www.cenbii.eu:profile:bii07:ver1.0urn:www.cenbii.eu:profile:bii08:ver1.0urn:www.cenbii.eu:profile:bii09:ver1.0urn:www.cenbii.eu:profile:bii10:ver1.0urn:www.cenbii.eu:profile:bii11:ver1.0urn:www.cenbii.eu:profile:bii12:ver1.0urn:www.cenbii.eu:profile:bii13:ver1.0urn:www.cenbii.eu:profile:bii14:ver1.0urn:www.cenbii.eu:profile:bii15:ver1.0urn:www.cenbii.eu:profile:bii16:ver1.0urn:www.cenbii.eu:profile:bii17:ver1.0urn:www.cenbii.eu:profile:bii18:ver1.0urn:www.cenbii.eu:profile:bii19:ver1.0urn:www.cenbii.eu:profile:bii20:ver1.0urn:www.cenbii.eu:profile:bii21:ver1.0urn:www.cenbii.eu:profile:bii22:ver1.0urn:www.cenbii.eu:profile:bii23:ver1.0urn:www.cenbii.eu:profile:bii24:ver1.0urn:www.cenbii.eu:profile:bii25:ver1.0urn:www.cenbii.eu:profile:bii26:ver1.0

Page 203: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ProfileIDProfile IDCWA ???1PlaceholderPlaceholder

CEN/ISSS WS/BII

en

ValueBII01 - Catalogue onlyBII02 - Catalogue update BII03 - Order OnlyBII04 - Invoice onlyBII05 - BillingBII06 - ProcurementBII07 - Procurement with invoice disputeBII08 - Billing with dispute and reminderBII09 - Customs BillBII10 - Tender Notification BII11 - QualificationBII12 - Tendering Simple BII13 - Advanced Procurement with dispatchBII14 - Prior Information NoticeBII15 - Scanned InvoiceBII16 - Catalogue deletion BII17 - Multi party catalogueBII18 - Punch-outBII19 - Advanced ProcurementBII20 - Customer Initiated SourcingBII21 - StatementBII22 - Call for TenderBII23 - Invoice only with disputeBII24 - Attachment DocumentBII25 - Status RequestBII26 - Retrieve Business Document

Page 204: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

Code1

2

34

81:381:4

380:1380:2380:3380:4916:1916:2916:3916:4916:5916:6

ADT1:1ADT1:2ADT1:3ADT1:4ADT1:5

311:1311:7311:2311:3311:4231:3231:4231:5231:6312:1312:2312:3312:5

ADT3:1ADT3:2ADT3:3ADT3:4

Page 205: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ADT3:5ADT2:1ADT2:2ADT2:3ADT2:4ADT2:5

9:19:29:39:4

ADT4:1ADT4:2ADT4:3ADT4:4ADT4:5ADT5:1ADT5:2ADT5:3ADT5:5

310:1310:2310:4310:3310:5

ADT6:3ADT6:4ADT6:5

320:3320:4320:5320:6230:3230:4230:5230:6220:1220:2220:3220:4406:3406:4406:5406:6

Page 206: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ResponseCodeResponse Code

0.1PlaceholderPlaceholder

European Commision

en

Value Column1Undefined incoming message

Undefined operation

Undefined header blockAccess unauthorised Credit Note ID already existsHard business rule violatedInvoice approvedInvoice disputedInvoice ID already existsHard business rule violatedAttachment addedAttachment rejectedAttachment ID already existsHard business rule violatedParent document ID does not existMissing Attachment binary dataWillingness approvedWillingness rejectedWillingness ID already existsHard business rule violatedParent document ID does not existRequestForQuotation approvedRequestForQuotation cancelledRequestForQuotation rejectedRequestForQuotation ID already existsHard business rule violatedOrder Response ID already existsHard business rule violatedParent document ID does not existOrder state is wrongAcknowledgement approvedAcknowledgement rejectedAcknowledgement ID already existsParent document ID does not existProposal approvedProposal rejectedProposal ID already existsHard business rule violated

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/ResponseCode-2.0.gc

Page 207: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Parent document ID does not existProposal Request approvedProposal Request rejectedProposal Request ID already existsHard business rule violatedParent document ID does not existCatalogue approvedCatalogue rejectedCatalogue ID already existsHard business rule violatedQuotationRequest approvedQuotationRequest rejectedQuotationRequest ID already existsHard business rule violatedParent document ID does not existAdhocS2C approvedAdhocS2C rejectedAdhocS2C ID already existsParent document ID does not existQuotation approvedQuotation rejectedHard business rule violatedQuotation ID already existsParent document ID does not existAdhocC2S ID already existsHard business rule violatedParent document ID does not existOrder Acknowledgement ID already existsHard business rule violatedParent document ID does not existOrder state is wrongOrder Change ID already existsHard business rule violatedParent document ID does not existOrder state is wrongOrder approvedOrder rejectedOrder ID already existsHard business rule violatedOrder Cancellation ID already existsHard business rule violatedParent document ID does not existOrder state is wrong

Page 208: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Long DescriptionThis error message is thrown when the incoming message is undefined.

This error message is thrown when access to the operation cannot be grantedThis error message is thrown when the incoming Credit Note ID has already been received.This error message is thrown when the Credit Note violates a schematron hard business rule.Invoice is approvedInvoice is disputedThis error message is thrown when the incoming Invoice ID has already been received.This error message is thrown when the Invoice violates a schematron hard business rule.Attachment added to parent document.This error message is thrown in case the MIME type of the Attachment is not allowed.This error message is thrown when the parent document of the Attachment does not exist.This error message is thrown when the Attachment violates a schematron hard business rule.This error message is thrown when the incoming Attachment ID has already been received.This error message is thrown when the Attachment does not contain binary content.Willingness is acceptedWillingness is rejectedThis error message is thrown when the incoming Willingness ID has already been received.

RequestForQuotation is processedRequestForQuotation is cancelledRequestForQuotation is rejectedThis error message is thrown when the incoming RequestForQuotation ID has already been received.

This error message is thrown when the Body block lacks information about the operation (like the wrapper element) or the Body block is missing or contains multiple times the Body block.This error message is thrown when the message lacks specific Header blocks or contains multiple times the same Header block

Page 209: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

This error message is thrown when the incoming RequestForQuotation ID has already been received.

Page 210: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

CodeApplicationResponseCatalogueCatalogueItemUpdateCataloguePriceUpdateCreditNoteInvoiceOrderOrderResponseSimple

Page 211: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ResponseDocumentTypeCodeResponse Document Type CodeCWA ???1PlaceholderPlaceholder

CEN/ISSS WS/BII

en

ValueApplication ResponseCatalogueCatalogue Item Specification UpdateCatalogue Pricing UpdateCredit NoteInvoiceOrderOrder Response Simple

Page 212: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

Code012345

Page 213: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

StatusCodeStatus Code

0.1PlaceholderPlaceholder

European Commision

en

ValueNon existingReceivedProcessedRejectedSentAccepted

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/StatusCode-2.0.gc

Page 214: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

Code

StandardRatedZeroRated

Note:In NES, the Tax Type Code is used specifically to indicate (for information) the category

Page 215: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

TaxTypeCodeTax Type Code

1PlaceholderPlaceholder

en

Value

The tax specified by the Tax Scheme attracts VAT at zero rate (0%) or is VAT exempt.

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/TaxTypeCode-2.0.gc

The tax specified by the Tax Scheme attracts VAT at standardrate.

Page 216: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

CodeAAAABACADAEBCEGHOSZ

Page 217: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

TaxCategoryIDTax Category IDUN/ECE 5305D08BPlaceholderPlaceholder

United Nations Economic Commission for Europe6en

ValueMixed tax rateLower rateExempt for resaleValue Added Tax (VAT) not now due for paymentValue Added Tax (VAT) due from a previous invoiceVAT Reverse ChargeTransferred (VAT)Duty paid by supplierExempt from taxFree export item, tax not chargedHigher rateServices outside scope of taxStandard rateZero rated goods

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/TaxCategoryID-2.0.gc

Page 218: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Code specifying that the rate is based on mixed tax Tax rate is lower than standard rate A tax category code indicating the item is tax exempt when the item is bought for future resale A code to indicate that the Value Added Tax (VAT) amount which is due on the current invoice is to be paid on receipt of a separate VAT payment request A code to indicate that the Value Added Tax (VAT) amount of a previous invoice is to be paid Code specifying that the standard VAT rate is levied from the invoicee VAT not to be paid to the issuer of the invoice but directly to relevant tax authority Duty associated with shipment of goods is paid by the supplier; customer receives goods with duty paid Code specifying that taxes are not applicable Code specifying that the item is free export and taxes are not charged Code specifying a higher rate of duty or tax or fee Code specifying that taxes are not applicable to the services Code specifying the standard rate Code specifying that the goods are at a zero rate

Page 219: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

CodeVAT

Page 220: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

TaxSchemeIDTax Scheme IDUN/ECE 5153 SubsetD08BPlaceholderPlaceholder

United Nations Economic Commission for Europe6en

ValueValue added tax

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/TaxSchemeID-2.0.gc

Page 221: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

Code

AAA Exempt

AAB Exempt

AAC Exempt

Page 222: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

AAE Reverse Charge

AAF Exempt

AAG Exempt

AAH Margin Scheme

AAI Margin Scheme

AAJ Reverse Charge

AAK Reverse Charge

AAL Reverse Charge Exempt

AAM Exempt New Means of Transpo

AAN Exempt Triangulation

Page 223: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

AAO Reverse Charge

Page 224: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

TaxExemptionReasonCodeTax Exemption Reason CodeCWA 155772006PlaceholderPlaceholder

CEN/ISSS

en

Value

Exemption of exports from the Community and like transactions and international transport.

Special exemptions linked to international goods traffic.

Exempt Intra-Community supplies of goods.

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/default/TaxExemptionReasonCode-2.0.gc

Page 225: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Reverse Charge Intra-Community transport services.

Exemption under the special scheme for investment gold.

Exempt within the territory of the country.

Article 26a of Directive 77/388/EC

Margin scheme for travel agents

Reverse charge procedure applying to supplies of gold.

Reverse charge procedure when goods cease to be covered by warehousing arrangements.

Intra-Community supply of a new means of transport.

Triangulation

Reverse charge procedure. Special scheme for non VAT registered companies within an ECcountry in case of domestic supply of goods and services to a VAT registered purchaser inthat EC country.

Page 226: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Reverse charge procedure for services such as consultant, lawyer, information, ADB and translation.

Page 227: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

To be used when invoicing goods which are delivered to a non-EC country and wheninvoicing certain services, where these are directly connected with the export of goods.

To be used when invoicing goods which are imported from a non EC country into anapproved warehouse, or free zone, within the EC area, and held in warehouse under VATsuspension. This arrangement may also include VAT suspended goods movements betweendifferent approved warehouses within the EC provided that the goods are re-exported fromthe warehouse to a non-EC country. Should also be used for transport costs included incustoms value.Example: a company in EC country A imports goods from US and stores them in anapproved warehouse, under VAT suspension. The EC company A then sells the goods to acompany in EC country B and transfers the goods from the warehouse in country A to awarehouse in country B, still under VAT suspension.Then the company in country B sells and delivers the goods to a company in Russia.

The VAT liability for the supply of goods from a VAT registered business in one EU Member State toa VAT registered business in another EU Member State is shifted from the vendor to the personacquiring the goods.In a manual invoicing environment, the vendor justifies not accounting for VAT at the rate prevalentin the EU Member State in which he belongs by quoting as part of the VAT invoice for the supply:• the VAT registration number of the person acquiring the goods - in the country in which thesupply is received; and• a reference to Article 28c(A) of Directive 77/388/EC.This code is intended to perform the same function for an electronic invoice as would be performedby the reference to Article 28c(A) of Directive 77/388/EC in a manual invoice.

Page 228: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

To be used when invoicing the transport of goods within the EC and ancillary services tothese transports, services rendered by intermediaries, services on movable tangibleproperty, where the customer is registered for VAT in a different EC country to that of thesupplier.

To be used when invoicing investment gold to a customer in another EC country, where thespecial scheme for investment gold is applicable.

To be used when invoicing, within the supplier’s own country, goods and services that areexempt from VAT under the national legislation – e.g. banking-, insurance services, hospitalcare, medicine and education.

To be used when invoicing second-hand goods, works of arts, collector’s items and antiqueswhere the margin scheme is applicable.

To be used when invoicing for travel arrangements where the margin scheme for travelagents is applicable.

To be used when the supplier of the investment gold, which would otherwise be exempt fromVAT, has exercised the right to “option to tax”, under the Article26b(C) of directive 77/388/EC. Under this “option to tax” arrangement, the customer is liableto account for VAT on supply, under the reverse charge procedure.

To be used when invoicing goods and certain services, from a supplier (a foreign entity) whois not established and registered for VAT in an EC country, to a customer who is VATregistered in that EC country.

To be used when invoicing goods from a non-EC country which have been held in anapproved warehouse and should be removed for consumption in an EC country (i.e. not reexportedas in AAB).Example: still using the example above (AAB) as a base the company in country A sells andtransfers the goods to a company in country B but in this case the company in country Bsells and deliver the goods to EC country C for domestic consumption.

To be used when invoicing a supply of new means of transport to a customer in another ECcountry.

To be used when invoicing by a company who is the middleman in a triangulation chain i.e.goods trade between three parties in different EC countries and the goods delivered fromthe first part to the last part.

Page 229: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

To be used when invoicing taxable services for example consultant-, lawyer-, auditor-,translation- and information services, ADB and preparing systems and programs,advertising to EC countries and certain non EC countries.

Page 230: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Article 15 of Directive 77/388/EC

Article 16 of Directive 77/388/EC

Article 28c(A) of Directive 77/388/EC

Page 231: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Article 28b(C) (D) (E) (F) of Directive 77/388/EC

Article 26b(B) ) of Directive 77/77/388/EC

Article 13 of Directive 77/388/EC

Article 26a of Directive 77/388/EC

Article 26 of Directive 77/388/EC

Article 26b(F) of Directive 77/388/EC

Article 21 1.a of Directive

Article 16 (1) 2nd subparagraph of Directive 77/388/EC

Article 28a(2) of Directive 77/388/EC

Article 28c(E)(3) of Directive 77/388/EC

Page 232: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

Article 9.2.e of Directive 77/388/EC

Page 233: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ShortNameLongNameListIDVersionCanonicalUriCanonicalVersionUriLocationUriAgencyLongNameAgencyIdentifierLocale

Code0506081011131415161718192021222324252627282930313233343536373840414344454647485354

Page 234: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

5657585960616263646669717273747677788081848587899091929394959697981A1B1C1D1E1F1G1H1I1J1K1L1M1X2A2B2C2G2H2I

Page 235: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

2J2K2L2M2N2P2Q2R2U2V2W2X2Y2Z3B3C3E3G3H3I4A4B4C4E4G4H4K4L4M4N4O4P4Q4R4T4U4W4X5A5B5C5E5F5G5H5I5J5K5P5QA1A10A11

Page 236: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

A12A13A14A15A16A17A18A19A2A20A21A22A23A24A25A26A27A28A29A3A30A31A32A33A34A35A36A37A38A39A4A40A41A42A43A44A45A47A48A49A5A50A51A52A53A54A55A56A57A58A59A6A60

Page 237: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

A61A62A63A64A65A66A67A68A69A7A70A71A73A74A75A76A77A78A79A8A80A81A82A83A84A85A86A87A88A89A9A90A91A93A94A95A96A97A98A99AAABACRACTADAEAHAIAJAKALAMAMH

Page 238: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

AMPANNAPAPZAQARAREASASMASUATMATTAVAWAYAZB0B1B10B11B12B13B14B15B16B17B18B19B2B20B21B22B23B24B25B26B27B28B29B3B30B31B32B33B34B35B36B37B38B39B4B40B41

Page 239: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

B42B43B44B45B46B47B48B49B5B50B51B52B53B54B55B56B57B58B59B6B60B61B62B63B64B65B66B67B68B69B7B70B71B72B73B74B75B76B77B78B79B8B80B81B82B83B84B85B86B87B88B89B9

Page 240: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

B90B91B92B93B94B95B96B97B98B99BARBBBDBEBFTBGBHBHPBILBJBKBLBLDBLLBOBPBQLBRBTBTUBUABUIBWBXBZC0C1C10C11C12C13C14C15C16C17C18C19C2C20C21C22C23C24

Page 241: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

C25C26C27C28C29C3C30C31C32C33C34C35C36C37C38C39C4C40C41C42C43C44C45C46C47C48C49C5C50C51C52C53C54C55C56C57C58C59C6C60C61C62C63C64C65C66C67C68C69C7C70C71C72

Page 242: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

C73C74C75C76C77C78C79C8C80C81C82C83C84C85C86C87C88C89C9C90C91C92C93C94C95C96C97C98C99CACCTCDLCELCENCGCGMCHCJCKCKGCLCLFCLTCMKCMQCMTCNPCNTCOCOUCQCRCS

Page 243: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

CTCTGCTMCTNCUCURCVCWACWICYCZD03D04D1D10D11D12D13D14D15D16D17D18D19D2D20D21D22D23D24D25D26D27D28D29D30D31D32D33D34D35D36D37D38D39D40D41D42D43D44D45D46D47

Page 244: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

D48D49D5D50D51D52D53D54D55D56D57D58D59D6D60D61D62D63D64D65D66D67D68D69D7D70D71D72D73D74D75D76D77D78D79D8D80D81D82D83D85D86D87D88D89D9D90D91D92D93D94D95D96

Page 245: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

D97D98D99DAADADDAYDBDCDDDEDECDGDIDJDLTDMADMKDMODMQDMTDNDPCDPRDPTDQDRDRADRIDRLDRMDSDTDTNDUDWTDXDYDZNDZPE01E07E08E09E10E11E12E14E15E16E17E18E19E2

Page 246: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

E20E21E22E23E25E27E28E3E30E31E32E33E34E35E36E37E38E39E4E40E41E42E43E44E45E46E47E48E49E5E50E51E52E53E54E55E56E57E58E59E60E61E62E63E64E65E66E67E68E69E70E71E72

Page 247: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

E73E74E75E76E77E78E79E80E81E82E83E84E85E86E87E88E89E90E91E92E93E94E95E96E97E98E99EAEBECEPEQEVF01F02F03F04F05F06F07F08F1F10F11F12F13F14F15F16F17F18F19F20

Page 248: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

F21F22F23F24F25F26F27F28F29F30F31F32F33F34F35F36F37F38F39F40F41F42F43F44F45F46F47F48F49F50F51F52F53F54F55F56F57F58F59F60F61F62F63F64F65F66F67F68F69F70F71F72F73

Page 249: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

F74F75F76F77F78F79F80F81F82F83F84F85F86F87F88F89F9F90F91F92F93F94F95F96F97F98F99FAHFARFBFBMFCFDFEFFFGFHFITFLFMFOTFPFRFSFTKFTQG01G04G05G06G08G09G10

Page 250: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

G11G12G13G14G15G16G17G18G19G2G20G21G23G24G25G26G27G28G29G3G30G31G32G33G34G35G36G37G38G39G40G41G42G43G44G45G46G47G48G49G50G51G52G53G54G55G56G57G58G59G60G61G62

Page 251: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

G63G64G65G66G67G68G69G7G70G71G72G73G74G75G76G77G78G79G80G81G82G83G84G85G86G87G88G89G90G91G92G93G94G95G96G97G98G99GBGBQGCGDGDWGEGFGFIGGRGHGIAGICGIIGIPGJ

Page 252: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

GKGLGLDGLIGLLGMGNGOGPGQGRMGRNGROGRTGTGVGWGWHGYGZH03H04H05H06H07H08H09H1H10H11H12H13H14H15H16H18H19H2H20H21H22H23H24H25H26H27H28H29H30H31H32H33H34

Page 253: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

H35H36H37H38H39H40H41H42H43H44H45H46H47H48H49H50H51H52H53H54H55H56H57H58H59H60H61H62H63H64H65H66H67H68H69H70H71H72H73H74H75H76H77H78H79H80H81H82H83H84H85H87H88

Page 254: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

H89H90H91H92H93H94H95H96H98H99HAHARHBAHBXHCHDHDWHEHFHGMHHHIHIUHJHKHKMHLHLTHMHMQHMTHNHOHPHPAHSHTHTZHURHYIAICIEIFIIILIMINHINKINQIPISDIT

Page 255: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

IUIVJ10J12J13J14J15J16J17J18J19J2J20J21J22J23J24J25J26J27J28J29J30J31J32J33J34J35J36J38J39J40J41J42J43J44J45J46J47J48J49J50J51J52J53J54J55J56J57J58J59J60J61

Page 256: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

J62J63J64J65J66J67J68J69J70J71J72J73J74J75J76J78J79J81J82J83J84J85J87J89J90J91J92J93J94J95J96J97J98J99JBJEJGJKJMJNTJOJOUJPSJRJWLK1K10K11K12K13K14K15K16

Page 257: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

K17K18K19K2K20K21K22K23K24K25K26K27K28K3K30K31K32K33K34K35K36K37K38K39K40K41K42K43K45K46K47K48K49K5K50K51K52K53K54K55K58K59K6K60K61K62K63K64K65K66K67K68K69

Page 258: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

K70K71K73K74K75K76K77K78K79K80K81K82K83K84K85K86K87K88K89K90K91K92K93K94K95K96K97K98K99KAKATKBKBAKCCKDKDWKELKFKGKGMKGSKHYKHZKIKICKIPKJKJOKLKLKKMAKMHKMK

Page 259: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

KMQKMTKNIKNSKNTKOKPAKPHKPOKPPKRKSKSDKSHKTKTMKTNKURKVAKVRKVTKWKWHKWOKWTKXL10L11L12L13L14L15L16L17L18L19L2L20L21L23L24L25L26L27L28L29L30L31L32L33L34L35L36

Page 260: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

L37L38L39L40L41L42L43L44L45L46L47L48L49L50L51L52L53L54L55L56L57L58L59L60L61L62L63L64L65L66L67L68L69L70L71L72L73L74L75L76L77L78L79L80L81L82L83L84L85L86L87L88L89

Page 261: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

L90L91L92L93L94L95L96L98L99LALACLBRLBTLCLDLELEFLFLHLILJLKLMLNLOLPLPALRLSLTNLTRLUBLUMLUXLXLYM0M1M10M11M12M13M14M15M16M17M18M19M20M21M22M23M24

Page 262: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

M25M26M27M29M30M31M32M33M34M35M36M37M4M5M7M9MAMAHMALMAMMARMAWMBEMBFMBRMCMCUMDMFMGMMHZMIKMILMINMIOMIUMKMLDMLTMMKMMQMMTMNDMONMPAMQMQHMQSMSKMTMTKMTQMTR

Page 263: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

MTSMVMVAMWHN1N2N3NANARNBNBBNCNCLNDNENEWNFNGNHNINILNIUNJNLNMINMPNNNPLNPRNPTNQNRNRLNTNTTNUNVNXNYOAODEOHMONONZOPOTOZOZAOZIP0P1P2P3

Page 264: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

P4P5P6P7P8P9PAPALPBPDPEPFPFLPGPGLPIPKPLPLAPMPNPOPQPRPSPTPTDPTIPTLPUPVPWPYPZQ3QAQANQBQDQHQKQRQTQTDQTIQTLQTRR1R4R9RARDRG

Page 265: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

RHRKRLRMRNRORPRPMRPSRSRTRUS3S4S5S6S7S8SASANSCOSCRSDSESECSETSGSHTSIESKSLSMISNSOSPSQSQRSRSSSSTSTSTISTKSTLSTNSVSWSXT0T1T3T4T5

Page 266: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

T6T7T8TATAHTCTDTETFTITICTIPTJTKTLTMSTNTNETPTPRTQTQDTRTRLTSTSDTSHTTTUTVTWTYU1U2UAUBUCUDUEUFUHUMVAVIVLTVPVQVSW2W4WAWBWCD

Page 267: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

WEWEBWEEWGWHWHRWIWMWRWSDWTTWWX1YDKYDQYLYRDYTZ1Z2Z3Z4Z5Z6Z8ZP

Page 268: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

UnitOfMeasureCodeUnit Of Measure CodeUN/ECE rec 20Revision 6e 2009PlaceholderPlaceholder

United Nations Economic Commission for Europe6en

Valueliftsmall sprayheat lotgroupoutfitrationshotstick, militaryhundred fifteen kg drumhundred lb drumfiftyfive gallon (US) drumtank trucktwenty foot containerforty foot containerdecilitre per gramgram per cubic centimetretheoretical poundgram per square centimetreactual tontheoretical tonkilogram per square metrepound per thousand square foothorse power day per air dry metric toncatch weightkilogram per air dry metric tonkilopascal square metre per gramkilopascal per millimetremillilitre per square centimetre secondcubic foot per minute per square footounce per square footounce per square foot per 0,01inchmillilitre per secondmillilitre per minutesuper bulk bagfivehundred kg bulk bagthreehundred kg bulk bagfifty lb bulk bagfifty lb bagbulk car loadtheoretical kilogramtheoretical tonne

http://docs.oasis-open.org/ubl/os-UBL-2.0/cl/gc/cefact/UnitOfMeasureCode-2.0.gc

Page 269: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

sitasmeshnet kilogrampart per millionpercent weightpart per billion (US)percent per 1000 hourfailure rate in timepound per square inch, gaugeoerstedtest specific scalevolt ampere per poundwatt per poundampere tum per centimetremillipascalgaussmilli-inchkilogausspound per square inch absolutehenrykilopound-force per square inchfoot pound-forcepound per cubic footpoiseSaybold universal secondstokescalorie per cubic centimetrecalorie per gramcurl unittwenty thousand gallon (US) tankcarten thousand gallon (US) tankcarten kg drumfifteen kg drumcar milecar countlocomotive countcaboose countempty cartrain milefuel usage gallon (US)caboose milefixed rateton milelocomotive miletotal car counttotal car milequarter mileradian per secondradian per second squaredroentgenvolt ACvolt DCBritish thermal unit (international table) per hour

Page 270: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

cubic centimetre per secondcubic foot per hourcubic foot per minutecentimetre per seconddecibelkilobytekilobecquerelkilocuriemegagrammegagram per hourbinmetre per minutemilliroentgenmillivoltmegajoulemanmonthpound per pound of productpound per piece of productkilogram per kilogram of productkilogram per piece of productbobbincapcentistokestwenty packmicrolitremicrometre (micron)milliamperemegabytemilligram per hourmegabecquerelmicrofaradnewton per metreounce inchounce footpicofaradpound per hourton (US) per hourkilolitre per hourbarrel (US) per minutebatchgallon(US) per thousandMMSCF/daypound per thousandpumpstagestandard cubic foothydraulic horse powercount per minuteseismic levelseismic line15 °C calorieampere square metre per joule secondangstrom

Page 271: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

astronomical unitattojoulebarnbarn per electronvoltbarn per steradian electronvoltbarn per steradianbecquerel per kilogrambecquerel per cubic metreampere per centimetreBritish thermal unit (international table) per second square foot degree RankineBritish thermal unit (international table) per pound degree RankineBritish thermal unit (international table) per second foot degree RankineBritish thermal unit (international table) per hour square foot degree Rankinecandela per square metrecheval vapeurcoulomb metrecoulomb metre squared per voltcoulomb per cubic centimetrecoulomb per cubic metreampere per millimetrecoulomb per cubic millimetrecoulomb per kilogram secondcoulomb per molecoulomb per square centimetrecoulomb per square metrecoulomb per square millimetrecubic centimetre per molecubic decimetre per molecubic metre per coulombcubic metre per kilogramampere per square centimetrecubic metre per moleampere per square metrecurie per kilogramdeadweight tonnagedecalitredecametredecitexdegree Rankinedenierampere square metredyne second per cubic centimetredyne second per centimetredyne second per centimetre to the fifth powerelectronvoltelectronvolt per metreelectronvolt square metreelectronvolt square metre per kilogramergerg per centimetre8-part cloud coverampere per square metre kelvin squarederg per cubic centimetre

Page 272: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

erg per gramerg per gram seconderg per seconderg per second square centimetreerg per square centimetre seconderg square centimetreerg square centimetre per gramexajoulefarad per metreampere per square millimetrefemtojoulefemtometrefoot per second squaredfoot pound-force per secondfreight tongalGaussian CGS unit of displacementGaussian CGS unit of electric currentGaussian CGS unit of electric chargeampere secondGaussian CGS unit of electric field strengthGaussian CGS unit of electric polarizationGaussian CGS unit of electric potentialGaussian CGS unit of magnetizationgigacoulomb per cubic metregigaelectronvoltgigahertzgigaohmgigaohm metregigapascalrategigawattgongram per cubic metregram per molegraygray per secondhectopascalhenry per metrebitballbulk packacreactivitybyteampere per metreadditional minuteaverage minute per callcopfathomaccess lineampouleampere hour

Page 273: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ampereyearaluminium pound onlytroy ounce or apothecary ounceanti-hemophilic factor (AHF) unitsuppositoryareassortmentalcoholic strength by massalcoholic strength by volumestandard atmospheretechnical atmospherecapsulepowder filled vialassemblyBritish thermal unit (international table) per poundBtu per cubic footbarrel (US) per daybit per secondjoule per kilogram kelvinjoule per metrejoule per square metrejoule per metre to the fourth powerjoule per molejoule per mole kelvincreditjoule seconddigitbunkjoule square metre per kilogramkelvin per wattkiloamperekiloampere per square metrekiloampere per metrekilobecquerel per kilogramkilocoulombkilocoulomb per cubic metrekilocoulomb per square metrekiloelectronvoltbatting poundgibibitkilogram metre per secondkilogram metre squaredkilogram metre squared per secondkilogram per cubic decimetrekilogram per litrecalorie (thermochemical) per gramkilogram-forcekilogram-force metrekilogram-force metre per secondbarrel, imperialkilogram-force per square metrekilojoule per kelvin

Page 274: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

kilojoule per kilogramkilojoule per kilogram kelvinkilojoule per molekilomolekilomole per cubic metrekilonewtonkilonewton metrekiloohmbilletkiloohm metrekilopondkilosecondkilosiemenskilosiemens per metrekilovolt per metrekiloweber per metrelight yearlitre per molelumen hourbunlumen per square metrelumen per wattlumen secondlux hourlux secondmaxwellmegaampere per square metremegabecquerel per kilogramgigabitmegacoulomb per cubic metrecyclemegacoulomb per square metremegaelectronvoltmegagram per cubic metremeganewtonmeganewton metremegaohmmegaohm metremegasiemens per metremegavoltmegavolt per metrejoule per cubic metregigabit per secondreciprocal metre squared reciprocal secondinch per linear footmetre to the fourth powermicroamperemicrobarmicrocoulombmicrocoulomb per cubic metremicrocoulomb per square metremicrofarad per metrebatt

Page 275: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

microhenrymicrohenry per metremicronewtonmicronewton metremicroohmmicroohm metremicropascalmicroradianmicrosecondmicrosiemensbar [unit of pressure]base boxboardbundleboard footbagbrushbrake horse powerbillion (EUR)bucketbasketbaledry barrel (US)barrel (US)bottlehundred board footbecquerelbar [unit of packaging]boltBritish thermal unit (international table)bushel (US)bushel (UK)base weightboxmillion BTUscallcomposite product pound (total weight)millifaradmilligalmilligram per metremilligraymillihenrymillijoulemillimetre per secondmillimetre squared per secondmillimolemole per kilogramcarsetmillinewtonkibibitmillinewton per metremilliohm metremillipascal second

Page 276: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

milliradianmillisecondmillisiemensmillisievertmilliteslamicrovolt per metremillivolt per metremilliwattmilliwatt per square metremilliwebermolemole per cubic decimetremole per cubic metrekilobitmole per litrenanoamperecarloadnanocoulombnanofaradnanofarad per metrenanohenrynanohenry per metrenanometrenanoohm metrenanosecondnanoteslananowattcostneperneper per secondpicometrenewton metre secondnewton metre squared kilogram squarednewton per square metrenewton per square millimetrenewton secondnewton second per metreoctavecellohm centimetreohm metreoneparsecpascal per kelvinpascal secondpascal second per cubic metrepascal second per metrepetajoulephoncentipoisepicoamperepicocoulombpicofarad per metre

Page 277: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

picohenrykilobit per secondpicowattpicowatt per square metrepound gagepound-forcekilovolt ampere hourmillicoulomb per kilogramradradianradian square metre per moleradian square metre per kilogramradian per metrereciprocal angstromreciprocal cubic metrereciprocal cubic metre per secondreciprocal electron volt per cubic metrereciprocal henrycoil groupreciprocal joule per cubic metrereciprocal kelvin or kelvin to the power minus onereciprocal metrereciprocal square metrereciprocal minutereciprocal molereciprocal pascal or pascal to the power minus onereciprocal secondreciprocal second per cubic metrereciprocal second per metre squaredcancarrying capacity in metric toncandeladegree Celsiushundredcardcentigramcontainerconeconnectorcoulomb per kilogramcoilhundred leavecentilitresquare centimetrecubic centimetrecentimetrehundred packcental (UK)carboycoulombcartridgecratecase

Page 278: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

cartoncontent grammetric caratcontent ton (metric)cupcuriecoverhundred pound (cwt) / hundred weight (US)hundred weight (UK)cylindercombokilowatt hour per hourlot [unit of weight]reciprocal second per steradiansiemens per metremebibitsiemens square metre per molesievertthousand linear yardsonesquare centimetre per ergsquare centimetre per steradian ergmetre kelvinsquare metre kelvin per wattreciprocal second per steradian metre squaredsquare metre per joulesquare metre per kilogramsquare metre per molepen gram (protein)square metre per steradiansquare metre per steradian joulesquare metre per volt secondsteradiansyphonterahertzterajouleterawattterawatt hourteslatexcalorie (thermochemical)megabitcalorie (thermochemical) per gram kelvincalorie (thermochemical) per second centimetre kelvincalorie (thermochemical) per second square centimetre kelvinthousand litretonne per cubic metretropical yearunified atomic mass unitvarvolt squared per kelvin squaredvolt - amperevolt per centimetre

Page 279: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

volt per kelvinmillivolt per kelvinkilogram per square centimetrevolt per metrevolt per millimetrewatt per kelvinwatt per metre kelvinwatt per square metrewatt per square metre kelvinwatt per square metre kelvin to the fourth powerwatt per steradianwatt per steradian square metreweber per metreroentgen per secondweber per millimetreminute [unit of angle]second [unit of angle]bookblockroundcassettedollar per hournumber of wordsinch to the fourth powersandwichInternational Table (IT) calorieInternational Table (IT) calorie per second centimetre kelvinInternational Table (IT) calorie per second square centimetre kelvinjoule square metrekilogram per molecalorie (international table) per gramcalorie (international table) per gram kelvinmegacoulombmegajoule per secondbeamdraize scoremicrowattmicroteslamicrovoltmillinewton metremicrowatt per square metremillicoulombmillimole per kilogrammillicoulomb per cubic metremillicoulomb per square metredyne per square centimetrecubic metre (net)rembandsecond per cubic metresecond per cubic metre radianjoule per grampound gross

Page 280: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

pallet/unit loadmass poundsleevedecareten daydaydry pounddisk (disc)degree [unit of angle]dealdecadedecigramdispenserdecagramdecilitrecubic decametresquare decimetrestandard kilolitrecubic decimetredecimetredecinewton metredozen piecedozen pairdisplacement tonnagedata recorddrumdram (US)dram (UK)dozen rolldrachm (UK)displaydry tondecitonnedynepennyweightdyne per centimetredirectory bookdozendozen packnewton per square centimetremegawatt hour per hourmegawatt per hertzmilliampere hourdegree daygigacaloriemillekilocalorie (international table)kilocalorie (thermochemical) per hourmillion Btu(IT) per hourcubic foot per secondtonne per hourpingbelt

Page 281: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

megabit per secondsharesTEUtyreactive unitdoseair dry tontrailerstrandsquare metre per litrelitre per hourfoot per thousandgigabyteterabytepetabytepixelmegapixeldots per inchgross kilogrampart per hundred thousandkilogram-force per square millimetrekilogram-force per square centimetrejoule per square centimetrekilogram-force metre per square centimetremilliohmkilowatt hour per cubic metrekilowatt hour per kelvinservice unitworking daymetric long tonaccounting unitjobrun foottesttripusewellzoneexabit per secondexbibytepebibytetebibytegibibytemebibytekibibyteexbibit per metreexbibit per square metreexbibit per cubic metregigabyte per secondgibibit per metregibibit per square metregibibit per cubic metrekibibit per metre

Page 282: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

kibibit per square metrekibibit per cubic metremebibit per metremebibit per square metremebibit per cubic metrepetabitpetabit per secondpebibit per metrepebibit per square metrepebibit per cubic metreterabitterabit per secondtebibit per metretebibit per cubic metretebibit per square metrebit per metrebit per square metrereciprocal centimetrereciprocal daycubic decimetre per hourkilogram per hourkilomole per secondmole per seconddegree per secondmillimetre per degree Celcius metredegree celsius per kelvinhektopascal per bareachelectronic mail boxeach per montheleven packequivalent gallonenvelopebit per cubic metrekelvin per kelvinkilopascal per barmillibar per barmegapascal per barpoise per barpascal per barmilliampere per inchthousand cubic foot per daykelvin per hourkelvin per minutekelvin per secondsluggram per kelvinkilogram per kelvinmilligram per kelvinpound-force per footkilogram square centimetrekilogram square millimetrepound inch squared

Page 283: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

pound-force inchpound-force foot per amperegram per cubic decimetrekilogram per kilomolgram per hertzgram per daygram per hourgram per minutegram per secondkilogram per daykilogram per minutemilligram per daymilligram per minutemilligram per secondgram per day kelvingram per hour kelvingram per minute kelvingram per second kelvinkilogram per day kelvinkilogram per hour kelvinkilogram per minute kelvinkilogram per second kelvinmilligram per day kelvinmilligram per hour kelvinmilligram per minute kelvinmilligram per second kelvinnewton per millimetrepound-force per inchrod [unit of distance]micrometre per kelvincentimetre per kelvinmetre per kelvinmillimetre per kelvinmilliohm per metreohm per mileohm per kilometremilliampere per pound-force per square inchreciprocal barmilliampere per bardegree Celsius per barkelvin per bargram per day bargram per hour bargram per minute bargram per second barkilogram per day barkilogram per hour barkilogram per minute barkilogram per second barmilligram per day barmilligram per hour barmilligram per minute barmilligram per second bar

Page 284: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

gram per barmilligram per barmilliampere per millimetrepascal second per kelvininch of waterinch of mercurywater horse powerbar per kelvinhektopascal per kelvinkilopascal per kelvinmillibar per kelvinmegapascal per kelvinpoise per kelvinvolt per litre minutenewton centimetrenewton metre per degreefibre per cubic centimetre of airnewton metre per amperebar litre per secondbar cubic metre per secondhektopascal litre per secondhektopascal cubic metre per secondmillibar litre per secondmillibar cubic metre per secondmegapascal litre per secondmegapascal cubic metre per secondpascal litre per seconddegree Fahrenheitfaradfieldfibre metrethousand cubic footmillion particle per cubic foottrack foothundred cubic metretransdermal patchmicromolefailures in timeflake tonmillion cubic footfootpound per square footfoot per minutefoot per secondsquare footcubic footpascal cubic metre per secondcentimetre per barmetre per barmillimetre per barsquare inch per secondsquare metre per second kelvinstokes per kelvin

Page 285: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

gram per cubic centimetre bargram per cubic decimetre bargram per litre bargram per cubic metre bargram per millilitre barkilogram per cubic centimetre barkilogram per litre barkilogram per cubic metre barnewton metre per kilogramUS gallon per minutepound-force foot per poundcup [unit of volume]pecktablespoon (US)teaspoon (US)sterecubic centimetre per kelvinlitre per kelvincubic metre per kelvinImperial gallon per minutemillilitre per kelvinkilogram per cubic centimetreounce (avoirdupois) per cubic yardgram per cubic centimetre kelvingram per cubic decimetre kelvingram per litre kelvingram per cubic metre kelvingram per millilitre kelvinkilogram per cubic centimetre kelvinkilogram per litre kelvinkilogram per cubic metre kelvinsquare metre per second barmicrosiemens per centimetremicrosiemens per metrenanosiemens per centimetrenanosiemens per metrestokes per barcubic centimetre per daycubic centimetre per hourcubic centimetre per minutegallon (US) per hourlitre per secondcubic metre per daycubic metre per minutemillilitre per daymillilitre per hourcubic inch per hourcubic inch per minutecubic inch per secondmilliampere per litre minutevolt per barcubic centimetre per day kelvincubic centimetre per hour kelvin

Page 286: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

cubic centimetre per minute kelvincubic centimetre per second kelvinlitre per day kelvinlitre per hour kelvinlitre per minute kelvinlitre per second kelvincubic metre per day kelvinmicrofiche sheetcubic metre per hour kelvincubic metre per minute kelvincubic metre per second kelvinmillilitre per day kelvinmillilitre per hour kelvinmillilitre per minute kelvinmillilitre per second kelvinmillimetre to the fourth powercubic centimetre per day barcubic centimetre per hour barcubic centimetre per minute barcubic centimetre per second barlitre per day barlitre per hour barlitre per minute barlitre per second barcubic metre per day barcubic metre per hour barcubic metre per minute barcubic metre per second barmillilitre per day barmillilitre per hour barmillilitre per minute barmillilitre per second barcubic centimetre per barlitre per barcubic metre per barmillilitre per barmicrohenry per kiloohmmicrohenry per ohmgallon (US) per daygigabecquerelgram per 100 gramgross barrelgram, dry weightpound per gallon (US)gram per metre (gram per 100 centimetres)gram of fissile isotopegreat grosshalf gallon (US)gill (US)gram, including containergill (UK)gram, including inner packaginggram per millilitre

Page 287: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

gram per kilogramgram per litredry gallon (US)gallon (UK)gallon (US)gram per square metregross gallonmilligram per square metremilligram per cubic metremicrogram per cubic metregramgraingrossgross register tongross tongigajoulegallon per thousand cubic footgigawatt hourgross yardgage systemhenry per kiloohmhenry per ohmmillihenry per kiloohmmillihenry per ohmpascal second per barmicrobecquerelreciprocal yearhalf page – electronicreciprocal hourreciprocal monthdegree Celsius per hourdegree Celsius per minutedegree Celsius per secondsquare centimetre per gramsquare decametresquare hectometrecubic hectometrehalf litrecubic kilometreblankvolt square inch per pound-forcevolt per inchvolt per microsecondpercent per kelvinohm per metredegree per metremicrofarad per kilometremicrogram per litresquare micrometreampere per kilogramampere squared secondfarad per kilometrehertz metre

Page 288: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

kelvin metre per wattmegaohm per kilometremegaohm per metremegaamperemegahertz kilometrenewton per amperenewton metre watt to the power minus 0,5pascal per metresiemens per centimetreteraohmvolt second per metrevolt per secondwatt per cubic metreattofaradcentimetre per hourreciprocal cubic centimetredecibel per kilometredecibel per metrekilogram per barkilogram per cubic decimetre kelvinkilogram per cubic decimetre barkilogram per square metre secondinch per two pi radiantmetre per volt secondsquare metre per newtoncubic metre per cubic metremillisiemens per centimetremillivolt per minutemilligram per square centimetremilligram per grammillilitre per cubic metremillimetre per yearmillimetre per hourmillimole per grampicopascal per kilometrepicosecondpercent per monthpercent per hectobarpercent per decakelvinwatt per metredecapascalgram per millimetremodule widthconventional centimetre of waterFrench gaugerack unitmillimetre per minutebig pointlitre per kilogramgram millimetrereciprocal weekpiecemegaohm kilometre

Page 289: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

percent per ohmpercent per degreepercent per ten thousandpercent per one hundred thousandpercent per hundredpercent per thousandpercent per voltpercent per barpercent per inchpercent per metrehankhectarehectobarhundred boxeshundred counthalf dozenhundred kilogram, dry weighthundredth of a carathundred foothectogramhundred cubic foothundred sheethundred international unitmetric horse powerhundred kilogramhundred kilogram, net masshundred foot (linear)hectolitremile per hourmillion cubic metrehectometreconventional millimetre of mercuryhundred troy ounceconventional millimetre of waterhectolitre of pure alcoholhundred square foothalf hourhertzhourhundred yardinch pound (pound inch)count per inchpersoninches of watercolumn inchinch per minuteimpressioninchsquare inchcubic inchinsurance policyinternational sugar degreecount per centimetre

Page 290: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

inch per secondinch per second squaredpercent per millimetreper mille per psidegree APIdegree Baume (origin scale)degree Baume (US heavy)degree Baume (US light)degree Ballingdegree Brixdegree Fahrenheit hour square foot per British thermal unit (thermochemical)joule per kilogramdegree Fahrenheit per kelvindegree Fahrenheit per bardegree Fahrenheit hour square foot per British thermal unit (international table)degree Fahrenheit per hourdegree Fahrenheit per minutedegree Fahrenheit per secondreciprocal degree Fahrenheitdegree Oechsledegree Rankine per hourdegree Rankine per minutedegree Rankine per seconddegree Twaddellmicropoisemicrogram per kilogrammicrogram per cubic metre kelvinmicrogram per cubic metre barmicrolitre per litrebaudBritish thermal unit (mean)

British thermal unit (international table) per pound degree FahrenheitBritish thermal unit (international table) per minuteBritish thermal unit (international table) per second

British thermal unit (thermochemical) per hour

British thermal unit (thermochemical) per pound degree FahrenheitBritish thermal unit (thermochemical) per minuteBritish thermal unit (thermochemical) per secondcoulomb square metre per kilogrammegabaudwatt secondbar per barbarrel (UK petroleum)barrel (UK petroleum) per minutebarrel (UK petroleum) per daybarrel (UK petroleum) per hourbarrel (UK petroleum) per second

British thermal unit (international table) foot per hour square foot degree FahrenheitBritish thermal unit (international table) inch per hour square foot degree FahrenheitBritish thermal unit (international table) inch per second square foot degree Fahrenheit

British thermal unit (thermochemical) foot per hour square foot degree Fahrenheit

British thermal unit (thermochemical) inch per hour square foot degree FahrenheitBritish thermal unit (thermochemical) inch per second square foot degree Fahrenheit

Page 291: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

barrel (US petroleum) per hourbarrel (US petroleum) per secondbushel (UK) per daybushel (UK) per hourbushel (UK) per minutebushel (UK) per secondbushel (US dry) per daybushel (US dry) per hourbushel (US dry) per minutebushel (US dry) per secondcentinewton metrecentipoise per kelvincentipoise per barcalorie (mean)calorie (international table) per gram degree Celsiuscalorie (thermochemical) per centimetre second degree Celsiuscalorie (thermochemical) per gram degree Celsiuscalorie (thermochemical) per minutecalorie (thermochemical) per secondclocentimetre per second kelvincentimetre per second barcubic centimetre per cubic metrecentimetre of mercurycubic decimetre per daycubic decimetre per cubic metrecubic decimetre per minutecubic decimetre per seconddyne centimetreounce (UK fluid) per dayounce (UK fluid) per hourounce (UK fluid) per minuteounce (UK fluid) per secondounce (US fluid) per dayjumbojoule per kelvinjugmegajoule per kilogrammegajoule per cubic metrepipeline jointjointjoulehundred metrejarnumber of jewelskilowatt demandounce (US fluid) per hourounce (US fluid) per minuteounce (US fluid) per secondfoot per degree Fahrenheitfoot per hourfoot pound-force per hourfoot pound-force per minute

Page 292: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

foot per psifoot per second degree Fahrenheitfoot per second psikilovolt ampere reactive demandreciprocal cubic footcubic foot per degree Fahrenheitcubic foot per daycubic foot per psifoot of waterfoot of mercurygallon (UK) per daygallon (UK) per hourgallon (UK) per secondkilovolt ampere reactive hourgallon (US liquid) per secondgram-force per square centimetregill (UK) per daygill (UK) per hourgill (UK) per minutegill (UK) per secondgill (US) per daygill (US) per hourgill (US) per minutegill (US) per secondstandard acceleration of free fallgrain per gallon (US)horsepower (boiler)horsepower (electric)inch per degree Fahrenheitinch per psiinch per second degree Fahrenheitinch per second psireciprocal cubic inchkilovolt ampere (reactive)kilobaudkilocalorie (mean)kilocalorie (international table) per hour metre degree Celsiuskilocalorie (thermochemical)kilocalorie (thermochemical) per minutekilocalorie (thermochemical) per secondkilomole per hourkilomole per cubic metre kelvinkilolitrekilomole per cubic metre barkilomole per minutelitre per litrereciprocal litrepound (avoirdupois) per degree Fahrenheitpound (avoirdupois) square footpound (avoirdupois) per daypound per foot hourpound per foot secondpound (avoirdupois) per cubic foot degree Fahrenheit

Page 293: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

pound (avoirdupois) per cubic foot psipound (avoirdupois) per gallon (UK)pound (avoirdupois) per hour degree Fahrenheitpound (avoirdupois) per hour psipound (avoirdupois) per cubic inch degree Fahrenheitpound (avoirdupois) per cubic inch psipound (avoirdupois) per psipound (avoirdupois) per minutepound (avoirdupois) per minute degree Fahrenheitpound (avoirdupois) per minute psipound (avoirdupois) per secondpound (avoirdupois) per second degree Fahrenheitpound (avoirdupois) per second psipound per cubic yardpound-force per square footpound-force per square inch degree Fahrenheitpsi cubic inch per secondpsi litre per secondpsi cubic metre per secondpsi cubic yard per secondpound-force second per square footpound-force second per square inchreciprocal psiquart (UK liquid) per dayquart (UK liquid) per hourquart (UK liquid) per minutequart (UK liquid) per secondquart (US liquid) per dayquart (US liquid) per hourcakekatalkilocharacterkilobarkilogram of choline chloridekilogram decimalkilogram drained net weightkelvinkilopacketkegkilogramkilogram per secondkilogram of hydrogen peroxidekilohertzkilogram per millimetre widthkilogram, including containerkilogram, including inner packagingkilosegmentkilojoulekilogram per metrelactic dry material percentagekilogram of methylaminekilometre per hoursquare kilometre

Page 294: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

kilogram per cubic metrekilometrekilogram of nitrogenkilogram named substanceknotmilliequivalence caustic potash per gram of productkilopascalkilogram of potassium hydroxide (caustic potash)kilogram of potassium oxidekilogram of phosphorus pentoxide (phosphoric anhydride)kiloroentgenthousand pound per square inchkilogram of substance 90 % drykilogram of sodium hydroxide (caustic soda)kitkilometrekilotonnekilogram of uraniumkilovolt - amperekilovarkilovoltkilogram per millimetrekilowatt hourkilogram of tungsten trioxidekilowattmillilitre per kilogramquart (US liquid) per minutequart (US liquid) per secondmetre per second kelvinmetre per second barsquare metre hour degree Celsius per kilocalorie (international table)millipascal second per kelvinmillipascal second per barmilligram per cubic metre kelvinmilligram per cubic metre barmillilitre per litrelitre per minutereciprocal cubic millimetrecubic millimetre per cubic metremole per hourmole per kilogram kelvinmole per kilogram barmole per litre kelvinmole per litre barmole per cubic metre kelvinmole per cubic metre barmole per minutemilliroentgen aequivalent mennanogram per kilogramounce (avoirdupois) per dayounce (avoirdupois) per hourounce (avoirdupois) per minuteounce (avoirdupois) per second

Page 295: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ounce (avoirdupois) per gallon (UK)ounce (avoirdupois) per gallon (US)ounce (avoirdupois) per cubic inchounce (avoirdupois)-forceounce (avoirdupois)-force inchpikosiemens per metrepeck (UK)peck (UK) per daypeck (UK) per hourpeck (UK) per minutepeck (UK) per secondpeck (US dry) per daypeck (US dry) per hourpeck (US dry) per minutepeck (US dry) per secondpsi per psipint (UK) per daypint (UK) per hourpint (UK) per minutepint (UK) per secondpint (US liquid) per daypint (US liquid) per hourpint (US liquid) per minutepint (US liquid) per secondpint (US dry)quart (US dry)slug per dayslug per foot secondslug per cubic footslug per hourslug per minuteslug per secondtonne per kelvintonne per bartonne per daytonne per day kelvintonne per day bartonne per hour kelvintonne per hour bartonne per cubic metre kelvintonne per cubic metre bartonne per minutetonne per minute kelvintonne per minute bartonne per secondtonne per second kelvintonne per second barton (UK shipping)ton long per dayton (US shipping)ton short per degree Fahrenheitton short per dayton short per hour degree Fahrenheit

Page 296: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

ton short per hour psiton short per psiton (UK long) per cubic yardton (US short) per cubic yardton-force (US short)common yearsidereal yearyard per degree Fahrenheityard per psipound per cubic inchlactose excess percentagepoundtroy pound (US)linear centimetrelitre per dayliteleaflinear footlabour hourlinear inchlarge spraylinklinear metrelengthlot [unit of procurement]liquid poundlitre of pure alcohollayerlump sumton (UK) or long ton (US)litremetric ton, lubricating oillumenluxlinear yard per poundlinear yardmagnetic tapemilligram per litrereciprocal cubic yardcubic yard per degree Fahrenheitcubic yard per daycubic yard per hourcubic yard per psicubic yard per minutecubic yard per secondkilohertz metregigahertz metreBeaufortreciprocal megakelvin or megakelvin to the power minus onereciprocal kilovolt - ampere hourmillilitre per square centimetre minutenewton per centimetreohm kilometre

Page 297: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

percent per degree Celsiusgigaohm per metremegahertz metrekilogram per kilogramreciprocal volt - ampere secondkilogram per kilometrepascal second per litremillimole per litrenewton metre per square metremillivolt - ampere30-day monthactual/360monetary valuemicrocuriemicro-inchmillion Btu per 1000 cubic footmachine per unitmegavolt ampere reactive hourmega litremegametremegavolt ampere reactivemegawattthousand standard brick equivalentthousand board footmillibarmicrogrammillicurieair dry metric tonmilligram per square foot per sidemilligrammegahertzsquare milethousandminute [unit of time]millionmillion international unitmilligram per square inchmilliardmillilitresquare millimetrecubic millimetremillimetrekilogram, dry weightmonthmegapascalthousand metrecubic metre per hourcubic metre per secondmetre per second squaredmatsquare metrecubic metremetre

Page 298: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

metre per secondnumber of multsmegavolt - ampere

pen calorienumber of linesprint pointmilligram per kilogramnumber of articlesbargenumber of bobbinscarnumber of cellsnet barrelnet litrenewtonmessagenet gallon (us)message hournet imperial gallonnilnumber of international unitsnumber of screensloadnautical milenumber of packstrainnumber of parcelsnumber of pairsnumber of partsmhomicromhonumber of rollsnet tonnet register tonnewton metrevehiclepart per thousandpound per air dry metric tonpanelozone depletion equivalentohmounce per square yardouncetwo packovertime hourounce avfluid ounce (US)fluid ounce (UK)page - electronicpercentpound per footthree pack

megawatt hour (1000 kW.h)

Page 299: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

four packfive packsix packseven packeight packnine packpacketpascalpair inchpadpound equivalentpallet (lift)proof litreplateproof gallonpitchpackpaildegree Platopound percentagepound netpound per inch of lengthpage per inchpairpound-force per square inchpint (US)dry pint (US)pint (UK)liquid pint (US)tray / tray packhalf pint (US)pound per inch of widthpeck dry (US)peck dry (UK)mealpage - facsimilequarter (of a year)page - hardcopyquarter dozenquarter hourquarter kilogramquirequart (US)dry quart (US)quart (UK)liquid quart (US)quarter (UK)picacaloriethousand cubic metrerackrodring

Page 300: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

running or operating hourroll metric measurereelreamream metric measurerollpound per reamrevolutions per minuterevolutions per secondresetrevenue ton milerunsquare foot per secondsquare metre per secondsixty fourths of an inchsessionstorage unitstandard advertising unitsackhalf year (6 months)scorescruplesolid poundsectionsecond [unit of time]setsegmentshipping tonsiemenssplit tank truckslipsheetmile (statute mile)square rodspoolshelf packagesquaresquare, roofingstripsheet metric measureshort standard (7200 matches)sheetstone (UK)stick, cigarettestandard litreton (US) or short ton (UK/US)skidskeinshipmenttelecommunication line in servicethousand pound grossthousand piecethousand bagthousand casing

Page 301: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

thousand gallon (US)thousand impressionthousand linear inchtenth cubic footkiloampere hour (thousand ampere hour)truckloadthermtoteten square yardthousand square inchmetric ton, including containermetric ton, including inner packagingthousand square centimetretank, rectangularthousand foot (linear)kilogram of imported meat, less offaltintonne (metric ton)ten packten pairthousand footthousand cubic metre per dayten square foottrillion (EUR)thousand square foottonne of substance 90 % dryton of steam per hourthousand linear metretubethousand kilogramthousand sheettank, cylindricaltreatmenttablettorrtelecommunication line in service averagetelecommunication porttenth minutetenth hourusage per telecommunication line averageten thousand yardmillion unitvolt - ampere per kilogramvialvoltpercent volumebulkvisitwet kilotwo weekwatt per kilogramwet poundcord

Page 302: [XLS]circabc.europa.eu · Web view45 threehundred kg bulk bag 46 ... 97 ten kg drum 98 fifteen kg drum 1A car mile 1B car count 1C locomotive count 1D ... No quote NTP Net unit price

wet tonweberweekwine gallonwheelwatt hourweight per square inchworking monthwrapstandardwattmillilitre of waterGunter's chainsquare yardcubic yardhundred linear yardyardten yardlift vanchestcaskhogsheadlugconference pointnewspage agate linepage