VOLUME 26, No. 4 OCTOBER - DECEMBER, 2015 - iipr.icar.gov.in · Devendra Singh Bhole, Hon’ble...

CONTENTS

VOLUME 26, No. 4 OCTOBER - DECEMBER, 2015

News 2-3 World Soil Day Celebrated Biosafety Workshop Organized Training for FCI Officials Training on Seed Production IIPR AwardedResearch Highlights 3-8 New Varieties Novel A-Lines in CGMS Breeding in

Pigeonpea Maping Gene(s)/QTL(s) for Fertility

Restoration and Wilt Iron Deficiency in Fieldpea LAMP Assay for Detection of Transgene MADS Box Genes in Chickpea Free Radical Scavenging Activity of

Chickpea Cultivars Profile Hidden Markov Model in Chickpea Pre-harvest Sprouting Tolerance in

Mungbean Performance of Chickpea under Rice

Fallow Powdery Mildew in Cluster Bean/Guar Breeding for Short Stature in

Pigeonpea Zinc Ferti-fortification in Urd and Mung Enhancing RUE in Lentil Spodoptera Exigua in Maharashtra Status of Major Pulses Market in UPTransfer of Technology 8-11 t ; fdl ku t ; foKku dk;ZØe euk;k x;k j ch nyguh Ql yksa dh mRi knu rduhdh i j d‘"kd i zf' k{k.k j kT; Lrj h; i zf' k{k.k dk;ZØeksa dk vk;kst u d"kd i zf' k{k.k dk;ZØe dk vk;kst u df"k foKku dsUnzksa ds l aosnhdj.k dk;ZØe@izf'k{k.k dk vk;kst u l h, l hi h] ubZ fnYyh dh Vhe dk l aLFkku Hkze.k d"kdksa dk i z{ks= Hkze.kPersonnel 11Director’s Desk 12

Group Meet on MULLaRP and Arid Legumes Held

Annual Group Meet of AICRP onMULLaRP (Mungbean and urdbean)and Arid Legumes (Cowpeaand guar) was held at IIPR,Kanpur on November 28-29,2015. About 70 delegatesfrom SAUs and cooperatingcentres participated in theGroup Meet. Dr. N.P.Singh, Director, IIPR in hiswelcome addressexpressed happiness overpromotion of pulses in newniches specially in spring, summer andrice-fallow conditions and specificallymentioned the success of shortduration varieties of mungbeanoccupying large niches in the country.Expressing concern on low pulseproduction during last year, he calledupon the scientists to exert more fordevelopment of new technologies toreduce the gap between potential andharvested yield. Dr. A.K. Tiwari,Director, Pulses Development, Bhopaladvocated cultivation of summermungbean and urdbean, which has gotmomentum in last 5-7 years usingshort duration varieties andtechnologies for summer season. Dr.Tiwari raised high hope for cultivationof cowpea and desired that its potentialshould be fully exploited.

Dr. Sanjeev Gupta, ProjectCoordinator, MULLaRP projectedtremendous scope of horizontal and

vertical increase in production ofmungbean and urdbean and

specifically increasing production andproductivity of rice fallow pulses. Hehighlighted various varieties andtechnologies developed during lastthree decades and their contribution inpromoting summer mungbean andurdbean. Describing the success ofdistant hybridization programme inVigna species he emphasized upondevelopment of short duration, machineharvestable varieties having multipleresistance to diseases and insectpests. He also presented the summaryof progress of summer/springmungbean and urdbean during lastseason. Dr. Shiv Sewak, Nodal Officer,Network Research Project on AridLegumes, presented the summary ofprogress in arid legumes during the lastspring/summer seasons.

Dr. B.B. Singh, Assistant DirectorGeneral (O&P) in his chairman’sremarks desired that early duration

EDITORIAL COMMITTEEDr. N.P. Singh ChairmanDr. P.S. Basu MemberDr. G.P. Dixit MemberDr. Jitendra Kumar MemberDr. Naimuddin MemberMr. D. Upadhyaya Member Secretary

2 Indian Institute of Pulses Research

varieties are the need of the hour andspecial trials should be conducted forextra early genotypes across thelocations. He observed that very goodmaterial is coming f rom distant

hybridization programme. He alsoexhorted that other short durationpulses such as cowpea should also bepromoted for increasing area underpulses, while newer areas under rice

said that farmers are the soul of anation and urged the need to make thefarmers self -sustained and self

suff icient. He said thatagriculture still continues asa major l ivelihood to asignif icant portion ofpopulation in the country.Shri Bhole suggested thatduring lean season orvacation time (May-June),the village school can act ashub for such noble activityviz., development of SoilHealth Cards at village leveli tself . He promised to

extend all his support and cooperationfor soil health improvement programme.Total 311 SHC were prepared fordistribution to farmers. The meetingended with a vote of thanks by Dr. S.K.Singh, Principal Scientist, SocialScience.

productivity of staple crops includingpulses. In this direction, he called forlarge scale adoption of balanced and

integrated nutrient management,enhancing efficiency of fertilizer use,and use of soi l health cards formanaging both soil and crops efficiently.

The Chief Guest Shri DevendraSingh Bhole in his special remarks,

World Soil Day was celebrated atthe Institute on December 5, 2015. ShriDevendra Singh Bhole, Hon’bleMember of Parliamant, AkabarpurParliamentary Constituency,Uttar Pradesh was the ChiefGuest for the function. Around 250farmers from 7 districts of UttarPradesh, besides staff membersof the Insti tute includingscientists, technical, andadministrative staff and othersparticipated in the function. Dr.Ummed Singh, Nodal Officer fordevelopment of soil health cardhighlighted the importance ofWorld Soil Day and Soil Health Cards.While welcoming the Chief Guest andparticipants, Dr. N.P. Singh, Director,stressed upon the need for large scalesoil/plant testing and development ofsoil health card (SHC) so as to providea requisite boost to both production and

World Soil Day Celebrated

fallow should be brought undermungbean and urdbean cultivation.Later, results of previous season werediscussed and technical programme forthe next season was finalized.

Biosafety Workshop OrganizedAn Awareness Workshop

on Biosafety Regulations andIssues was organized at ICAR-Indian Institute of Pulses Research,Kanpur, on November 9, 2015,under the chairmanship of Dr. N. P.Singh, Director and Chairman,

Institutional Biosafety Committee.The awareness workshop wasconducted to create awareness amongthe staff working in different Projectsof the Institute on biosafety regulationsand issues and good laboratorypractices.

Training for FCI OfficialsTraining on ‘Pulses grain quality

and processing’ for Food Corporationof India personnel from Uttar Pradeshwas organised on December 7, 2015.Total 66 officials of different ranks likeAGM (QC), Manager (QC) andTechnical Staff participated in thisprogramme. In his inaugural addressDr. N.P. Singh, Director IIPR highlightedthe advances made in pulsesproduction in India as well as the needof procurement of pulses in country inview of recent price rise. The trainingcovered different aspects like pulsesproduction technology, grain quality(physical), diseases and pestsmanagement in storage, and pulsesprocessing and marketing. Dr.Narendra Kumar coordinated thetraining programme.

Pulses Newsletter : October - December, 2015 3

IIPR AwardedICAR-IIPR has bagged the Best

Performance Award in Breeder SeedProduction (ICARInstitute category)for the year 2014-15 during 10 th

Annual Rev iewMeeting of ICARSeed Project,“Seed Productionin AgriculturalCrops” held on 24-25 August, 2015 atICAR-Central Costal AgriculturalResearch Institute, Goa.

Training on Seed Production OrganizedTo improve the capabilities and

abridge the knowledge gap of thefarmers, a training on ‘Farmersparticipatory seed productiontechniques in rabi pulses’ underthe aegis of Mega Seed Projectwas organized on December 17,2015 for 100 farmers of Fatehpurdistrict of Uttar Pradesh.Technological aspects viz.,suitable varieties for differentagroclimatic regions,production, protection andvarious field and seed standardsrequired in quality seed production werecovered with practical orientations

along with seed storage andregistration for quality seed withcertification agency. Field visit was

organized to show the seed productiontechniques and relevant literature wasalso given to the farmers.

New VarietiesIPM 410-3: This mungbean varietydeveloped from the cross IPM 3-1 xNM1 has been identified for springcultivation in Punjab, Haryana, westernU.P., Delhi, northern Rajasthan,Himachal Pradesh and Uttarakhand in

Research Highlights

Three novel A-lines (Pusa 992A,ICP 88039A and DPP 3-2A) weredeveloped using GT 288A as donor

possessing A2 cytoplasm (A2: Cajanusscarabaeoides). Completely sterilenature of these three l ines wasev idenced by various stainingtechniques including acetocarmine,triphenyl tetrazolium chloride (TTC) andiodine-potassium iodide along withvisual inspection of the anther/pollenload. The stained pollen grainsrepresented fertile pollen grains, whilethe pollen grains from male sterile linesremained unstained/poorly stained.Further, these lines were crossed withpotential restorers and five early

maturing genotypes viz., AL 15, ICPL7148, AL 201, Pusa 2002-2 and MN 5to test the availability of a definitive

restoration system for these lines. Fewpotential restorers failed to impartfertility (like 261354 R), while othersshowed adequate fertility restoration(>95%: 261322 R and 250189 R). Bycontrast, no fertile plant was observedin F1 progenies derived from the cross‘A-line × variety’. At the same time, thelater can be considered as promisingcandidates for developing new A-lines.

Abhishek Bohra, Rintu Jha, I.P.Singh, P.S. Basu, S.K. Chaturvedi

and N.P. Singh

Novel A-Lines in CGMS Breeding in Pigeonpea

NWPZ and M.P., Chhattisgarh,Maharashtra and southern Rajasthanin CZ. It has given average yield of 1197kg/ha in NWPZ and 1171 kg/ha in CZ.

SML 1115 : This summer mungbeanvariety developed from the cross SML134 x SML 715 has been identified forcultivation in Tripura, Manipur andMizoram. It has given average yield of1105 kg/ha.


One F2 population (Type 7×ICP8863) was preliminarily screened forreaction against Fusarium wilt (F. udumvariant 2). Out of 200 individualsscreened, 140 manifested susceptiblereaction, whereas 60 plants showedresistance against the pathogen. Chi-square analysis (2 value: 2.66; df=1)supports the view that pigeonpeasusceptibility to Fusarium wil t isdominant monogenic in nature.Besides, F1s derived from crosses viz.,Bahar × IPA 8F, Bahar × KPL 44 andBahar × KPL 43 have been grown thisyear to generate additional F2

populations for mapping purpose.

Genomic DNA was extracted from

parents (Bahar, IPA 8F, KPL 44, KPL43) and their F1s. A set of 100 SSRmarkers was screened for poly-morphism among these parentalgenotypes. Nine SSR markers viz.,AHSSR 59, AHSSR 67, AHSSR 86,AHSSR 134, AHSSR 153, AHSSR 156,AHSSR160, AHSSR 164 and AHSSR165 provided polymorphic ampliconsbetween the mapping parents.

In parallel, attempts are being

made to map fertility restoration locus(Rf) that contributes to rescue A2 CMSin pigeonpea. To serve the purpose, anF2 mapping population (PA 163 A ×261322 R) is being analyzed withpolymorphic SSR markers.

Abhishek Bohra, R.K. Mishra,Prem Kumar A., P.G. Patil,

Shalini, K.R. Soren, F. Singh,S.K. Chaturvedi and N.P. Singh

Maping Gene(s)/QTL(s) for Fertility Restoration and Wilt

SSR screening of the parental genotypes

Iron Deficiency in FieldpeaAn experiment conducted at

ICAR-IIPR (Sandy loam, Inceptisol),showed iron chlorosis (in young leaves)of some segregants in F2 population ofthe cross IPF 13-14 x EC 502159. Feanalysis of affected leaves showed 68.4mg/kg, which isbelow the criticallimit (76 mg/kg)at 25 days aftersowing. Contraryto this, Fecontent in others e g r e g a n t shaving no chlorosis, varied from 126.8-138.6 mg/kg. The results indicated theneed of investigation to know the exactmechanism of iron chlorosis that couldbe useful in development of tolerantcultivars. At the initial stage, theproductivity of fieldpea could be improvedeither through ameliorating high pH orapplication of iron containing fertilizers,but its management at a later stage maynot be economically feasible.

A.K.Parihar, G.P.Dixit,S.K.Chaturvedi and Ummed Singh

Loop mediated IsothermalAmplif ication (LAMP) assaywas standardized for detection ofBt gene in transgenic pigeonpealines. Target gene could be amplifiedat 55°C using primers developedfrom 6 distinct regions of the targetgene. Amplif icated product isdetermined by using photometry.Photometry based detection workson changes in turbidity causedby increasing quantity ofmagnesium pyrophosphate precipitatein solution as a by product ofamplification. The optimized rapidLAMP protocol, less sensitive to PCRinhibitors, can be routinely used fortransgene detection, avoiding long end-point PCR.

LAMP Assay for Detection of Transgene

Shallu Thakur, Alok Das and N.P. Singh

Standardization of LAMP assay intransgenic pigeonpea lines

M: 1Kb plus ladder; NC: Negative Control;WT: Wild Type; NTC: No Template Control;PC: Positive Control; TP1& TP2: T6Transgenic pigeonpea lines


Genome wide identification andstructural comparison of members ofthe MADS (MCM1, AG, DEFAand SRF) transcription factor family ofchickpea was studied. MADS box TFare involved in f lower and poddevelopment. Sixty chickpea MADSgenes were detected across 8chromosomes, which were classifiedinto 24 type II (MIKC) and 36 typeI MADS-box genes according to theirphylogenetic relationships to theArabidopsis and rice MADS-boxgenes. Detailed gene structure andmotif distribution were then studied.Interestingly, three chickpea MADStype I genes denoted as Ca_01572,Ca_16376 and Ca_18082 resembled

MADS type II in possessing multipleintrons although lacked K domain, acharacteristic of MADS type II genes.In addition, chickpea MADS type Igene: Ca_14956, distinctly possessedtwo introns of 7kb and 13 kb long, whencompared to the other chickpea MADStype I genes. In addition, one pair of

MIKC MADS-box genes,Ca_03887 andCa_13111 were found on syntenyblocks derived from whole genomeduplication blocks.

Aravind Kumar Konda,Shanmugavadivel P.S., N.P.Singh

and K.R. Soren

MADS Box Genes in Chickpea

Free RadicalScavenging Activity of

Chickpea CultivarsFree radical scavenging activity of

chickpea seed extracts determined bythe DPPH (1, 1-diphenyl-2-picryl-hydrazyl) using 22 genotypes viz., ICC637, ICC4567, ICC 1205, ICC 456, ICC7441, ICC 11944, ICC 5912, ICC15614,ICC 12155, ICC 8950, ICC 6306, ICC10685, PG 5, C 235, BG 256, Pant G114, GNG 1958, JG 11, JG 14, JG 16,KWR 108 and Awrodhi indicatedgenotypic variations. The highest value(65.21%) was found in KWR 108,whereas it was lowest in ICC 10685(20.28%).

Profile Hidden Markov Model in ChickpeaProfile Hidden Markov Model

(HMM) is a dynamic statistical profilebeing used as query sequence foridentification of a group of remotelyhomologous proteins or transcriptionfactors (TF), which generally share acommon domain. The computationalmethodologies required for generatinga HMM profile has been standardizedin the laboratory. A HMM profile wasgenerated for WRKY transcriptionfactors that possess a conservedamino acid sequence : Trp(W)-Arg (R)-Lys (K)- Tyr(Y) in their DNA bindingdomain. Multiple sequence alignmentof 73 Arabidopsis WRKY TFs andother reported WRKY TFs wereconverted into a position-specificscoring system (PPSM) resulting inprofile sequence which is further usedas an input/query sequence forgenome wide identification of the TF inchickpea. This computationalmethodology can be used forgenerating HMM profiles for any givenprotein families in pulse crops. Itsapplications include genome wide

identification of trypsin inhibitors,lectins, R genes and transcriptionfactors etc.

HMM profile of WRKY TF< GYRWRKYGQKPVKGSPY-

PRSYYRCTSPGGCPVRKQVER-SADDPSVVITTYEGEHNHPLPT>

Aravind Kumar Konda,Shanmugavadivel P.S.,

N.P.Singh and K.R. Soren

Phylogenetic analysis of MADS type I proteinsof chickpea, Arabidopsis and rice

Phylogenetic analysis of MADS type II (MIKC)proteins of chickpea, Arabidopsis and rice

Nand Lal Meena, Jagdish Singh andRajni Kanaujia

Scavenging effect of chickpea seed extracts


Powdery Mildew inCluster Bean/GuarFusarium wilt, bacterial blight,

powdery mildew and anthracnose aremajor diseases affecting cluster bean(Guar) crop. Among them powderymildew is one of the important yieldlimiting factors. At IIPR research farm,

a white talcum-like powdery growthwas seen on the upper surface of leavesincluding stem and pods duringOctober-November, 2015. Infectedleaves gradually curl downward, paleyellow or brown, often leading todefoliation. Based on symptomatologyand microscopic observation, thecausal organisms was identified asErysiphe polygoni (Vanha) Weltzien.Conidia are hyaline, borne singly onconidiophore with hyphae attached onhost surface. Fungus grows well inenvironments with high humidity andmoderate temperatures.

R.K.Mishra and Naimuddin

Pre-harvest sprouting (PHS)known to cause deterioration in seed/grain quality of mungbean has emergedas major problem in short durationmungbean varieties cultivated duringkharif or latesummer season.Total 176 mungbeang e n o t y p e sscreened inlaboratory for PHStolerance showed awide variationamong them.Popular varieties like Meha, IPM 2-14and IPM 2-3 showed maximum podloss due to PHS (Germination of seedsin pods upto 82.51%). However, sixgenotypes viz., CHAMU-4, DOPOLE,

IC-52061, CHAMAH-1, BGG-1 andPusa Ratna showed less than10 % seed germination in pods andwere identif ied as PHS tolerant.Physical dormancy in fresh seeds

imparts tolerance to PHS in thesegenotypes.

Amrit Lamichaney, P.K. Katiyar, S.K.Chaturvedi and Vijay Laxmi

Pre-harvest Sprouting Tolerance in Mungbean

Seed germination in pods of IPM 2-3 (A) and CHAMU 4 (B)

Performance of Chickpea under Rice FallowThree rice establishment

methods viz. puddled transplanting(PTR), unpuddled transplanting (UPR)and direct seeded (DSR) were used tosee their effect on soil moisture, yieldand growth of chickpea under ricefallows rainfed condition. At the time ofchickpea sowing surface soil moisturecontent (SMC) varied between 18.4 to

20.0 %. Significantly higher SMC wasrecorded under chickpea sown afterUPR at 30 cm soil depth, followed byDSR over PTR. The SMC trend wasUPR>DSR>PTR. It was found thatdifferent rice establishment methodsaffect root and shoot growth ofchickpea. Under UPR, 46.9 and 63.6

per cent higher shoot dry weight wasobserved at f lowering and poddevelopment stages in comparison toPTR. Similarly, higher root dry weightand root nodule count were observedin chickpea sown under UPR over PTR.Chickpea sown after UPR producedsignificantly higher yield (23.9%) overPTR. However, chickpea yield sown

after DSR was 16.9 % higher incomparison to chickpea sown afterPTR.

Narendra Kumar, S.S. Singh,C.S. Praharaj, Arti Yadav, S.L. Yadav

and Saumya Singh

Direct seeded Unpuddled PuddledEffect of rice establishment methods on chickpea

Figure 1 (a) While powdery mass onleaves (b) conidia of the pathogen

a

b


Enhancing RUE inLentil

Moisture stress during cropgrowth limits the productivity of pulsesgrown in rice fallows. For enhancingresource use efficiency (RUE) throughconservation agricultural practices intransplanted rice-lentil relay croppingsystem, rice establishment methodssuch as unpuddled rice can be usefulover puddled condition. With 36-38%soil moisture retained in soil profile, thestorage moisture could be possiblycarried away for longer duration in bothlentil cultivars (high biomass with 120days duration for B-77 or Asha andmedium biomass with 100 days for PL

6). Moisture storage period couldfurther be expanded with effectivestrategies by involving minimumrationing with rice habit group such asIET 4786 and herbicides spray suchas quizalofop ethyl @ 80-100 g/hadepending on soil /crop/sproutcondition. Again the terminal moisturestress could possibly be mitigated byvigorously growing roots of pulsesfollowing extended soil moistureavailability at initial stages (under relaysystem) or application ofsupplementary irrigation (throughsprinklers). Because of optimum soilmoisture for better part of life cycle ofpulses following relay cropping, soilmoisture and microbial populationdynamics are favoured in such asystem over non-cropped rice fallows.

P.K. Bandyopadhyay*, C.S. Praharaj,S.S. Singh and N. Kumar

*Professor, BCKV, Kalyani (W.B.)

Most popular varieties/hybridsof pigeonpea grow 3.5 meter inheight and it isdifficult to followrequired plantp r o t e c t i o nmeasures tomanage diseaseand insect pestsinfestation in thef ield. Thereforep i g e o n p e abreeding has focused its effortstowards reducing the plant height atIIPR. For this purpose, Dholi dwarfwhich is known for its dwarf stature(92.25 cm) and compact growth habitwas used as one of the parents incrossing with popular cultivars viz.,Bahar, NA 1, T 7, BDN 1 and Kudrat 3and promising donors viz., IPA 8F, IPA

9F, IPA 15F and IPA 16F havingresistance/tolerance to multiple stress.

This led to identification of genotypeIPA 15-9 (Plant height of 1.80 meter)as the best plant type for targetedobjective.

Satheesh Naik S.J., Farindra Singh,Abhishek Bohra, Amrendra Pratap

Singh, Praveen Pandey, R.K. Mishra,S.K. Chaturvedi and I.P. Singh

Breeding for Short Stature and High Yield inPigeonpea

A pot experiment offoliar fertilization of zincoxide @ 0.6% wasconducted at pre-floweringstage for better zincconcentration in urdbeanand mungbean grains ascompared with othermethods of zinc applicationviz., seed priming, seedcoating, soil application andcontrol. Foliar fertilizationrecorded faster absorptionof Zn by leaf epidermis andtransportation to other plant parts viaxylem and phloem. Therefore, foliarspray of Zn could serve as a nobleapproach under ferti-fortification that

Zinc Ferti-fortification in Urdbean andMungbean

could mitigate deficiency of zinc ingrains partially.

Ummed Singh, C.S. Praharaj,S.S. Singh, Lalit Kumar and

P.S. Basu

Effect of foliar applied zinc in mungbean(L) andurdbean(R)

Lentil crop in puddled (left) vis-a-visunpuddled transplanted rice (right)

Dholi dwarf and IPA 15-9 grown side by side


Spodoptera Exigua inWestern Maharashtra

An experiment was laid out to seethe impact of different sowing dates onpest population infestation on chickpeaat Pulses Improvement Project,Mahatma Phule Krishi Vidyapeeth,Rahuri. During experimental period, itwas observed that Spodoptera exiguainfested the crop at first 30 days aftersowing. Maximum larval population(8.48 larvae/MRL) was recorded onchickpea grown on 15th September.Lowest incidence was recorded in cropsown on 15th December (0.00 larvae/MRL), followed by 16th November (0.25

larvae/MRL), 30th November (0.27larvae/MRL), 31st October (0.53 larvae/MRL) and 30 December (0.56 larvae/MRL) sown crop.

A.P. Chavan, C.J. Sonawane,G.P. Deshmukh, M.R. Bedis and

L. B. Mhase,Pulses Improvement Project,

MPKV, Rahuri (MS)

Based on the studies of nine majorpulses mandis of Uttar Pradesh,comparison of major markets wasmade. It has been found that Kanpuris the largest pulse-mandi in terms ofarrival being near to the pulsesproducing zone and better infrastructureavailability. For all five pulses viz., urd,mung, chickpea, pigeonpea and lentil,Kanpur mandi has the highest arrivalper month, which indicates that Kanpuracts as a centre or hub for pulsesmarket to which all other mandis actas a networking link and Kanpur mandican be selected as a reference for price,market behaviour and forecasting themarket behaviour with respect to

pulses. The Jhansi mandi located inthe bundelkhand region, also standsapart with second rank with respect toall five pulses in terms of arrival.Important policy decisions can be madeby watching price behaviour of pulsesin Kanpur and Jhansi mandi for theNorthern part of India. Allahabad mandistands at third number with respect tochickpea, while Lalitpur with regard tourd, mung, pigeonpea and lentil. Urdand mung arrival patterns are quite highin Lucknow mandi.

Deepak Singh,Devraj Mishra, RajeshKumar, S.K. Singh and N.P. Singh

Status of Major Pulses Market in Uttar Pradesh

t ; fdl ku t ; foKku dk; ZØe euk; k x; k

Transfer of Technology

Hkkj rh; nygu vuql a/kkul aLFkku esa fnuk¡d 29 fnl Ecj ]2015 dks t ; fdl ku t ; foKkudk;ZØe euk; k x; kA bl vol ji j p-' ks-vk- df"k ,oa i zkS| ksfxdhfo' ofo| ky; ] dkui qj vkSj ck¡nkdf"k ,oa i zkS| ksfxdh fo' ofo| ky; ]ck¡nk ds dqyi fr Mk- l qjsUnz ykyxksLokeh eq[ ; vfrfFk FksA nhii zTt oyu ds i ' pkr l aLFkku dsfuns' kd Mk- ujsUnz i zrki fl ag usvfrfFk; ksa ,oa l Hkkxkj esa mi fLFkrl Hkh dk Lokxr fd; kA vi us mn~cks/ku esaMk- xksLokeh us oSKkfud ' kks/kksa dk Hkj i wjykHk fdl kuksa rd i gq¡pkus dk vkg~okgufd; kA mUgksaus l ykg nh fd fdl kuksa dhl gHkkfxrk ds l kFk ,sl s dk;ZØe pyk; s t k; sft uds ' kks/k i fj .kke fdl kuksa ds [ksr esa Hkhfn[kkbZ nsaaA mUgksusa OkSKkfudks dk vkg~okgufd; k fd bl ds fy, fe’ku cuk dj fdl kuksads fgr esa dk;Z fd; k t k; sA

l aLFkku ds funs' kd Mk- fl ag us cnyrst yok;q i fj n' ; ] i ; kZoj .k i znw"k.k rFkk [ksrhi j bl ds nq"i zHkko i j fpUrk O;Dr dj rsgq, LoLFk i ; kZoj .k i j t ksj fn; k vkSjmoZjdks ds l Urqfyr mi ; ksx dh l ykg nhAMk- fl ag us l aLFkku dh fofHkUu xfrfof/k; ksavkSj mi yfC/k; ksa i j i zdk' k MkykA mUgksausdgk fd vUrjkZ"Vªh; l aLFkkuksa ,oa j k"Vªh;dk;ZØeksa ds vUrxZr nyguksa i j py jgh


fofHkUu i fj ; kst uk; sa vR;Ur ykHki zn jgh gSavkSj mul s mUur i zt kfr; ksa] rduhdh rFkkekuo l al k/ku fodkl esa l Qyrk feyh gSAmUgksusa dgk fd bu l Hkh mi yfC/k; ksa dkykHk fdl kuksa dks fey jgk gS] ft l l s mudhvk; esaa of) gks jgh gS vkSj t ; fdl kut ; foKku dk fe' ku i wjk gks jgk gSA

dk;ZØe esa fdl ku&OkSKkfud l aokn dkHkh vk; ksft u fd; k x; kA bl esa fdl kuksa usvi uh [ksrh l aca/kh dfBukb;ksa ds ckjs esai z' u i w++Ns vkSj OkSKkfudksa us muds l ek/kkucrk; sA /kU;okn~ i zLrko Mk- l at ho xqIrk usi zLrqr fd; k rFkk dk;ZØe dk l apkyu Mk-vkfnR; i zrki us fd; kA

j ch nyguh Ql yksa dh mRi knu rduhdh i j d‘"kd i zf' k{k.k

fnuk¡d 4&5 fnl Ecj ] 2015 dks l aLFkkuesa t So i zkS| ksfxdh foHkkx] Hkkj r l j dkj}kj k foRri ksf"kr mRrj i zns' k ds nygud‘"kdksa dk l kekft d]vkfFkZd o rduhdhl ' kfDRkdj .k i fj ; kst uk*ds vUrxZr j ch nyguhQl yksa dh mRi knurduhdh i j nks fnol h;d‘"kd i zf' k{k.k dk;ZØedk vk; kst u fd; k x; kAbl i zf' k{k.k esa dkui qjnsgkr t ui n ds fl ygjk o l ysei qj xzkeksads 49 fdl kuksa us Hkkx fy; kA dk;ZØe dkmn?kkVu l aLFkku ds funs' kd Mk- ujsUnzi zrki fl ag }kjk fd; k x; kA mUgksus vi usmncks/ku esa d‘"kdksa dks i zf' k{k.k l s vf/kdkf/kdykHkkfUor gksus dh l ykg nh vkSj mUur

mRi knu rduhd ds i z; ksx i j cy fn; kA

dk;ZØe esa j ch nyguh Ql yksa t Sl s puk]

eVj o el wj dh l aLrqr i zt kfr; k¡] l L;

i zca/ku] j ksx o dhV i zca/ku rduhdh i j

fdl kuksa dks i zf' kf{kr fd; k x; kA i zfrHkkxh

fdl kuksa dks nygu i zl aLdj .k rduhd o

e‘nk i jh{k.k ds egRo i j Hkh i zf' kf{kr fd; k

x; kA dk;ZØe dk l eUo;u Mk- mek l kg

o Mk- i h-vkj - l kcys us fd; kA

j kT; Lr j h; i zf' k{k.k dk; ZØeksadk vk; kst u

l aLFkku esa 12&18 vDVwcj ,oa 27&31vDVwcj ] 2015 dks nks cSp essa nyguhQl yksa dh gkbZVsd mRi knu rduhd* i jj kT; Lrjh; i zf' k{k.k dk;ZØeksa dk vk; kst ufd; k x; kA nksuksa gh i zf' k{k.k dk;ZØeksa dkvk; kst u ,Vh,e, ; kst uk ds varxZr] df"kfuns' kky; ] j kT; df"k i zcU/ku dsUnz]jgeku[ksM+k] y[kuÅ }kjk i zk; ksft r fd; kx; kA i gys cSp esa dqy 35 i zfrHkkfx; ksa usHkkx fy; k ft l esa mi funs' kd] l ykgdkj ]Cykd Vhe eSust j ] fo"k; &fo' ks"kK rFkki zxfr' khy fdl kuksa ¼dkui qj l aHkkx½ us Hkkx

fy; kA 27-31 vDVwcj ] 2015 dks vk; ksft ri zf' k{k.k dk;ZØe esa fp=dwV /kke l aHkkx dsfofHkUu ft yksa l s i /kkjs 33 i zfrHkkfx; ksa usHkkx fy; kA Mk- ,u-i h- fl ag] funs' kd usi zkS| ksfxdh fodkl i j l a{ksi esa i zdk' k MkykvkSj i zfrHkkfx; ksa l s vkxzg fd; k fd osfVdkÅ [ksrh ,oa i ks"k.k l qj {kk dks /; ku esaj [krs gq, vi uh [ksrh esa nyguh Ql yksa dkl ekos' k djsaA i zf' k{k.k ds nkSjku] fo"k;fo' ks"kKksa us okrkZ vk/kkfj r fofHkUu fo"k; ksa i jO; k[ ; ku i zLrqr fd, t Sl s i zt krh; ] l L; h; ]dhV&j ksx , oa dVkbZ mi j kUr i zcU/kuAO;k[ ; kuksa esa O;kogkfjd Kku nsuk i zkFkfedrki j j gkA i zfrHkkfx; ksa dks l aLFkku ds eq[ ;,oa uohu ' kks/k i z{ks=ksa dk Hkze.k djk; k x; kAl kFk gh mUgsa l aLFkku }kjk fodfl r l kfgR;Hkh mi yC/k djk; k x; kA nksuksa gh i zf' k{k.kdk;ZØeksa dk l eUo;u Mk- l q' khy dqekjfl ag] i z/kku oSKkfud us fd; kA


l h, l hi h] ubZ fnYyh dh Vhedk l aLFkku Hkze.k

fnuk¡d 31 vDVwcj 2015 dks df"kykxr ,oa ewY; vk; ksx ¼l h, l hi h½ ds v/; {k]l nL; l fpo ,oa l nL; ksa us l aLFkku dkHkze.k fd; kA l aLFkku esa mDr fo"k; i jxgu ppkZ@okrkZyki fd; k x; kA Mk- ,u-i h- fl ag funs' kd us nyguh Ql yksa dhmUur i zkS| ksfxdh ,oa Hkkoh j .kuhfr i jvi us fopkj i zLrqr fd,A fofHkUu ekSl eksa esa

nyguksa dh vkod vkSj ykxr ,oa dheri j xgu fopkj&foe' kZ gqvkA l kFk gh U;wurel eFkZu ewY; ,oa nyguksa dh l jdkjh [kjhni j Hkh fo' ks"k ppkZ gqbZA l Hkh foHkkxk/; k{kksa,oa i fj ; kst uk l eUo;dksa us cSBd esa Hkkxfy; kA ny us l aLFkku esa vk; ksft r j kT;i zf' k{k.k dk;ZØe esa Hkh Hkkx fy; kA cqUnsy[k.Mds i zl kjdk;ZdrkZvksa ,oa d"kdksa us nygu dsmRi knu ,oa ml ds foi .ku l EcU/kh i gyqvksai j vi us vuqHko Vhe ds l nL; ksa ds l kFkl k>k fd,A

df"k foKku dsUnzksa ds l aosnhdj .k dk; ZØe@i zf' k{k.k dk vk; kst u

l aLFkku esa 18&19 uoEcj ] 2015 dksdf"k i zkS| ksfxdh vuqi z; ksx ' kks/k l aLFkku t ksuIV ¼,Vh,vkj vkbZ½ ,oa Hkkj rh; nygu

vuql a/kku l aLFkku] dkui qj }kjk l a;qDr : il s mDr i zf' k{k.k dk;ZØe dk vk; kst u fd; kx; k ft l dk eq[ ; mn~ns' ; Fkk ,u,Q, l ,eds varxZr pkyw l = ¼2015-16½ esa vfxzei afDr i znk'Zu ds ek/; e l s ubZ i zkS| ksfxdh,oa i zt kfr; ksa ds gLrkUrj .k dks l qxe cukukAdk;ZØe esa dqy 81 i zfrHkkfx;ksa ¼ofj - oSKkfudl g foHkkxk/; {k ,oa fo"k;&oLrq fo' ks"kK½ usl fØ; i zfrHkkfxrk dhA funs' kd] vVkjh usvfxze i afDr i zn' kZu dk;ZØeksa dh l eh{kkdhA Mk- ,u-i h- fl ag] funs' kd us orZekui fj n' ; i j vi us fopkj i zLrqr dj rs gq,

m-i z- ,oa mRrjk[k.M esa nygu mRi knu dhl EHkkoukvksa i j ppkZ dhA mUgksaus mRrexq.koRrk ds i zn' kZu yxkus i j fo' ks"k cy

fn; k ft l l s j kT; df"k foHkkx dks i zkS| ksfxdhdk mfpr ykHk fey l dsA i zf' k{k.k dsnkSjku] egRoi w.kZ fo"k; ksa t Sl s fd i zt krh; ]l L;h; i zcU/ku] j ksx dhV ,oa dVkbZ mi jkUri zcU/ku vkfn i j fo' ks"k t kudkjh mi yC/kdjkbZ xbZA bl ckr i j fo' ks"k cy fn; kx; k fd l eFkZ dsUnzksa }kjk ßl hM gcÞ cuk; kt k, ft l l s i al nhnk i zt kfr ; ksa dscht ksa dh mi yC/krk vkSj l qxe gks l dsA Mk-Å/ke fl ag xkSre] funs' kd] ,Vh,vkjvkbZ]t ksu IV us i zf' k{k.k dk;ZØe dk l eUo;ufd; kA

l aLFkku esa 07&11 fnl Ecj 2015 dksnyguh Ql yksa ds fy, mRi knu i zkS| ksfxdh*fo"k; i j i k¡p fnol h; i zf' k{k.k dk;ZØe dkvk; kst u fd; k x; kA mDr i zf' k{k.k dk;ZØedf"k i zkS| ksfxdh i zcU/ku , t sUl h] gt kjhckx]>kj [k.M }kjk i zk; ksft r fd; k x; k FkkA Mk-,u-i h- fl ag] funs' kd us d"kdksa dks ,du; k ukjk fn; k ßvf/kd nygu mxk;saÞAmUgksaus fdl kuksa dks l q>ko fn; k fd os fl afprvoLFkk esa vkyw] eVj ] l j l ksa] puk] xsgw¡vkfn dh dVkbZ ds mi jkUr xzh"e@cl Uresa vYi kof/k ew¡x cks,aA i k¡p fnol h; bl

dk;ZØe esa egRoi w.kZ fo"k;ksat Sl s i zt krh; ] l L; h; ]dhV&j ksx , oa dVkbZmi jkUr i zcU/ku i j fo'ks"kt ksj fn; k x; kA i zfrHkkxhd"kdksa dks l aLFkku ds eq[;,oa uohu' kks/k i z{ks= dkHkze.k djk; k x; kA blnkSj ku cht mRi knul EcU/kh t kudkjh fo' ks"k : i l s i znku dhxbZA i fj ; kst uk funs' kd] ,Vh,e, l fgrdqy 25 i zfrHkfx; ksa us bl dk;ZØe esa Hkkx

d"kd i zf' k{k.k dk; ZØe dk vk; kst u

fy; kA Mk- l q' khy dqekj ] i z/kku oSKkfud usbl dk;ZØe dk l eUo;u fd; kA


PersonnelPromotions

Transfers

Retirement

ObituaryMr. Ranjan Kumar Srivastav, Sr. Technical Officer, left for his heavenly abode

on 7.11.2015. May his soul Rest in Peace.

d"kdksa dk i z{ks= Hkze.k

Awards

Dr. M.R. Bedis, Principal Scientist,Pulses Improvement Project,MPKV, Rahuri has been awardedwith Dr. Punjabrao DeshmukhPrerana “Krishiratna” award for hisspecial contribution in agriculturalresearch especially in chickpea,pigeonpea, maize, niger, medicinaland aromatic plants and grasses.The award was given by Shri UjjwaljiNikam, Advocate and Prof. SanjayJadhav, Chairman, Jaikisan AgroForum, Nashik on 27.12.2015 atJalgaon, Maharashtra.

Dr. P.R. Saabale and Dr. R.K.Mishrawere awarded First and Secondprizes, respectively for their postersof research papers entit led‘Sources of resistance for wilt anddry root rot in elite breeding lines ofchickpea’ authored by P.R.Saabale, O.P.Sharma, R.K.Mishra,Naimuddin, A.K. Srivastava andS.K.Chaturvedi, and ‘Biocontrolpotential of native Trichodermaspecies against wilt of major pulses’authored by R.K. Mishra,Naimuddin, P.R. Saabale and OmitaMishra, presented in the zonalmeeting of Indian phytopathologicalsociety cum National Symposiumon ‘Impact of climate change onplant-microbe interaction and itsimplications, held at Banaras HinduUniversity, Varanasi on December18 - 19, 2015.

Name Designation From To Date

Dr. S. Paulraj Scientist

ICAR--IIPR, Kanpur

ICAR-CPCRI, Kasaragod

21.12.2015

Dr. Neetu Singh Kushwah

Scientist

ICAR—NRC on Litchi, Muzaffarpur

ICAR--IIPR, Kanpur

26.12.2015

Name Post held Date of retirement

Mr. K.N. Gupta Sr. Finance & Accounts Officer 31.10.2015

Mrs. A. Abraham Asstt. Administrative Officer 30.11.2015

Name Promoted to w.e.f.

Dr. M. Senthil Kumar Sr. Scientist 3.1.2014

Dr. Rajesh Kumar Srivastav Sr. Technical Officer (T-6) 23.6.2015

Mr. Rajendra Prasad Sr. Technical Officer (T-6) 1.1.2015

fnukad i zfrHkkfx; ksa dh l a[ ; k ft yk i zns' k 03/11/2015 09 Vhdex<+ e/; i zns' k 03/11/2015 50 f' kouh e/; i zns' k 20/11/2015 06 fHk.M e/; i zns' k 23/11/2015 19 fl ) kFkZ uxj mRrj i zns'k 17/12/2015 14 t cyi qj e/; i zns' k 17/12/2015 17 Qrsgi qj mRrj i zns'k 18/12/2015 28 t cyi qj e/; i zns' k


Published by Dr. N.P. Singh, Director, Indian Institute of Pulses Research, Kanpur-208 024Tel. : 0512-2570264; EPBAX Lines : 0512- 2572464, 2572465; Fax : 0512-2572582

E-mail : [email protected] ; [email protected]; Website; http://www.iipr.res.in

Printed at Army Printing Press, 33, Nehru Road, Sadar Cantt. Lucknow-226 002. Tel. : 0522-2481164, 6565333

Director’s DeskDear Readers,

Seasons greetings and wish youall a very happy 2016.

Seed is the basic and most criticalinput for sustainable crop production.Response of all other inputs dependupon quality of seeds to a large extent. Itis estimated that direct contribution ofquality seed of pulses alone to the totalproduction is about 15-20% varying fromcrop to crop and it can be increased upto45% with efficient management ofother inputs. The major driver of foodinflation during recent years was thehike in prices of pulses, which wascaused by crop loss due to untimelyrains during harvesting period. India'spulses production fell from 19.78million tonnes in 2013-14 to 17.3million tonnes in 2014-15, whileimports rose from 3.18 million tonnesto 4.58 million tonnes during thesame period. The urgency was sohigh that in an interaction with themedia in June this year, Hon'ble UnionAgriculture Minister said that the risein the price of pulses was a burningissue. Even the Prime Ministerexhorted the farmers to grow pulsesin one-fifth of their cultivable lands toovercome the shortage and make Indiaself-sufficient in this sector by 2022. Thiswill need adequate and timely supply ofquality seeds of these crops.

Even though seed production hasincreased three-fold in the past eightyears, still there is a shortage of qualityseeds of pulses in the country.Fortunately, there is tremendous scopeof increasing area under pulses.Between rabi and kharif seasons thereis a window of opportunity (March-June)to cultivate short-duration pulses. Indiahas about 11.6 million ha of rice fallowthat is left uncultivated after rabi rice, whichcan be used to grow pulses. However, topromote pulses in these areas, we needshort-duration and photo-thermoinsensit ive varieties. Further, thegovernment needs to make productionof pulses lucrative. Like rice and wheat,the government should procure pulses,not leaving farmers dependent on thevagaries of the market. Assured MSP andprocurement together will give a bigboost to pulses production. The procuredquantity can be distr ibuted throughpublic distribution system (PDS). Thegovernment should also think of

encouraging private players and contractfarming, and provide competitive marketsfor pulses. The market supply chain ofpulses is quite long and unorganizedinvolving farmers, small traders,commission agents, wholesale dealersand retailers before reaching theconsumers. In this entire process, theprofit margin of farmers shrinks. Apartfrom a long supply chain, import of pulsesneeds to be critically examined. When the

imports arrive Indian market inNovember-December, the market isalready flooded with pulses producedindigenously. This brings down their pricedrastically and ultimately the farmerssuffer. Therefore, the import of pulsesneeds to be planned in accordance withdomestic crop situation. Further,appropriate measures have to be takento stop farmers shifting to other crops.This is already happening in AndhraPradesh, where farmers growingchickpea have shifted to cotton farming.Shortage of quality seed continues to beone of the major constraints in spread ofnew and improved varieties/hybrids andrealizing their yield potential.

Seeds fetch a higher price thanunprocessed dals , but it requiresproducers to be diligent. This needsgreater attention from the public sectorbecause private companies are lit tleinterested in the production of seeds ofpulse crops owing to their self-pollinatingnature and also because farmers canreproduce them on their own. The IndianInstitute of Pulses Research, alongwith

ACIRP centres located in SAUs, is playingcrucial role in producing large quantitiesof breeder seeds. Nevertheless, theirconversion in commercial (certified) seedis a major issue to produce sufficientquantities to meet farmers' demand.Although we produced about 15,000quintals of breeder seed, which issufficient for developing quality seeds for24 million ha, but the subsequentconversion into foundation seed and

certified seed which goes to farmersis not happening. Production of seedis time consuming, cost intensive andrisky under rainfed conditions in whichpulses are grown. Seed productionthus requires advance planning on thepart of States taking important factorsinto account such as increase in areaunder crop, varietal replacementcontemplated, progressivereplacement of seed in case of self/open pollinated varieties, areaexpansion under hybrids andpromotion of the new varieties/hybrids.

To mitigate the pulse seedscarcity in the country, one vital anddoable approach is 'seed village'

concept. In this approach, farmersthemselves select a variety amongstrecommended ones for their area,according to their farm ecology.Subsequently, they grow the preferredvariety for seed production. This is donefollowing all the recommended practicesfor seed production under thesupervision of seed certif icationagencies and guidance of the researchinstitutes. With this 'seed village' concept,farmers get good quality seed locally.IIPR has taken a lead in this direction byforming seed producers societiesregistered with seed certif icationagencies. It is imperative that this isadopted in a large area or in a cluster ofvillages for large scale seed production,thereby fulfilling the needs of the wholedistrict and also the neighboring districts.If this 'seed village' concept is extendedthroughout the country, I am sure thatthere will be no shortage of quality seedof pulse crops and thereby our countrywill be self reliant in pulses.

(N.P. Singh)

VOLUME 26, No. 4 OCTOBER - DECEMBER, 2015 - iipr.icar.gov.in · Devendra Singh Bhole, Hon’ble...

Documents

Transcript of VOLUME 26, No. 4 OCTOBER - DECEMBER, 2015 - iipr.icar.gov.in · Devendra Singh Bhole, Hon’ble...