892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089 of 983090983090

SECOND EDITION

Touchstone Level 983090Common European Framework of Reference for Languages (CEFR)

Contents

Introduction to CEFR 983090

CEFR level 983091

CEFR goals realized in this level of Touchstone 983092

How each unit relates to the CEFR 983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 222

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090 of 983090

SECOND EDITION

Introduction to the Common European Framework of Reference (CEFR)

Touchstone Second Edition and the Common European Framework of ReferenceThe table below shows how Touchstone Second Edition correlates with the Council of Europersquos levels and with some majorinternational examinations

The overall aim of the Council of Europersquos CommonEuropean Framework of Reference (CEFR) is to provideobjective criteria for describing and assessing language

proficiency in an internationally comparable manner TheCouncil of Europersquos work on the definition of appropriatelearning objectives for adult language learners datesback to the 983089983097983095983088s The influential Threshold series(J A van Ek and J L M Trim Cambridge UniversityPress 983089983097983097983089) provides a detailed description infunctional notional grammatical and socioculturalterms of what a language user needs to be able to do inorder to communicate effectively in the sort of situationscommonly encountered in everyday life Three levels ofproficiency are identified called Waystage Threshold

and Vantage (roughly corresponding to ElementaryIntermediate and Upper Intermediate)

The Threshold series was followed in 983090983088983088983089 by thepublication of the Common European Framework ofReference which describes six levels of communicativeability in terms of competences or ldquocan dordquo statementsA983089 (Breakthrough) A983090 (Waystage) B983089 (Threshold)B983090 (Vantage) C983089 (Effective Operational Proficiency) andC983090 (Mastery) Based on the CEFR descriptors theCouncil of Europe also developed the EuropeanLanguage Portfolio a document that enables learnersto assess their language ability and to keep aninternationally recognized record of their languagelearning experience

Sources httpwwwcambridgeenglishorgabout-uswhat-we-dointernational-language-standardshttpwwwetsorgMediaResearchpdfCEF_Mapping_Study_Interim_Report pdfhttpwwwsprachenmarktdefileadminsprachenmarktets_imagesTOEIC_Can-do-table_CEFR _983090983088983088983096pdf

CEFRCouncil of

EuropeCambridge English

Language AssessmentIELTS TOEFL iBT TOEIC

Touchstone 983089

Touchstone 983090

Touchstone 983091

Touchstone 983092

Viewpoint 983089

Viewpoint 983090

A983089 Breakthrough 983089983090983088+

A983090 Waystage 983090983090983093+

B983089 Threshold KET (Key English Test) 983092983088ndash983093983088 983093983095ndash983096983094 983093983093983088+

PET (Preliminary English Test)

B983090 Vantage FCE (First Certificate inEnglish)

983093983093ndash983094983093 983096983095ndash983089983088983097 983095983096983093+

C983089 EffectiveOperational

Efficiency

CAE (Certificate inAdvanced English)

983095983088ndash983096983088 983089983089983088ndash983089983090983088 983092983097983088+ (Listening)983092983092983093+ (Reading)

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 322

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983091 of 983090

SECOND EDITION

CEFR Level

Touchstone Second Edition Level 983090 covers level A983090 of the CEFR This tabledescribes the general degree of skill achieved by learners at this level

Skill Learners will be able to

Listening bull understand phrases and very high frequency vocabulary related to areasof the most immediate personal relevance (eg basic personal and familyinformation shopping local geography and employment)

bull catch the main point in short clear simple messages and announcements

Reading bull read short simple texts including short simple personal letters and emails

bull find specific predictable information in simple everyday material such asadvertisements catalogs menus and timetables

Speaking bull communicate about basic and routine tasks that require a simple and directexchange of information on familiar topics and activities

bull handle very short social exchanges

bull use a series of phrases and sentences to describe in simple terms their familyand other people living conditions their educational background and theirpresent or most recent job

Writing bull write short simple notes messages and emails relating to matters in areas ofimmediate need

bull write a simple personal letter for example thanking someone for something

Communicativelanguagecompetence

bull use basic sentence patterns and phrases groups of a few words and formulaein order to communicate limited information in everyday situations

bull use some simple grammatical structures correctly

bull speak with clear enough pronunciation to be understood

bull perform and respond to basic language functions such as informationexchange requests and invitations and express opinions and attitudes in asimple way

bull socialize simply but effectively using common expressions and using everydaypolite forms of greeting and address

Communicationstrategies

bull initiate maintain and close simple conversations guess some unknown wordsfrom context in simple short texts and utterances and ask for clarification orrepetition

bull indicate when they are following a conversation

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 422

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983092 of 983090

SECOND EDITION

CEFR goals realized in this level of Touchstone

Listening

At A983090 learners can understand speech that

is clearly and slowly articulated

concerns predictable everyday matters

OVERALL LISTENING COMPREHENSIONCan understand phrases and expressions related to very familiar topics (eg basic personal and family information shopping local geographyand employment)

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983092 p983091 B983091 p983089983093 A983089 p983090983090 A983089 p983091983092 A983089 p983092983092 A983091 p983093983093 A983089 p983094983094 A983089 p983095983094 A983089 p983096983094 A983089 p983097983096 A983089 p983089983088983096 A983089 p983089983089983096B983089 p983092 C983089 p983089983094 A983091 p983090983091 B983090 p983091983095 B983089 p983092983094 B983089 p983093983094 B983090 p983094983097 B983090 p983095983097 A983091 p983096983095 B983089 p983089983088983088 B983090 p983089983089983089 B983089 p983089983090983089C983091 p983095 C983091 p983089983095 B983091 p983090983093 C983091 p983091983097 C983091 p983092983097 B983091 p983093983095 C983089 p983095983088 C983089 p983096983088 B983090 p983096983097 B983090 p983089983088983089 C983089 p983089983089983090 C983089 p983089983090983090

D983090 p983090983097 D983090 p983092983089 D983090 p983093983089 C983089 p983093983096 C983090 p983095983089 C983090 p983096983089 C983089 p983097983088 C983089 p983089983088983090 C983091 p983089983089983091 C983091 p983089983090983091C983091 p983093983097 C983091 p983095983089 D983090 p983096983091 C983090 p983097983089 C983090 p983089983088983091 D983090 p983089983089983093 D983090 p983089983090983093

D983090 p983095983091 C983091 p983097983089 C983091 p983089983088983091D983090 p983097983091 D983090 p983089983088983093

UNDERSTANDING INTERACTIONCan generally identify the topic of discussion around them as log as it is conducted slowly and clearly

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 D983090 p983089983097 A983091 p983090983091 B983090 p983094983097 C983091 p983096983089 B983090 p983096983097 B983089 p983089983088983088 A983089 p983089983088983096 B983090 p983089983090983089C983091 p983095 C983089 p983095983088 C983089 p983089983088983089 B983090 p983089983089983089 C983089 p983089983090983090

C983091 p983089983088983091 C983089 p983089983089983090 C983091 p983089983090983091C983091 p983089983089983091 D983090 p983089983090983093D983090 p983089983089983093

LISTENING TO ANNOUNCEMENTS amp INSTRUCTIONSCan catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get from X to Y by foot or public transport

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983093983093 C983091 p983089983090983091B983090 p983093983095B983091 p983093983095

LISTENING TO MEDIA amp RECORDINGSCan understand and extract the essential information from short recorded passagesCan identify the main point of TV news items reporting events accidents etc where the visual supports the commentary

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983089 p983089983090 A983089 p983090983090 D983090 p983095983091

Reading

At A983090 learners can understand short simple texts on familiar topics which use high frequency vocabulary

READING CORRESPONDENCECan understand basic types of standard routine letters emails short simple personal letters etc

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983089 p983089983096 D983091 p983090983097 D983090 p983095983091 D983089 p983096983088

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983093 of 983090

SECOND EDITION

READING FOR ORIENTATIONCan find specific predictable information in simple everyday material such as advertisements websites catalogs menus reference lists and timetablesCan understand everyday signs and notices in public places

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983089 p983094983088 D983089 p983095983088D983091 p983094983089

READING FOR INFORMATION amp ARGUMENTCan identify specific information in simple written material such as letters brochures and short newspaper or online articles

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983089 p983096 D983089 p983089983096 D983089 p983090983096 D983089 p983092983088 D983089 p983093983088 D983089 p983094983088 D983089 p983095983088 D983089 p983096983088 D983089 p983097983090 D983089 p983089983088983092 D983089 p983089983089983092 D983089 p983089983090983092

D983091 p983090983097 D983091 p983097983091 D983091 p983089983088983093

Speaking

Overall spoken interactionAt A983090 learners can manage simple routine exchanges fairly easily but struggle with extended conversations andoften need help with understanding They can

ask and answer questions and exchange ideas and information on familiar topics in predictable everyday situations

handle very short social exchanges and simple transactions mostly understand speech in a standard accent directed at them which is delivered slowly and clearly provided they can

ask for repetition or reformulation from time to time

CONVERSATIONCan use simple everyday polite forms of g reeting address farewell introduction and giving thanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983089 p983090 C983089 p983089983094 C983089 p983090983094 C983089 p983091983096 C983089 p983092983096 C983089 p983093983096 A983090 p983094983095 C983089 p983096983088 B983091 p983096983097 A983091 p983097983097 A983090 p983089983088983097 A983091 p983089983089983097C983089 p983094 C983090 p983089983095 C983090 p983090983095 C983090 p983091983097 C983090 p983092983097 C983090 p983093983097 C983089 p983095983088 C983090 p983096983089 C983089 p983097983088 B983089 p983089983088983088 C983089 p983089983089983090 C983089 p983089983090983090C983090 p983095 C983091 p983089983095 C983091 p983090983095 C983090 p983095983089 C983091 p983096983089 C983090 p983097983089 C983089 p983089983088983090 C983090 p983089983089983091 C983090 p983089983090983091C983091 p983095 D983091 p983096983091 C983091 p983097983089 C983090 p983089983088983091 C983091 p983089983089983091

C983091 p983089983088983091

INFORMAL DISCUSSION (WITH FRIENDS)Can participate in a discussion about everyday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983091 p983097 B983090 p983089983092 A983091 p983090983091 D983089 p983092983089 A983091 p983094983095 A983090 p983097983097 D983089 p983089983090983093

C983091 p983089983095 C983091 p983090983095 B983091 p983094983097 B983091 p983089983088983089 D983090 p983089983090983093D983089 p983090983096 C983089 p983095983088 D983090 p983089983088983093

C983091 p983095983089 D983091 p983089983088983093

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983094 of 983090

SECOND EDITION

GOAL-ORIENTED COOPERATION (EG REPAIRING A CAR DISCUSSING A DOCUMENT OR ORGANIZING

AN EVENT)Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do next

bull making and responding to suggestionsbull asking for and giving directions

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983093983093 B983091 p983094983097 C983089 p983096983088 C983091 p983089983090983091B983090 p983093983095 C983089 p983095983088 C983090 p983096983089B983091 p983093983095 C983091 p983095983089

TRANSACTIONS TO OBTAIN GOODS amp SERVICESCan deal with common aspects of everyday living such as travel ndash tourist information public transport and accommodation shopping buying tickets andsimple transactions in shops post offices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the priceCan order a meal

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983091 p983093983097

INFORMATION EXCHANGECan ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange of informationCan exchange limited information on familiar and routine operational matters

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983090 A983091 p983089983091 A983089 p983090983090 A983090 p983091983093 A983090 p983092983093 A983089 p983093983092 A983090 p983094983095 A983091 p983095983095 B983089 p983096983096 C983091 p983089983088983091 A983091 p983089983088983097 A983089 p983089983089983097A983091 p983091 B983090 p983089983092 A983090 p983090983091 A983091 p983091983093 A983091 p983092983093 A983090 p983093983093 C983089 p983095983088 D983091 p983096983091 B983091 p983096983097 B983091 p983089983089983089 B983091 p983089983090983089A983092 p983091 D983090 p983089983097 A983091 p983090983091 B983089 p983091983094 B983092 p983092983095 B983090 p983093983095 D983091 p983089983089983093 C983089 p983089983090983090B983090 p983092 B983092 p983090983093 B983091 p983091983095 C983090 p983092983097 B983091 p983093983095

C983089 p983090983094 C983089 p983091983096 C983091 p983092983097 C983091 p983093983097C983090 p983091983097 D983091 p983093983089C983091 p983091983097

INTERVIEWING AND BEING INTERVIEWEDCan answer simple questions and respond to simple statements in an interview

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983089 p983090 A983090 p983089983091 B983092 p983092983095

A983091 p983089983091 D983089 p983093983089D983091 p983093983089

Overall spoken productionAt A983090 learners can give simple descriptions or presentations about everyday things as a short series of simplephrases and sentences linked into a list

SUSTAINED MONOLOGUE DESCRIBING EXPERIENCECan tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal ex periencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects and possessionsCan explain what they like or dislike about something

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090B983091 p983093 A983091 p983089983091 B983092 p983090983093 B983092 p983092983095 D983091 p983094983089 C983089 p983095983088 D983089 p983096983090 A983089 p983096983094

D983089 p983089983096 D983091 p983090983097 C983089 p983092983096 D983090 p983096983091 A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983095 of 983090

SECOND EDITION

Writing

Overall written production and interaction

At A983090 learners can write a series of simple phrases and sentences linked with simple connectors like and but and

because

OVERALL WRITTEN PRODUCTIONCan write short simple formulaic notes relating to matters in areas of immediate need

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983091 p983089983097 D983091 p983090983097 D983090 p983092983089

CORRESPONDENCECan write very simple personal letters emails etc

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983092983089 D983090 p983095983091

CREATIVE WRITINGCan write very short basic descriptions of events past activities and personal experiences

Can write a series of simple phrases and sentences about everyday andor personal matters (eg family people places a job or study experience livingconditions educational background present or most recent job)

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983096 A983091 p983089983091 A983090 p983091983093 C983089 p983092983096 D983091 p983094983089 D983091 p983096983091 B983089 p983096983096 D983091 p983089983088983093 B983089 p983089983089983088 D983090 p983089983090983093

D983091 p983089983097 D983091 p983093983089 D983091 p983097983091 D983093 p983089983089983093

COHERENCECan use the most frequently occurring connectors to link simple sentences and phrases in order to tell a story or describe something as a simplelist of points

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983096 D983091 p983089983097 D983091 p983090983097 D983091 p983093983089 D983091 p983096983091 D983091 p983097983091 D983091 p983089983088983093 D983090 p983089983090983093

Communicative language competence

VOCABULARY RANGECan understand high frequency job-related or e veryday languageHas sufficient vocabulary to conduct routine everyday tr ansactions and express basic communicative and survival needs

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090B983091 p983093 B983089 p983089983092 B983089 p983090983092 A983089 p983091983092 B983091 p983092983095 B983089 p983093983094 B983089 p983094983096 B983089 p983095983096 B983089 p983096983096 B983089 p983089983088983088 B983091 p983089983089983088 B983089 p983089983090983088

C983089 p983091983096 D983089 p983093983088 C983089 p983089983089983090

GRAMMATICAL ACCURACY Use some simple structures correctly but still systematically make basic mistakes (eg tend to mix up tenses and forget to mark agreement)

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983091 p983091 A983089 p983089983090 A983089 p983090983090 A983090 p983091983093 A983090 p983092983093 A983090 p983093983093 A983089 p983094983094 A983089 p983095983094 A983089 p983096983094 A983089 p983097983096 A983090 p983089983088983097 A983090 p983089983089983097B983090 p983092 A983090 p983089983091 A983090 p983090983091 B983091 p983091983095 B983089 p983092983094 B983089 p983093983094 A983090 p983094983095 A983090 p983095983095 A983090 p983096983095 A983090 p983097983097 B983091 p983089983089983089 B983090 p983089983090983089

B983092 p983089983093 B983092 p983090983093 B983090 p983092983094 B983090 p983093983095 B983091 p983094983097 B983091 p983095983097 B983091 p983089983088983089 B983091 p983089983088983089 B983091 p983089983090983089

PHONOLOGICAL CONTROLPronunciation is generally clear enough to be understood despite a noticeable foreign accent but conversational partners will need to ask for repetition fromtime to time

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983090 B983090 p983089983092 B983089 p983090983092 A983089 p983091983092 A983090 p983092983093 A983091 p983093983093 A983089 p983094983094 A983089 p983095983094 A983091 p983096983095 A983091 p983097983097 A983089 p983089983088983096 A983091 p983089983089983097

B983091 p983089983093 B983090 p983090983092 A983091 p983091983093 A983091 p983092983093 B983089 p983093983094 A983091 p983094983095 A983091 p983095983095 B983089 p983096983096 B983089 p983089983088983088 A983091 p983089983088983097 B983089 p983089983090983088B983091 p983090983093 C983090 p983091983097 B983091 p983092983095 C983090 p983093983097 B983089 p983094983096 B983089 p983095983096 B983091 p983096983097 C983089 p983089983088983090 C983090 p983089983089983091 C983089 p983089983090983090

B983090 p983094983097 B983090 p983095983097 C983089 p983097983088 C983090 p983089983088983091B983091 p983095983097D983091 p983096983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983096 of 983090

SECOND EDITION

SOCIOLINGUISTIC APPROPRIATENESSCan handle very short social exchanges using everyday polite forms of greeting and address

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 C983089 p983089983094 C983089 p983090983094 D983090 p983092983089 C983089 p983096983088 C983089 p983097983088 C983089 p983089983088983090 C983089 p983089983090983090

C983091 p983090983095 C983090 p983096983089 C983091 p983097983089 C983090 p983089983088983091 C983090 p983089983090983091C983091 p983096983089 C983091 p983089983088983091 C983091 p983089983090983091

Communication strategies

TAKING THE FLOOR (TURNTAKING) COOPERATING ASKING FOR CLARIFICATION COMPENSATING

MONITORING amp REPAIRCan use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask very simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 C983089 p983090983094 C983089 p983091983096 C983089 p983092983096 C983089 p983093983097 C983090 p983095983089 C983089 p983089983088983090 C983089 p983089983089983090C983090 p983095 C983091 p983090983095 C983090 p983091983097 C983090 p983092983097 C983090 p983093983097 C983090 p983089983089983091D983089 p983096 C983091 p983092983097 C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983097 of 983090

SECOND EDITION

How each unit relates to the CEFR

Unit 983089

Skill Goal LessonListening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)A983092 p983091B983089 p983092C983091 p983095

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983089 p983094C983091 p983095

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983089 p983090C983089 p983094C983090 p983095C983091 p983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983091 p983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983090A983091 p983091A983092 p983091B983090 p983092

Can answer simple questions and respond to simple statements in an interview A983089 p983090

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983091 p983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday personal matters (eg familypeople places a job or study experience living conditions educational background present ormost recent job)

D983090 p983096

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983096

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983093

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983091 p983091B983090 p983092

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983094

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983094C983090 p983095D983089 p983096

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1022

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983088 of 983090983090

SECOND EDITION

Unit 983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg very basic personal

and family information shopping local geography and employment)

B983091 p983089983093

C983089 p983089983094C983091 p983089983095

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

D983090 p983089983097

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983089983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983089983096

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983096

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983089983094C983090 p983089983095C983091 p983089983095

Can participate in a discussion about everyday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

B983090 p983089983092C983091 p983089983095

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983091B983090 p983089983092D983090 p983089983097

Can answer simple questions and respond to simple statements in an interview A983090 p983089983091A983091 p983089983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

A983091 p983089983091D983089 p983089983096

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983089983097

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983091 p983089983091D983091 p983089983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983089983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983089983090A983090 p983089983091B983092 p983089983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983090 p983089983092B983091 p983089983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983094

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983089 of 983090983090

SECOND EDITION

Unit 983091

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983090983090

A983091 p983090983091B983091 p983090983093D983090 p983090983097

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983091 p983090983091

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983090983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983091 p983090983097

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983090983096D983091 p983090983097

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983090983094C983090 p983090983095C983091 p983090983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983090983091C983091 p983090983095D983089 p983090983096

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983090983090A983090 p983090983091A983091 p983090983091B983092 p983090983093C983089 p983090983094

Can tell a story as a simple list of pointsCan give short basic descriptions of

bull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983090983093D983091 p983090983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983090983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983090983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983090983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983090983090A983090 p983090983091

B983092 p983090983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983089 p983090983092B983090 p983090983092B983091 p983090983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983090983094C983091 p983090983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983090983094C983091 p983090983095

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1222

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983090 of 983090

SECOND EDITION

Unit 983092

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983091983092

B983090 p983091983095C983091 p983091983097D983090 p983092983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983092983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983091983096C983090 p983091983097

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983092983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983091983093A983091 p983091983093B983089 p983091983094B983091 p983091983095C983089 p983091983096C983090 p983091983097C983091 p983091983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983090 p983092983089

Can write very simple personal letters emails etc D983090 p983092983089

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983090 p983091983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

A983089 p983091983092C983089 p983091983096

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983091983093B983091 p983091983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983091983092A983091 p983091983093C983090 p983091983097

Can handle very short social exchanges using everyday polite forms of greeting and address D983090 p983092983089

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983091983096C983090 p983091983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1322

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983091 of 983090

SECOND EDITION

Unit 983093

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983092983092

B983089 p983092983094C983091 p983092983097D983090 p983093983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983093983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond invitations and apologiesCan say what they like and dislike

C983089 p983092983096C983090 p983092983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983092983093A983091 p983092983093B983092 p983092983095C983090 p983092983097C983091 p983092983097D983091 p983093983089

Can answer simple questions and respond to simple statements in an interview B983092 p983092983095D983089 p983093983089D983091 p983093983089

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983092983095C983089 p983092983096

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

C983089 p983092983096D983091 p983093983089

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983093983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983092983095D983089 p983093983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983092983093B983089 p983092983094B983090 p983092983094

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983092983093A983091 p983092983093B983091 p983092983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983092983096C983090 p983092983097C983091 p983092983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1422

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983092 of 983090

SECOND EDITION

Unit 983094

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983091 p983093983093

B983089 p983093983094B983091 p983093983095C983089 p983093983096C983091 p983093983097

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get from X to Y by foot or public transport

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Reading Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983094983088D983091 p983094983089

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983094983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983093983096C983090 p983093983097

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Can deal with common aspects of ever yday living such as travel ndash tourist information publictransport and accommodation shopping buying tickets and simple transactions in shops postoffices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the price

Can order a meal

C983091 p983093983097

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983093983092A983090 p983093983093B983090 p983093983095B983091 p983093983095C983091 p983093983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983091 p983094983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983093 of 983090983090

SECOND EDITION

Skill Goal Lesson

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983094983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983093983094

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983093983093B983089 p983093983094B983090 p983093983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983093983093B983089 p983093983094C983090 p983093983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983093983097C983090 p983093983097C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983094 of 983090

SECOND EDITION

Unit 983095

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983094983094

B983090 p983094983097C983089 p983095983088C983090 p983095983089C983091 p983095983089D983090 p983095983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983094983097C983089 p983095983088

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

D983090 p983095983091

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983090 p983095983091

Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983095983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983095983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations invitations and apologiesCan say what they like and dislike

A983090 p983094983095C983089 p983095983088C983090 p983095983089

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983094983095B983091 p983094983097C983089 p983095983088C983091 p983095983089

Can manage simple routine tasks such asbull asking for and providing things

bull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

B983091 p983094983097C983089 p983095983088

C983091 p983095983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983094983095C983089 p983095983088

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessions

Can use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

C983089 p983095983088

Writing Can write very simple personal letters emails etc D983090 p983095983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983095 of 983090

SECOND EDITION

Skill Goal Lesson

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983094983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement) A983089 p983094983094A983090 p983094983095B983091 p983094983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983094983094A983091 p983094983095B983089 p983094983096B983090 p983094983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983090 p983095983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983096 of 983090983090

SECOND EDITION

Unit 983096

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983095983094

B983090 p983095983097C983089 p983096983088C983090 p983096983089D983090 p983096983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983091 p983096983089

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983096983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologies

Can say what they like and dislike

C983089 p983096983088C983090 p983096983089C983091 p983096983089D983091 p983096983091

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983089 p983096983088C983090 p983096983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983095983095D983091 p983096983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983089 p983096983090D983090 p983096983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983096983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983096983091

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983095983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983095983094A983090 p983095983095B983091 p983095983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983095983094A983091 p983095983095B983089 p983095983096B983090 p983095983097B983091 p983095983097D983091 p983096983091

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983096983088C983090 p983096983089C983091 p983096983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983097 of 983090

SECOND EDITION

Unit 983097

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983096983094

A983091 p983096983095B983090 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089D983090 p983097983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983096983097

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983097983090D983091 p983097983091

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

B983091 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

B983089 p983096983096B983091 p983096983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessions

Can explain what they like or dislike about something

A983089 p983096983094A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

B983089 p983096983096D983091 p983097983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983097983091

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983096983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983096983094A983090 p983096983095B983091 p983089983088983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983096983095B983089 p983096983096

B983091 p983096983097C983089 p983097983088

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983097983088C983091 p983097983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 222

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090 of 983090

SECOND EDITION

Introduction to the Common European Framework of Reference (CEFR)

Touchstone Second Edition and the Common European Framework of ReferenceThe table below shows how Touchstone Second Edition correlates with the Council of Europersquos levels and with some majorinternational examinations

The overall aim of the Council of Europersquos CommonEuropean Framework of Reference (CEFR) is to provideobjective criteria for describing and assessing language

proficiency in an internationally comparable manner TheCouncil of Europersquos work on the definition of appropriatelearning objectives for adult language learners datesback to the 983089983097983095983088s The influential Threshold series(J A van Ek and J L M Trim Cambridge UniversityPress 983089983097983097983089) provides a detailed description infunctional notional grammatical and socioculturalterms of what a language user needs to be able to do inorder to communicate effectively in the sort of situationscommonly encountered in everyday life Three levels ofproficiency are identified called Waystage Threshold

and Vantage (roughly corresponding to ElementaryIntermediate and Upper Intermediate)

The Threshold series was followed in 983090983088983088983089 by thepublication of the Common European Framework ofReference which describes six levels of communicativeability in terms of competences or ldquocan dordquo statementsA983089 (Breakthrough) A983090 (Waystage) B983089 (Threshold)B983090 (Vantage) C983089 (Effective Operational Proficiency) andC983090 (Mastery) Based on the CEFR descriptors theCouncil of Europe also developed the EuropeanLanguage Portfolio a document that enables learnersto assess their language ability and to keep aninternationally recognized record of their languagelearning experience

Sources httpwwwcambridgeenglishorgabout-uswhat-we-dointernational-language-standardshttpwwwetsorgMediaResearchpdfCEF_Mapping_Study_Interim_Report pdfhttpwwwsprachenmarktdefileadminsprachenmarktets_imagesTOEIC_Can-do-table_CEFR _983090983088983088983096pdf

CEFRCouncil of

EuropeCambridge English

Language AssessmentIELTS TOEFL iBT TOEIC

Touchstone 983089

Touchstone 983090

Touchstone 983091

Touchstone 983092

Viewpoint 983089

Viewpoint 983090

A983089 Breakthrough 983089983090983088+

A983090 Waystage 983090983090983093+

B983089 Threshold KET (Key English Test) 983092983088ndash983093983088 983093983095ndash983096983094 983093983093983088+

PET (Preliminary English Test)

B983090 Vantage FCE (First Certificate inEnglish)

983093983093ndash983094983093 983096983095ndash983089983088983097 983095983096983093+

C983089 EffectiveOperational

Efficiency

CAE (Certificate inAdvanced English)

983095983088ndash983096983088 983089983089983088ndash983089983090983088 983092983097983088+ (Listening)983092983092983093+ (Reading)

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 322

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983091 of 983090

SECOND EDITION

CEFR Level

Touchstone Second Edition Level 983090 covers level A983090 of the CEFR This tabledescribes the general degree of skill achieved by learners at this level

Skill Learners will be able to

Listening bull understand phrases and very high frequency vocabulary related to areasof the most immediate personal relevance (eg basic personal and familyinformation shopping local geography and employment)

bull catch the main point in short clear simple messages and announcements

Reading bull read short simple texts including short simple personal letters and emails

bull find specific predictable information in simple everyday material such asadvertisements catalogs menus and timetables

Speaking bull communicate about basic and routine tasks that require a simple and directexchange of information on familiar topics and activities

bull handle very short social exchanges

bull use a series of phrases and sentences to describe in simple terms their familyand other people living conditions their educational background and theirpresent or most recent job

Writing bull write short simple notes messages and emails relating to matters in areas ofimmediate need

bull write a simple personal letter for example thanking someone for something

Communicativelanguagecompetence

bull use basic sentence patterns and phrases groups of a few words and formulaein order to communicate limited information in everyday situations

bull use some simple grammatical structures correctly

bull speak with clear enough pronunciation to be understood

bull perform and respond to basic language functions such as informationexchange requests and invitations and express opinions and attitudes in asimple way

bull socialize simply but effectively using common expressions and using everydaypolite forms of greeting and address

Communicationstrategies

bull initiate maintain and close simple conversations guess some unknown wordsfrom context in simple short texts and utterances and ask for clarification orrepetition

bull indicate when they are following a conversation

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 422

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983092 of 983090

SECOND EDITION

CEFR goals realized in this level of Touchstone

Listening

At A983090 learners can understand speech that

is clearly and slowly articulated

concerns predictable everyday matters

OVERALL LISTENING COMPREHENSIONCan understand phrases and expressions related to very familiar topics (eg basic personal and family information shopping local geographyand employment)

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983092 p983091 B983091 p983089983093 A983089 p983090983090 A983089 p983091983092 A983089 p983092983092 A983091 p983093983093 A983089 p983094983094 A983089 p983095983094 A983089 p983096983094 A983089 p983097983096 A983089 p983089983088983096 A983089 p983089983089983096B983089 p983092 C983089 p983089983094 A983091 p983090983091 B983090 p983091983095 B983089 p983092983094 B983089 p983093983094 B983090 p983094983097 B983090 p983095983097 A983091 p983096983095 B983089 p983089983088983088 B983090 p983089983089983089 B983089 p983089983090983089C983091 p983095 C983091 p983089983095 B983091 p983090983093 C983091 p983091983097 C983091 p983092983097 B983091 p983093983095 C983089 p983095983088 C983089 p983096983088 B983090 p983096983097 B983090 p983089983088983089 C983089 p983089983089983090 C983089 p983089983090983090

D983090 p983090983097 D983090 p983092983089 D983090 p983093983089 C983089 p983093983096 C983090 p983095983089 C983090 p983096983089 C983089 p983097983088 C983089 p983089983088983090 C983091 p983089983089983091 C983091 p983089983090983091C983091 p983093983097 C983091 p983095983089 D983090 p983096983091 C983090 p983097983089 C983090 p983089983088983091 D983090 p983089983089983093 D983090 p983089983090983093

D983090 p983095983091 C983091 p983097983089 C983091 p983089983088983091D983090 p983097983091 D983090 p983089983088983093

UNDERSTANDING INTERACTIONCan generally identify the topic of discussion around them as log as it is conducted slowly and clearly

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 D983090 p983089983097 A983091 p983090983091 B983090 p983094983097 C983091 p983096983089 B983090 p983096983097 B983089 p983089983088983088 A983089 p983089983088983096 B983090 p983089983090983089C983091 p983095 C983089 p983095983088 C983089 p983089983088983089 B983090 p983089983089983089 C983089 p983089983090983090

C983091 p983089983088983091 C983089 p983089983089983090 C983091 p983089983090983091C983091 p983089983089983091 D983090 p983089983090983093D983090 p983089983089983093

LISTENING TO ANNOUNCEMENTS amp INSTRUCTIONSCan catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get from X to Y by foot or public transport

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983093983093 C983091 p983089983090983091B983090 p983093983095B983091 p983093983095

LISTENING TO MEDIA amp RECORDINGSCan understand and extract the essential information from short recorded passagesCan identify the main point of TV news items reporting events accidents etc where the visual supports the commentary

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983089 p983089983090 A983089 p983090983090 D983090 p983095983091

Reading

At A983090 learners can understand short simple texts on familiar topics which use high frequency vocabulary

READING CORRESPONDENCECan understand basic types of standard routine letters emails short simple personal letters etc

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983089 p983089983096 D983091 p983090983097 D983090 p983095983091 D983089 p983096983088

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983093 of 983090

SECOND EDITION

READING FOR ORIENTATIONCan find specific predictable information in simple everyday material such as advertisements websites catalogs menus reference lists and timetablesCan understand everyday signs and notices in public places

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983089 p983094983088 D983089 p983095983088D983091 p983094983089

READING FOR INFORMATION amp ARGUMENTCan identify specific information in simple written material such as letters brochures and short newspaper or online articles

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983089 p983096 D983089 p983089983096 D983089 p983090983096 D983089 p983092983088 D983089 p983093983088 D983089 p983094983088 D983089 p983095983088 D983089 p983096983088 D983089 p983097983090 D983089 p983089983088983092 D983089 p983089983089983092 D983089 p983089983090983092

D983091 p983090983097 D983091 p983097983091 D983091 p983089983088983093

Speaking

Overall spoken interactionAt A983090 learners can manage simple routine exchanges fairly easily but struggle with extended conversations andoften need help with understanding They can

ask and answer questions and exchange ideas and information on familiar topics in predictable everyday situations

handle very short social exchanges and simple transactions mostly understand speech in a standard accent directed at them which is delivered slowly and clearly provided they can

ask for repetition or reformulation from time to time

CONVERSATIONCan use simple everyday polite forms of g reeting address farewell introduction and giving thanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983089 p983090 C983089 p983089983094 C983089 p983090983094 C983089 p983091983096 C983089 p983092983096 C983089 p983093983096 A983090 p983094983095 C983089 p983096983088 B983091 p983096983097 A983091 p983097983097 A983090 p983089983088983097 A983091 p983089983089983097C983089 p983094 C983090 p983089983095 C983090 p983090983095 C983090 p983091983097 C983090 p983092983097 C983090 p983093983097 C983089 p983095983088 C983090 p983096983089 C983089 p983097983088 B983089 p983089983088983088 C983089 p983089983089983090 C983089 p983089983090983090C983090 p983095 C983091 p983089983095 C983091 p983090983095 C983090 p983095983089 C983091 p983096983089 C983090 p983097983089 C983089 p983089983088983090 C983090 p983089983089983091 C983090 p983089983090983091C983091 p983095 D983091 p983096983091 C983091 p983097983089 C983090 p983089983088983091 C983091 p983089983089983091

C983091 p983089983088983091

INFORMAL DISCUSSION (WITH FRIENDS)Can participate in a discussion about everyday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983091 p983097 B983090 p983089983092 A983091 p983090983091 D983089 p983092983089 A983091 p983094983095 A983090 p983097983097 D983089 p983089983090983093

C983091 p983089983095 C983091 p983090983095 B983091 p983094983097 B983091 p983089983088983089 D983090 p983089983090983093D983089 p983090983096 C983089 p983095983088 D983090 p983089983088983093

C983091 p983095983089 D983091 p983089983088983093

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983094 of 983090

SECOND EDITION

GOAL-ORIENTED COOPERATION (EG REPAIRING A CAR DISCUSSING A DOCUMENT OR ORGANIZING

AN EVENT)Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do next

bull making and responding to suggestionsbull asking for and giving directions

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983093983093 B983091 p983094983097 C983089 p983096983088 C983091 p983089983090983091B983090 p983093983095 C983089 p983095983088 C983090 p983096983089B983091 p983093983095 C983091 p983095983089

TRANSACTIONS TO OBTAIN GOODS amp SERVICESCan deal with common aspects of everyday living such as travel ndash tourist information public transport and accommodation shopping buying tickets andsimple transactions in shops post offices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the priceCan order a meal

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983091 p983093983097

INFORMATION EXCHANGECan ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange of informationCan exchange limited information on familiar and routine operational matters

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983090 A983091 p983089983091 A983089 p983090983090 A983090 p983091983093 A983090 p983092983093 A983089 p983093983092 A983090 p983094983095 A983091 p983095983095 B983089 p983096983096 C983091 p983089983088983091 A983091 p983089983088983097 A983089 p983089983089983097A983091 p983091 B983090 p983089983092 A983090 p983090983091 A983091 p983091983093 A983091 p983092983093 A983090 p983093983093 C983089 p983095983088 D983091 p983096983091 B983091 p983096983097 B983091 p983089983089983089 B983091 p983089983090983089A983092 p983091 D983090 p983089983097 A983091 p983090983091 B983089 p983091983094 B983092 p983092983095 B983090 p983093983095 D983091 p983089983089983093 C983089 p983089983090983090B983090 p983092 B983092 p983090983093 B983091 p983091983095 C983090 p983092983097 B983091 p983093983095

C983089 p983090983094 C983089 p983091983096 C983091 p983092983097 C983091 p983093983097C983090 p983091983097 D983091 p983093983089C983091 p983091983097

INTERVIEWING AND BEING INTERVIEWEDCan answer simple questions and respond to simple statements in an interview

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983089 p983090 A983090 p983089983091 B983092 p983092983095

A983091 p983089983091 D983089 p983093983089D983091 p983093983089

Overall spoken productionAt A983090 learners can give simple descriptions or presentations about everyday things as a short series of simplephrases and sentences linked into a list

SUSTAINED MONOLOGUE DESCRIBING EXPERIENCECan tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal ex periencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects and possessionsCan explain what they like or dislike about something

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090B983091 p983093 A983091 p983089983091 B983092 p983090983093 B983092 p983092983095 D983091 p983094983089 C983089 p983095983088 D983089 p983096983090 A983089 p983096983094

D983089 p983089983096 D983091 p983090983097 C983089 p983092983096 D983090 p983096983091 A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983095 of 983090

SECOND EDITION

Writing

Overall written production and interaction

At A983090 learners can write a series of simple phrases and sentences linked with simple connectors like and but and

because

OVERALL WRITTEN PRODUCTIONCan write short simple formulaic notes relating to matters in areas of immediate need

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983091 p983089983097 D983091 p983090983097 D983090 p983092983089

CORRESPONDENCECan write very simple personal letters emails etc

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983092983089 D983090 p983095983091

CREATIVE WRITINGCan write very short basic descriptions of events past activities and personal experiences

Can write a series of simple phrases and sentences about everyday andor personal matters (eg family people places a job or study experience livingconditions educational background present or most recent job)

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983096 A983091 p983089983091 A983090 p983091983093 C983089 p983092983096 D983091 p983094983089 D983091 p983096983091 B983089 p983096983096 D983091 p983089983088983093 B983089 p983089983089983088 D983090 p983089983090983093

D983091 p983089983097 D983091 p983093983089 D983091 p983097983091 D983093 p983089983089983093

COHERENCECan use the most frequently occurring connectors to link simple sentences and phrases in order to tell a story or describe something as a simplelist of points

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983096 D983091 p983089983097 D983091 p983090983097 D983091 p983093983089 D983091 p983096983091 D983091 p983097983091 D983091 p983089983088983093 D983090 p983089983090983093

Communicative language competence

VOCABULARY RANGECan understand high frequency job-related or e veryday languageHas sufficient vocabulary to conduct routine everyday tr ansactions and express basic communicative and survival needs

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090B983091 p983093 B983089 p983089983092 B983089 p983090983092 A983089 p983091983092 B983091 p983092983095 B983089 p983093983094 B983089 p983094983096 B983089 p983095983096 B983089 p983096983096 B983089 p983089983088983088 B983091 p983089983089983088 B983089 p983089983090983088

C983089 p983091983096 D983089 p983093983088 C983089 p983089983089983090

GRAMMATICAL ACCURACY Use some simple structures correctly but still systematically make basic mistakes (eg tend to mix up tenses and forget to mark agreement)

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983091 p983091 A983089 p983089983090 A983089 p983090983090 A983090 p983091983093 A983090 p983092983093 A983090 p983093983093 A983089 p983094983094 A983089 p983095983094 A983089 p983096983094 A983089 p983097983096 A983090 p983089983088983097 A983090 p983089983089983097B983090 p983092 A983090 p983089983091 A983090 p983090983091 B983091 p983091983095 B983089 p983092983094 B983089 p983093983094 A983090 p983094983095 A983090 p983095983095 A983090 p983096983095 A983090 p983097983097 B983091 p983089983089983089 B983090 p983089983090983089

B983092 p983089983093 B983092 p983090983093 B983090 p983092983094 B983090 p983093983095 B983091 p983094983097 B983091 p983095983097 B983091 p983089983088983089 B983091 p983089983088983089 B983091 p983089983090983089

PHONOLOGICAL CONTROLPronunciation is generally clear enough to be understood despite a noticeable foreign accent but conversational partners will need to ask for repetition fromtime to time

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983090 B983090 p983089983092 B983089 p983090983092 A983089 p983091983092 A983090 p983092983093 A983091 p983093983093 A983089 p983094983094 A983089 p983095983094 A983091 p983096983095 A983091 p983097983097 A983089 p983089983088983096 A983091 p983089983089983097

B983091 p983089983093 B983090 p983090983092 A983091 p983091983093 A983091 p983092983093 B983089 p983093983094 A983091 p983094983095 A983091 p983095983095 B983089 p983096983096 B983089 p983089983088983088 A983091 p983089983088983097 B983089 p983089983090983088B983091 p983090983093 C983090 p983091983097 B983091 p983092983095 C983090 p983093983097 B983089 p983094983096 B983089 p983095983096 B983091 p983096983097 C983089 p983089983088983090 C983090 p983089983089983091 C983089 p983089983090983090

B983090 p983094983097 B983090 p983095983097 C983089 p983097983088 C983090 p983089983088983091B983091 p983095983097D983091 p983096983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983096 of 983090

SECOND EDITION

SOCIOLINGUISTIC APPROPRIATENESSCan handle very short social exchanges using everyday polite forms of greeting and address

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 C983089 p983089983094 C983089 p983090983094 D983090 p983092983089 C983089 p983096983088 C983089 p983097983088 C983089 p983089983088983090 C983089 p983089983090983090

C983091 p983090983095 C983090 p983096983089 C983091 p983097983089 C983090 p983089983088983091 C983090 p983089983090983091C983091 p983096983089 C983091 p983089983088983091 C983091 p983089983090983091

Communication strategies

TAKING THE FLOOR (TURNTAKING) COOPERATING ASKING FOR CLARIFICATION COMPENSATING

MONITORING amp REPAIRCan use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask very simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 C983089 p983090983094 C983089 p983091983096 C983089 p983092983096 C983089 p983093983097 C983090 p983095983089 C983089 p983089983088983090 C983089 p983089983089983090C983090 p983095 C983091 p983090983095 C983090 p983091983097 C983090 p983092983097 C983090 p983093983097 C983090 p983089983089983091D983089 p983096 C983091 p983092983097 C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983097 of 983090

SECOND EDITION

How each unit relates to the CEFR

Unit 983089

Skill Goal LessonListening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)A983092 p983091B983089 p983092C983091 p983095

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983089 p983094C983091 p983095

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983089 p983090C983089 p983094C983090 p983095C983091 p983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983091 p983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983090A983091 p983091A983092 p983091B983090 p983092

Can answer simple questions and respond to simple statements in an interview A983089 p983090

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983091 p983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday personal matters (eg familypeople places a job or study experience living conditions educational background present ormost recent job)

D983090 p983096

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983096

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983093

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983091 p983091B983090 p983092

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983094

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983094C983090 p983095D983089 p983096

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1022

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983088 of 983090983090

SECOND EDITION

Unit 983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg very basic personal

and family information shopping local geography and employment)

B983091 p983089983093

C983089 p983089983094C983091 p983089983095

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

D983090 p983089983097

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983089983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983089983096

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983096

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983089983094C983090 p983089983095C983091 p983089983095

Can participate in a discussion about everyday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

B983090 p983089983092C983091 p983089983095

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983091B983090 p983089983092D983090 p983089983097

Can answer simple questions and respond to simple statements in an interview A983090 p983089983091A983091 p983089983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

A983091 p983089983091D983089 p983089983096

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983089983097

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983091 p983089983091D983091 p983089983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983089983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983089983090A983090 p983089983091B983092 p983089983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983090 p983089983092B983091 p983089983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983094

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983089 of 983090983090

SECOND EDITION

Unit 983091

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983090983090

A983091 p983090983091B983091 p983090983093D983090 p983090983097

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983091 p983090983091

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983090983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983091 p983090983097

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983090983096D983091 p983090983097

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983090983094C983090 p983090983095C983091 p983090983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983090983091C983091 p983090983095D983089 p983090983096

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983090983090A983090 p983090983091A983091 p983090983091B983092 p983090983093C983089 p983090983094

Can tell a story as a simple list of pointsCan give short basic descriptions of

bull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983090983093D983091 p983090983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983090983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983090983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983090983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983090983090A983090 p983090983091

B983092 p983090983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983089 p983090983092B983090 p983090983092B983091 p983090983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983090983094C983091 p983090983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983090983094C983091 p983090983095

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1222

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983090 of 983090

SECOND EDITION

Unit 983092

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983091983092

B983090 p983091983095C983091 p983091983097D983090 p983092983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983092983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983091983096C983090 p983091983097

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983092983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983091983093A983091 p983091983093B983089 p983091983094B983091 p983091983095C983089 p983091983096C983090 p983091983097C983091 p983091983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983090 p983092983089

Can write very simple personal letters emails etc D983090 p983092983089

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983090 p983091983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

A983089 p983091983092C983089 p983091983096

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983091983093B983091 p983091983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983091983092A983091 p983091983093C983090 p983091983097

Can handle very short social exchanges using everyday polite forms of greeting and address D983090 p983092983089

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983091983096C983090 p983091983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1322

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983091 of 983090

SECOND EDITION

Unit 983093

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983092983092

B983089 p983092983094C983091 p983092983097D983090 p983093983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983093983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond invitations and apologiesCan say what they like and dislike

C983089 p983092983096C983090 p983092983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983092983093A983091 p983092983093B983092 p983092983095C983090 p983092983097C983091 p983092983097D983091 p983093983089

Can answer simple questions and respond to simple statements in an interview B983092 p983092983095D983089 p983093983089D983091 p983093983089

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983092983095C983089 p983092983096

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

C983089 p983092983096D983091 p983093983089

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983093983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983092983095D983089 p983093983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983092983093B983089 p983092983094B983090 p983092983094

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983092983093A983091 p983092983093B983091 p983092983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983092983096C983090 p983092983097C983091 p983092983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1422

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983092 of 983090

SECOND EDITION

Unit 983094

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983091 p983093983093

B983089 p983093983094B983091 p983093983095C983089 p983093983096C983091 p983093983097

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get from X to Y by foot or public transport

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Reading Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983094983088D983091 p983094983089

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983094983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983093983096C983090 p983093983097

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Can deal with common aspects of ever yday living such as travel ndash tourist information publictransport and accommodation shopping buying tickets and simple transactions in shops postoffices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the price

Can order a meal

C983091 p983093983097

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983093983092A983090 p983093983093B983090 p983093983095B983091 p983093983095C983091 p983093983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983091 p983094983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983093 of 983090983090

SECOND EDITION

Skill Goal Lesson

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983094983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983093983094

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983093983093B983089 p983093983094B983090 p983093983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983093983093B983089 p983093983094C983090 p983093983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983093983097C983090 p983093983097C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983094 of 983090

SECOND EDITION

Unit 983095

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983094983094

B983090 p983094983097C983089 p983095983088C983090 p983095983089C983091 p983095983089D983090 p983095983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983094983097C983089 p983095983088

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

D983090 p983095983091

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983090 p983095983091

Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983095983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983095983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations invitations and apologiesCan say what they like and dislike

A983090 p983094983095C983089 p983095983088C983090 p983095983089

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983094983095B983091 p983094983097C983089 p983095983088C983091 p983095983089

Can manage simple routine tasks such asbull asking for and providing things

bull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

B983091 p983094983097C983089 p983095983088

C983091 p983095983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983094983095C983089 p983095983088

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessions

Can use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

C983089 p983095983088

Writing Can write very simple personal letters emails etc D983090 p983095983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983095 of 983090

SECOND EDITION

Skill Goal Lesson

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983094983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement) A983089 p983094983094A983090 p983094983095B983091 p983094983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983094983094A983091 p983094983095B983089 p983094983096B983090 p983094983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983090 p983095983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983096 of 983090983090

SECOND EDITION

Unit 983096

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983095983094

B983090 p983095983097C983089 p983096983088C983090 p983096983089D983090 p983096983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983091 p983096983089

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983096983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologies

Can say what they like and dislike

C983089 p983096983088C983090 p983096983089C983091 p983096983089D983091 p983096983091

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983089 p983096983088C983090 p983096983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983095983095D983091 p983096983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983089 p983096983090D983090 p983096983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983096983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983096983091

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983095983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983095983094A983090 p983095983095B983091 p983095983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983095983094A983091 p983095983095B983089 p983095983096B983090 p983095983097B983091 p983095983097D983091 p983096983091

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983096983088C983090 p983096983089C983091 p983096983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983097 of 983090

SECOND EDITION

Unit 983097

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983096983094

A983091 p983096983095B983090 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089D983090 p983097983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983096983097

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983097983090D983091 p983097983091

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

B983091 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

B983089 p983096983096B983091 p983096983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessions

Can explain what they like or dislike about something

A983089 p983096983094A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

B983089 p983096983096D983091 p983097983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983097983091

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983096983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983096983094A983090 p983096983095B983091 p983089983088983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983096983095B983089 p983096983096

B983091 p983096983097C983089 p983097983088

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983097983088C983091 p983097983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 322

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983091 of 983090

SECOND EDITION

CEFR Level

Touchstone Second Edition Level 983090 covers level A983090 of the CEFR This tabledescribes the general degree of skill achieved by learners at this level

Skill Learners will be able to

Listening bull understand phrases and very high frequency vocabulary related to areasof the most immediate personal relevance (eg basic personal and familyinformation shopping local geography and employment)

bull catch the main point in short clear simple messages and announcements

Reading bull read short simple texts including short simple personal letters and emails

bull find specific predictable information in simple everyday material such asadvertisements catalogs menus and timetables

Speaking bull communicate about basic and routine tasks that require a simple and directexchange of information on familiar topics and activities

bull handle very short social exchanges

bull use a series of phrases and sentences to describe in simple terms their familyand other people living conditions their educational background and theirpresent or most recent job

Writing bull write short simple notes messages and emails relating to matters in areas ofimmediate need

bull write a simple personal letter for example thanking someone for something

Communicativelanguagecompetence

bull use basic sentence patterns and phrases groups of a few words and formulaein order to communicate limited information in everyday situations

bull use some simple grammatical structures correctly

bull speak with clear enough pronunciation to be understood

bull perform and respond to basic language functions such as informationexchange requests and invitations and express opinions and attitudes in asimple way

bull socialize simply but effectively using common expressions and using everydaypolite forms of greeting and address

Communicationstrategies

bull initiate maintain and close simple conversations guess some unknown wordsfrom context in simple short texts and utterances and ask for clarification orrepetition

bull indicate when they are following a conversation

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 422

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983092 of 983090

SECOND EDITION

CEFR goals realized in this level of Touchstone

Listening

At A983090 learners can understand speech that

is clearly and slowly articulated

concerns predictable everyday matters

OVERALL LISTENING COMPREHENSIONCan understand phrases and expressions related to very familiar topics (eg basic personal and family information shopping local geographyand employment)

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983092 p983091 B983091 p983089983093 A983089 p983090983090 A983089 p983091983092 A983089 p983092983092 A983091 p983093983093 A983089 p983094983094 A983089 p983095983094 A983089 p983096983094 A983089 p983097983096 A983089 p983089983088983096 A983089 p983089983089983096B983089 p983092 C983089 p983089983094 A983091 p983090983091 B983090 p983091983095 B983089 p983092983094 B983089 p983093983094 B983090 p983094983097 B983090 p983095983097 A983091 p983096983095 B983089 p983089983088983088 B983090 p983089983089983089 B983089 p983089983090983089C983091 p983095 C983091 p983089983095 B983091 p983090983093 C983091 p983091983097 C983091 p983092983097 B983091 p983093983095 C983089 p983095983088 C983089 p983096983088 B983090 p983096983097 B983090 p983089983088983089 C983089 p983089983089983090 C983089 p983089983090983090

D983090 p983090983097 D983090 p983092983089 D983090 p983093983089 C983089 p983093983096 C983090 p983095983089 C983090 p983096983089 C983089 p983097983088 C983089 p983089983088983090 C983091 p983089983089983091 C983091 p983089983090983091C983091 p983093983097 C983091 p983095983089 D983090 p983096983091 C983090 p983097983089 C983090 p983089983088983091 D983090 p983089983089983093 D983090 p983089983090983093

D983090 p983095983091 C983091 p983097983089 C983091 p983089983088983091D983090 p983097983091 D983090 p983089983088983093

UNDERSTANDING INTERACTIONCan generally identify the topic of discussion around them as log as it is conducted slowly and clearly

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 D983090 p983089983097 A983091 p983090983091 B983090 p983094983097 C983091 p983096983089 B983090 p983096983097 B983089 p983089983088983088 A983089 p983089983088983096 B983090 p983089983090983089C983091 p983095 C983089 p983095983088 C983089 p983089983088983089 B983090 p983089983089983089 C983089 p983089983090983090

C983091 p983089983088983091 C983089 p983089983089983090 C983091 p983089983090983091C983091 p983089983089983091 D983090 p983089983090983093D983090 p983089983089983093

LISTENING TO ANNOUNCEMENTS amp INSTRUCTIONSCan catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get from X to Y by foot or public transport

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983093983093 C983091 p983089983090983091B983090 p983093983095B983091 p983093983095

LISTENING TO MEDIA amp RECORDINGSCan understand and extract the essential information from short recorded passagesCan identify the main point of TV news items reporting events accidents etc where the visual supports the commentary

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983089 p983089983090 A983089 p983090983090 D983090 p983095983091

Reading

At A983090 learners can understand short simple texts on familiar topics which use high frequency vocabulary

READING CORRESPONDENCECan understand basic types of standard routine letters emails short simple personal letters etc

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983089 p983089983096 D983091 p983090983097 D983090 p983095983091 D983089 p983096983088

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983093 of 983090

SECOND EDITION

READING FOR ORIENTATIONCan find specific predictable information in simple everyday material such as advertisements websites catalogs menus reference lists and timetablesCan understand everyday signs and notices in public places

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983089 p983094983088 D983089 p983095983088D983091 p983094983089

READING FOR INFORMATION amp ARGUMENTCan identify specific information in simple written material such as letters brochures and short newspaper or online articles

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983089 p983096 D983089 p983089983096 D983089 p983090983096 D983089 p983092983088 D983089 p983093983088 D983089 p983094983088 D983089 p983095983088 D983089 p983096983088 D983089 p983097983090 D983089 p983089983088983092 D983089 p983089983089983092 D983089 p983089983090983092

D983091 p983090983097 D983091 p983097983091 D983091 p983089983088983093

Speaking

Overall spoken interactionAt A983090 learners can manage simple routine exchanges fairly easily but struggle with extended conversations andoften need help with understanding They can

ask and answer questions and exchange ideas and information on familiar topics in predictable everyday situations

handle very short social exchanges and simple transactions mostly understand speech in a standard accent directed at them which is delivered slowly and clearly provided they can

ask for repetition or reformulation from time to time

CONVERSATIONCan use simple everyday polite forms of g reeting address farewell introduction and giving thanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983089 p983090 C983089 p983089983094 C983089 p983090983094 C983089 p983091983096 C983089 p983092983096 C983089 p983093983096 A983090 p983094983095 C983089 p983096983088 B983091 p983096983097 A983091 p983097983097 A983090 p983089983088983097 A983091 p983089983089983097C983089 p983094 C983090 p983089983095 C983090 p983090983095 C983090 p983091983097 C983090 p983092983097 C983090 p983093983097 C983089 p983095983088 C983090 p983096983089 C983089 p983097983088 B983089 p983089983088983088 C983089 p983089983089983090 C983089 p983089983090983090C983090 p983095 C983091 p983089983095 C983091 p983090983095 C983090 p983095983089 C983091 p983096983089 C983090 p983097983089 C983089 p983089983088983090 C983090 p983089983089983091 C983090 p983089983090983091C983091 p983095 D983091 p983096983091 C983091 p983097983089 C983090 p983089983088983091 C983091 p983089983089983091

C983091 p983089983088983091

INFORMAL DISCUSSION (WITH FRIENDS)Can participate in a discussion about everyday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983091 p983097 B983090 p983089983092 A983091 p983090983091 D983089 p983092983089 A983091 p983094983095 A983090 p983097983097 D983089 p983089983090983093

C983091 p983089983095 C983091 p983090983095 B983091 p983094983097 B983091 p983089983088983089 D983090 p983089983090983093D983089 p983090983096 C983089 p983095983088 D983090 p983089983088983093

C983091 p983095983089 D983091 p983089983088983093

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983094 of 983090

SECOND EDITION

GOAL-ORIENTED COOPERATION (EG REPAIRING A CAR DISCUSSING A DOCUMENT OR ORGANIZING

AN EVENT)Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do next

bull making and responding to suggestionsbull asking for and giving directions

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983093983093 B983091 p983094983097 C983089 p983096983088 C983091 p983089983090983091B983090 p983093983095 C983089 p983095983088 C983090 p983096983089B983091 p983093983095 C983091 p983095983089

TRANSACTIONS TO OBTAIN GOODS amp SERVICESCan deal with common aspects of everyday living such as travel ndash tourist information public transport and accommodation shopping buying tickets andsimple transactions in shops post offices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the priceCan order a meal

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983091 p983093983097

INFORMATION EXCHANGECan ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange of informationCan exchange limited information on familiar and routine operational matters

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983090 A983091 p983089983091 A983089 p983090983090 A983090 p983091983093 A983090 p983092983093 A983089 p983093983092 A983090 p983094983095 A983091 p983095983095 B983089 p983096983096 C983091 p983089983088983091 A983091 p983089983088983097 A983089 p983089983089983097A983091 p983091 B983090 p983089983092 A983090 p983090983091 A983091 p983091983093 A983091 p983092983093 A983090 p983093983093 C983089 p983095983088 D983091 p983096983091 B983091 p983096983097 B983091 p983089983089983089 B983091 p983089983090983089A983092 p983091 D983090 p983089983097 A983091 p983090983091 B983089 p983091983094 B983092 p983092983095 B983090 p983093983095 D983091 p983089983089983093 C983089 p983089983090983090B983090 p983092 B983092 p983090983093 B983091 p983091983095 C983090 p983092983097 B983091 p983093983095

C983089 p983090983094 C983089 p983091983096 C983091 p983092983097 C983091 p983093983097C983090 p983091983097 D983091 p983093983089C983091 p983091983097

INTERVIEWING AND BEING INTERVIEWEDCan answer simple questions and respond to simple statements in an interview

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983089 p983090 A983090 p983089983091 B983092 p983092983095

A983091 p983089983091 D983089 p983093983089D983091 p983093983089

Overall spoken productionAt A983090 learners can give simple descriptions or presentations about everyday things as a short series of simplephrases and sentences linked into a list

SUSTAINED MONOLOGUE DESCRIBING EXPERIENCECan tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal ex periencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects and possessionsCan explain what they like or dislike about something

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090B983091 p983093 A983091 p983089983091 B983092 p983090983093 B983092 p983092983095 D983091 p983094983089 C983089 p983095983088 D983089 p983096983090 A983089 p983096983094

D983089 p983089983096 D983091 p983090983097 C983089 p983092983096 D983090 p983096983091 A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983095 of 983090

SECOND EDITION

Writing

Overall written production and interaction

At A983090 learners can write a series of simple phrases and sentences linked with simple connectors like and but and

because

OVERALL WRITTEN PRODUCTIONCan write short simple formulaic notes relating to matters in areas of immediate need

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983091 p983089983097 D983091 p983090983097 D983090 p983092983089

CORRESPONDENCECan write very simple personal letters emails etc

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983092983089 D983090 p983095983091

CREATIVE WRITINGCan write very short basic descriptions of events past activities and personal experiences

Can write a series of simple phrases and sentences about everyday andor personal matters (eg family people places a job or study experience livingconditions educational background present or most recent job)

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983096 A983091 p983089983091 A983090 p983091983093 C983089 p983092983096 D983091 p983094983089 D983091 p983096983091 B983089 p983096983096 D983091 p983089983088983093 B983089 p983089983089983088 D983090 p983089983090983093

D983091 p983089983097 D983091 p983093983089 D983091 p983097983091 D983093 p983089983089983093

COHERENCECan use the most frequently occurring connectors to link simple sentences and phrases in order to tell a story or describe something as a simplelist of points

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983096 D983091 p983089983097 D983091 p983090983097 D983091 p983093983089 D983091 p983096983091 D983091 p983097983091 D983091 p983089983088983093 D983090 p983089983090983093

Communicative language competence

VOCABULARY RANGECan understand high frequency job-related or e veryday languageHas sufficient vocabulary to conduct routine everyday tr ansactions and express basic communicative and survival needs

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090B983091 p983093 B983089 p983089983092 B983089 p983090983092 A983089 p983091983092 B983091 p983092983095 B983089 p983093983094 B983089 p983094983096 B983089 p983095983096 B983089 p983096983096 B983089 p983089983088983088 B983091 p983089983089983088 B983089 p983089983090983088

C983089 p983091983096 D983089 p983093983088 C983089 p983089983089983090

GRAMMATICAL ACCURACY Use some simple structures correctly but still systematically make basic mistakes (eg tend to mix up tenses and forget to mark agreement)

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983091 p983091 A983089 p983089983090 A983089 p983090983090 A983090 p983091983093 A983090 p983092983093 A983090 p983093983093 A983089 p983094983094 A983089 p983095983094 A983089 p983096983094 A983089 p983097983096 A983090 p983089983088983097 A983090 p983089983089983097B983090 p983092 A983090 p983089983091 A983090 p983090983091 B983091 p983091983095 B983089 p983092983094 B983089 p983093983094 A983090 p983094983095 A983090 p983095983095 A983090 p983096983095 A983090 p983097983097 B983091 p983089983089983089 B983090 p983089983090983089

B983092 p983089983093 B983092 p983090983093 B983090 p983092983094 B983090 p983093983095 B983091 p983094983097 B983091 p983095983097 B983091 p983089983088983089 B983091 p983089983088983089 B983091 p983089983090983089

PHONOLOGICAL CONTROLPronunciation is generally clear enough to be understood despite a noticeable foreign accent but conversational partners will need to ask for repetition fromtime to time

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983090 B983090 p983089983092 B983089 p983090983092 A983089 p983091983092 A983090 p983092983093 A983091 p983093983093 A983089 p983094983094 A983089 p983095983094 A983091 p983096983095 A983091 p983097983097 A983089 p983089983088983096 A983091 p983089983089983097

B983091 p983089983093 B983090 p983090983092 A983091 p983091983093 A983091 p983092983093 B983089 p983093983094 A983091 p983094983095 A983091 p983095983095 B983089 p983096983096 B983089 p983089983088983088 A983091 p983089983088983097 B983089 p983089983090983088B983091 p983090983093 C983090 p983091983097 B983091 p983092983095 C983090 p983093983097 B983089 p983094983096 B983089 p983095983096 B983091 p983096983097 C983089 p983089983088983090 C983090 p983089983089983091 C983089 p983089983090983090

B983090 p983094983097 B983090 p983095983097 C983089 p983097983088 C983090 p983089983088983091B983091 p983095983097D983091 p983096983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983096 of 983090

SECOND EDITION

SOCIOLINGUISTIC APPROPRIATENESSCan handle very short social exchanges using everyday polite forms of greeting and address

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 C983089 p983089983094 C983089 p983090983094 D983090 p983092983089 C983089 p983096983088 C983089 p983097983088 C983089 p983089983088983090 C983089 p983089983090983090

C983091 p983090983095 C983090 p983096983089 C983091 p983097983089 C983090 p983089983088983091 C983090 p983089983090983091C983091 p983096983089 C983091 p983089983088983091 C983091 p983089983090983091

Communication strategies

TAKING THE FLOOR (TURNTAKING) COOPERATING ASKING FOR CLARIFICATION COMPENSATING

MONITORING amp REPAIRCan use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask very simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 C983089 p983090983094 C983089 p983091983096 C983089 p983092983096 C983089 p983093983097 C983090 p983095983089 C983089 p983089983088983090 C983089 p983089983089983090C983090 p983095 C983091 p983090983095 C983090 p983091983097 C983090 p983092983097 C983090 p983093983097 C983090 p983089983089983091D983089 p983096 C983091 p983092983097 C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983097 of 983090

SECOND EDITION

How each unit relates to the CEFR

Unit 983089

Skill Goal LessonListening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)A983092 p983091B983089 p983092C983091 p983095

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983089 p983094C983091 p983095

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983089 p983090C983089 p983094C983090 p983095C983091 p983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983091 p983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983090A983091 p983091A983092 p983091B983090 p983092

Can answer simple questions and respond to simple statements in an interview A983089 p983090

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983091 p983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday personal matters (eg familypeople places a job or study experience living conditions educational background present ormost recent job)

D983090 p983096

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983096

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983093

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983091 p983091B983090 p983092

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983094

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983094C983090 p983095D983089 p983096

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1022

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983088 of 983090983090

SECOND EDITION

Unit 983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg very basic personal

and family information shopping local geography and employment)

B983091 p983089983093

C983089 p983089983094C983091 p983089983095

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

D983090 p983089983097

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983089983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983089983096

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983096

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983089983094C983090 p983089983095C983091 p983089983095

Can participate in a discussion about everyday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

B983090 p983089983092C983091 p983089983095

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983091B983090 p983089983092D983090 p983089983097

Can answer simple questions and respond to simple statements in an interview A983090 p983089983091A983091 p983089983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

A983091 p983089983091D983089 p983089983096

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983089983097

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983091 p983089983091D983091 p983089983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983089983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983089983090A983090 p983089983091B983092 p983089983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983090 p983089983092B983091 p983089983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983094

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983089 of 983090983090

SECOND EDITION

Unit 983091

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983090983090

A983091 p983090983091B983091 p983090983093D983090 p983090983097

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983091 p983090983091

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983090983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983091 p983090983097

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983090983096D983091 p983090983097

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983090983094C983090 p983090983095C983091 p983090983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983090983091C983091 p983090983095D983089 p983090983096

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983090983090A983090 p983090983091A983091 p983090983091B983092 p983090983093C983089 p983090983094

Can tell a story as a simple list of pointsCan give short basic descriptions of

bull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983090983093D983091 p983090983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983090983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983090983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983090983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983090983090A983090 p983090983091

B983092 p983090983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983089 p983090983092B983090 p983090983092B983091 p983090983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983090983094C983091 p983090983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983090983094C983091 p983090983095

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1222

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983090 of 983090

SECOND EDITION

Unit 983092

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983091983092

B983090 p983091983095C983091 p983091983097D983090 p983092983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983092983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983091983096C983090 p983091983097

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983092983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983091983093A983091 p983091983093B983089 p983091983094B983091 p983091983095C983089 p983091983096C983090 p983091983097C983091 p983091983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983090 p983092983089

Can write very simple personal letters emails etc D983090 p983092983089

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983090 p983091983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

A983089 p983091983092C983089 p983091983096

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983091983093B983091 p983091983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983091983092A983091 p983091983093C983090 p983091983097

Can handle very short social exchanges using everyday polite forms of greeting and address D983090 p983092983089

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983091983096C983090 p983091983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1322

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983091 of 983090

SECOND EDITION

Unit 983093

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983092983092

B983089 p983092983094C983091 p983092983097D983090 p983093983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983093983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond invitations and apologiesCan say what they like and dislike

C983089 p983092983096C983090 p983092983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983092983093A983091 p983092983093B983092 p983092983095C983090 p983092983097C983091 p983092983097D983091 p983093983089

Can answer simple questions and respond to simple statements in an interview B983092 p983092983095D983089 p983093983089D983091 p983093983089

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983092983095C983089 p983092983096

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

C983089 p983092983096D983091 p983093983089

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983093983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983092983095D983089 p983093983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983092983093B983089 p983092983094B983090 p983092983094

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983092983093A983091 p983092983093B983091 p983092983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983092983096C983090 p983092983097C983091 p983092983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1422

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983092 of 983090

SECOND EDITION

Unit 983094

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983091 p983093983093

B983089 p983093983094B983091 p983093983095C983089 p983093983096C983091 p983093983097

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get from X to Y by foot or public transport

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Reading Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983094983088D983091 p983094983089

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983094983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983093983096C983090 p983093983097

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Can deal with common aspects of ever yday living such as travel ndash tourist information publictransport and accommodation shopping buying tickets and simple transactions in shops postoffices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the price

Can order a meal

C983091 p983093983097

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983093983092A983090 p983093983093B983090 p983093983095B983091 p983093983095C983091 p983093983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983091 p983094983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983093 of 983090983090

SECOND EDITION

Skill Goal Lesson

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983094983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983093983094

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983093983093B983089 p983093983094B983090 p983093983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983093983093B983089 p983093983094C983090 p983093983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983093983097C983090 p983093983097C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983094 of 983090

SECOND EDITION

Unit 983095

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983094983094

B983090 p983094983097C983089 p983095983088C983090 p983095983089C983091 p983095983089D983090 p983095983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983094983097C983089 p983095983088

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

D983090 p983095983091

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983090 p983095983091

Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983095983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983095983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations invitations and apologiesCan say what they like and dislike

A983090 p983094983095C983089 p983095983088C983090 p983095983089

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983094983095B983091 p983094983097C983089 p983095983088C983091 p983095983089

Can manage simple routine tasks such asbull asking for and providing things

bull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

B983091 p983094983097C983089 p983095983088

C983091 p983095983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983094983095C983089 p983095983088

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessions

Can use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

C983089 p983095983088

Writing Can write very simple personal letters emails etc D983090 p983095983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983095 of 983090

SECOND EDITION

Skill Goal Lesson

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983094983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement) A983089 p983094983094A983090 p983094983095B983091 p983094983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983094983094A983091 p983094983095B983089 p983094983096B983090 p983094983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983090 p983095983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983096 of 983090983090

SECOND EDITION

Unit 983096

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983095983094

B983090 p983095983097C983089 p983096983088C983090 p983096983089D983090 p983096983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983091 p983096983089

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983096983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologies

Can say what they like and dislike

C983089 p983096983088C983090 p983096983089C983091 p983096983089D983091 p983096983091

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983089 p983096983088C983090 p983096983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983095983095D983091 p983096983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983089 p983096983090D983090 p983096983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983096983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983096983091

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983095983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983095983094A983090 p983095983095B983091 p983095983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983095983094A983091 p983095983095B983089 p983095983096B983090 p983095983097B983091 p983095983097D983091 p983096983091

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983096983088C983090 p983096983089C983091 p983096983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983097 of 983090

SECOND EDITION

Unit 983097

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983096983094

A983091 p983096983095B983090 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089D983090 p983097983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983096983097

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983097983090D983091 p983097983091

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

B983091 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

B983089 p983096983096B983091 p983096983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessions

Can explain what they like or dislike about something

A983089 p983096983094A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

B983089 p983096983096D983091 p983097983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983097983091

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983096983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983096983094A983090 p983096983095B983091 p983089983088983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983096983095B983089 p983096983096

B983091 p983096983097C983089 p983097983088

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983097983088C983091 p983097983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 422

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983092 of 983090

SECOND EDITION

CEFR goals realized in this level of Touchstone

Listening

At A983090 learners can understand speech that

is clearly and slowly articulated

concerns predictable everyday matters

OVERALL LISTENING COMPREHENSIONCan understand phrases and expressions related to very familiar topics (eg basic personal and family information shopping local geographyand employment)

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983092 p983091 B983091 p983089983093 A983089 p983090983090 A983089 p983091983092 A983089 p983092983092 A983091 p983093983093 A983089 p983094983094 A983089 p983095983094 A983089 p983096983094 A983089 p983097983096 A983089 p983089983088983096 A983089 p983089983089983096B983089 p983092 C983089 p983089983094 A983091 p983090983091 B983090 p983091983095 B983089 p983092983094 B983089 p983093983094 B983090 p983094983097 B983090 p983095983097 A983091 p983096983095 B983089 p983089983088983088 B983090 p983089983089983089 B983089 p983089983090983089C983091 p983095 C983091 p983089983095 B983091 p983090983093 C983091 p983091983097 C983091 p983092983097 B983091 p983093983095 C983089 p983095983088 C983089 p983096983088 B983090 p983096983097 B983090 p983089983088983089 C983089 p983089983089983090 C983089 p983089983090983090

D983090 p983090983097 D983090 p983092983089 D983090 p983093983089 C983089 p983093983096 C983090 p983095983089 C983090 p983096983089 C983089 p983097983088 C983089 p983089983088983090 C983091 p983089983089983091 C983091 p983089983090983091C983091 p983093983097 C983091 p983095983089 D983090 p983096983091 C983090 p983097983089 C983090 p983089983088983091 D983090 p983089983089983093 D983090 p983089983090983093

D983090 p983095983091 C983091 p983097983089 C983091 p983089983088983091D983090 p983097983091 D983090 p983089983088983093

UNDERSTANDING INTERACTIONCan generally identify the topic of discussion around them as log as it is conducted slowly and clearly

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 D983090 p983089983097 A983091 p983090983091 B983090 p983094983097 C983091 p983096983089 B983090 p983096983097 B983089 p983089983088983088 A983089 p983089983088983096 B983090 p983089983090983089C983091 p983095 C983089 p983095983088 C983089 p983089983088983089 B983090 p983089983089983089 C983089 p983089983090983090

C983091 p983089983088983091 C983089 p983089983089983090 C983091 p983089983090983091C983091 p983089983089983091 D983090 p983089983090983093D983090 p983089983089983093

LISTENING TO ANNOUNCEMENTS amp INSTRUCTIONSCan catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get from X to Y by foot or public transport

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983093983093 C983091 p983089983090983091B983090 p983093983095B983091 p983093983095

LISTENING TO MEDIA amp RECORDINGSCan understand and extract the essential information from short recorded passagesCan identify the main point of TV news items reporting events accidents etc where the visual supports the commentary

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983089 p983089983090 A983089 p983090983090 D983090 p983095983091

Reading

At A983090 learners can understand short simple texts on familiar topics which use high frequency vocabulary

READING CORRESPONDENCECan understand basic types of standard routine letters emails short simple personal letters etc

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983089 p983089983096 D983091 p983090983097 D983090 p983095983091 D983089 p983096983088

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983093 of 983090

SECOND EDITION

READING FOR ORIENTATIONCan find specific predictable information in simple everyday material such as advertisements websites catalogs menus reference lists and timetablesCan understand everyday signs and notices in public places

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983089 p983094983088 D983089 p983095983088D983091 p983094983089

READING FOR INFORMATION amp ARGUMENTCan identify specific information in simple written material such as letters brochures and short newspaper or online articles

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983089 p983096 D983089 p983089983096 D983089 p983090983096 D983089 p983092983088 D983089 p983093983088 D983089 p983094983088 D983089 p983095983088 D983089 p983096983088 D983089 p983097983090 D983089 p983089983088983092 D983089 p983089983089983092 D983089 p983089983090983092

D983091 p983090983097 D983091 p983097983091 D983091 p983089983088983093

Speaking

Overall spoken interactionAt A983090 learners can manage simple routine exchanges fairly easily but struggle with extended conversations andoften need help with understanding They can

ask and answer questions and exchange ideas and information on familiar topics in predictable everyday situations

handle very short social exchanges and simple transactions mostly understand speech in a standard accent directed at them which is delivered slowly and clearly provided they can

ask for repetition or reformulation from time to time

CONVERSATIONCan use simple everyday polite forms of g reeting address farewell introduction and giving thanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983089 p983090 C983089 p983089983094 C983089 p983090983094 C983089 p983091983096 C983089 p983092983096 C983089 p983093983096 A983090 p983094983095 C983089 p983096983088 B983091 p983096983097 A983091 p983097983097 A983090 p983089983088983097 A983091 p983089983089983097C983089 p983094 C983090 p983089983095 C983090 p983090983095 C983090 p983091983097 C983090 p983092983097 C983090 p983093983097 C983089 p983095983088 C983090 p983096983089 C983089 p983097983088 B983089 p983089983088983088 C983089 p983089983089983090 C983089 p983089983090983090C983090 p983095 C983091 p983089983095 C983091 p983090983095 C983090 p983095983089 C983091 p983096983089 C983090 p983097983089 C983089 p983089983088983090 C983090 p983089983089983091 C983090 p983089983090983091C983091 p983095 D983091 p983096983091 C983091 p983097983089 C983090 p983089983088983091 C983091 p983089983089983091

C983091 p983089983088983091

INFORMAL DISCUSSION (WITH FRIENDS)Can participate in a discussion about everyday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983091 p983097 B983090 p983089983092 A983091 p983090983091 D983089 p983092983089 A983091 p983094983095 A983090 p983097983097 D983089 p983089983090983093

C983091 p983089983095 C983091 p983090983095 B983091 p983094983097 B983091 p983089983088983089 D983090 p983089983090983093D983089 p983090983096 C983089 p983095983088 D983090 p983089983088983093

C983091 p983095983089 D983091 p983089983088983093

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983094 of 983090

SECOND EDITION

GOAL-ORIENTED COOPERATION (EG REPAIRING A CAR DISCUSSING A DOCUMENT OR ORGANIZING

AN EVENT)Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do next

bull making and responding to suggestionsbull asking for and giving directions

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983093983093 B983091 p983094983097 C983089 p983096983088 C983091 p983089983090983091B983090 p983093983095 C983089 p983095983088 C983090 p983096983089B983091 p983093983095 C983091 p983095983089

TRANSACTIONS TO OBTAIN GOODS amp SERVICESCan deal with common aspects of everyday living such as travel ndash tourist information public transport and accommodation shopping buying tickets andsimple transactions in shops post offices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the priceCan order a meal

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983091 p983093983097

INFORMATION EXCHANGECan ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange of informationCan exchange limited information on familiar and routine operational matters

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983090 A983091 p983089983091 A983089 p983090983090 A983090 p983091983093 A983090 p983092983093 A983089 p983093983092 A983090 p983094983095 A983091 p983095983095 B983089 p983096983096 C983091 p983089983088983091 A983091 p983089983088983097 A983089 p983089983089983097A983091 p983091 B983090 p983089983092 A983090 p983090983091 A983091 p983091983093 A983091 p983092983093 A983090 p983093983093 C983089 p983095983088 D983091 p983096983091 B983091 p983096983097 B983091 p983089983089983089 B983091 p983089983090983089A983092 p983091 D983090 p983089983097 A983091 p983090983091 B983089 p983091983094 B983092 p983092983095 B983090 p983093983095 D983091 p983089983089983093 C983089 p983089983090983090B983090 p983092 B983092 p983090983093 B983091 p983091983095 C983090 p983092983097 B983091 p983093983095

C983089 p983090983094 C983089 p983091983096 C983091 p983092983097 C983091 p983093983097C983090 p983091983097 D983091 p983093983089C983091 p983091983097

INTERVIEWING AND BEING INTERVIEWEDCan answer simple questions and respond to simple statements in an interview

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983089 p983090 A983090 p983089983091 B983092 p983092983095

A983091 p983089983091 D983089 p983093983089D983091 p983093983089

Overall spoken productionAt A983090 learners can give simple descriptions or presentations about everyday things as a short series of simplephrases and sentences linked into a list

SUSTAINED MONOLOGUE DESCRIBING EXPERIENCECan tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal ex periencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects and possessionsCan explain what they like or dislike about something

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090B983091 p983093 A983091 p983089983091 B983092 p983090983093 B983092 p983092983095 D983091 p983094983089 C983089 p983095983088 D983089 p983096983090 A983089 p983096983094

D983089 p983089983096 D983091 p983090983097 C983089 p983092983096 D983090 p983096983091 A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983095 of 983090

SECOND EDITION

Writing

Overall written production and interaction

At A983090 learners can write a series of simple phrases and sentences linked with simple connectors like and but and

because

OVERALL WRITTEN PRODUCTIONCan write short simple formulaic notes relating to matters in areas of immediate need

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983091 p983089983097 D983091 p983090983097 D983090 p983092983089

CORRESPONDENCECan write very simple personal letters emails etc

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983092983089 D983090 p983095983091

CREATIVE WRITINGCan write very short basic descriptions of events past activities and personal experiences

Can write a series of simple phrases and sentences about everyday andor personal matters (eg family people places a job or study experience livingconditions educational background present or most recent job)

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983096 A983091 p983089983091 A983090 p983091983093 C983089 p983092983096 D983091 p983094983089 D983091 p983096983091 B983089 p983096983096 D983091 p983089983088983093 B983089 p983089983089983088 D983090 p983089983090983093

D983091 p983089983097 D983091 p983093983089 D983091 p983097983091 D983093 p983089983089983093

COHERENCECan use the most frequently occurring connectors to link simple sentences and phrases in order to tell a story or describe something as a simplelist of points

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983096 D983091 p983089983097 D983091 p983090983097 D983091 p983093983089 D983091 p983096983091 D983091 p983097983091 D983091 p983089983088983093 D983090 p983089983090983093

Communicative language competence

VOCABULARY RANGECan understand high frequency job-related or e veryday languageHas sufficient vocabulary to conduct routine everyday tr ansactions and express basic communicative and survival needs

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090B983091 p983093 B983089 p983089983092 B983089 p983090983092 A983089 p983091983092 B983091 p983092983095 B983089 p983093983094 B983089 p983094983096 B983089 p983095983096 B983089 p983096983096 B983089 p983089983088983088 B983091 p983089983089983088 B983089 p983089983090983088

C983089 p983091983096 D983089 p983093983088 C983089 p983089983089983090

GRAMMATICAL ACCURACY Use some simple structures correctly but still systematically make basic mistakes (eg tend to mix up tenses and forget to mark agreement)

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983091 p983091 A983089 p983089983090 A983089 p983090983090 A983090 p983091983093 A983090 p983092983093 A983090 p983093983093 A983089 p983094983094 A983089 p983095983094 A983089 p983096983094 A983089 p983097983096 A983090 p983089983088983097 A983090 p983089983089983097B983090 p983092 A983090 p983089983091 A983090 p983090983091 B983091 p983091983095 B983089 p983092983094 B983089 p983093983094 A983090 p983094983095 A983090 p983095983095 A983090 p983096983095 A983090 p983097983097 B983091 p983089983089983089 B983090 p983089983090983089

B983092 p983089983093 B983092 p983090983093 B983090 p983092983094 B983090 p983093983095 B983091 p983094983097 B983091 p983095983097 B983091 p983089983088983089 B983091 p983089983088983089 B983091 p983089983090983089

PHONOLOGICAL CONTROLPronunciation is generally clear enough to be understood despite a noticeable foreign accent but conversational partners will need to ask for repetition fromtime to time

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983090 B983090 p983089983092 B983089 p983090983092 A983089 p983091983092 A983090 p983092983093 A983091 p983093983093 A983089 p983094983094 A983089 p983095983094 A983091 p983096983095 A983091 p983097983097 A983089 p983089983088983096 A983091 p983089983089983097

B983091 p983089983093 B983090 p983090983092 A983091 p983091983093 A983091 p983092983093 B983089 p983093983094 A983091 p983094983095 A983091 p983095983095 B983089 p983096983096 B983089 p983089983088983088 A983091 p983089983088983097 B983089 p983089983090983088B983091 p983090983093 C983090 p983091983097 B983091 p983092983095 C983090 p983093983097 B983089 p983094983096 B983089 p983095983096 B983091 p983096983097 C983089 p983089983088983090 C983090 p983089983089983091 C983089 p983089983090983090

B983090 p983094983097 B983090 p983095983097 C983089 p983097983088 C983090 p983089983088983091B983091 p983095983097D983091 p983096983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983096 of 983090

SECOND EDITION

SOCIOLINGUISTIC APPROPRIATENESSCan handle very short social exchanges using everyday polite forms of greeting and address

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 C983089 p983089983094 C983089 p983090983094 D983090 p983092983089 C983089 p983096983088 C983089 p983097983088 C983089 p983089983088983090 C983089 p983089983090983090

C983091 p983090983095 C983090 p983096983089 C983091 p983097983089 C983090 p983089983088983091 C983090 p983089983090983091C983091 p983096983089 C983091 p983089983088983091 C983091 p983089983090983091

Communication strategies

TAKING THE FLOOR (TURNTAKING) COOPERATING ASKING FOR CLARIFICATION COMPENSATING

MONITORING amp REPAIRCan use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask very simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 C983089 p983090983094 C983089 p983091983096 C983089 p983092983096 C983089 p983093983097 C983090 p983095983089 C983089 p983089983088983090 C983089 p983089983089983090C983090 p983095 C983091 p983090983095 C983090 p983091983097 C983090 p983092983097 C983090 p983093983097 C983090 p983089983089983091D983089 p983096 C983091 p983092983097 C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983097 of 983090

SECOND EDITION

How each unit relates to the CEFR

Unit 983089

Skill Goal LessonListening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)A983092 p983091B983089 p983092C983091 p983095

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983089 p983094C983091 p983095

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983089 p983090C983089 p983094C983090 p983095C983091 p983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983091 p983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983090A983091 p983091A983092 p983091B983090 p983092

Can answer simple questions and respond to simple statements in an interview A983089 p983090

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983091 p983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday personal matters (eg familypeople places a job or study experience living conditions educational background present ormost recent job)

D983090 p983096

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983096

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983093

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983091 p983091B983090 p983092

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983094

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983094C983090 p983095D983089 p983096

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1022

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983088 of 983090983090

SECOND EDITION

Unit 983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg very basic personal

and family information shopping local geography and employment)

B983091 p983089983093

C983089 p983089983094C983091 p983089983095

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

D983090 p983089983097

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983089983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983089983096

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983096

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983089983094C983090 p983089983095C983091 p983089983095

Can participate in a discussion about everyday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

B983090 p983089983092C983091 p983089983095

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983091B983090 p983089983092D983090 p983089983097

Can answer simple questions and respond to simple statements in an interview A983090 p983089983091A983091 p983089983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

A983091 p983089983091D983089 p983089983096

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983089983097

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983091 p983089983091D983091 p983089983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983089983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983089983090A983090 p983089983091B983092 p983089983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983090 p983089983092B983091 p983089983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983094

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983089 of 983090983090

SECOND EDITION

Unit 983091

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983090983090

A983091 p983090983091B983091 p983090983093D983090 p983090983097

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983091 p983090983091

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983090983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983091 p983090983097

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983090983096D983091 p983090983097

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983090983094C983090 p983090983095C983091 p983090983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983090983091C983091 p983090983095D983089 p983090983096

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983090983090A983090 p983090983091A983091 p983090983091B983092 p983090983093C983089 p983090983094

Can tell a story as a simple list of pointsCan give short basic descriptions of

bull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983090983093D983091 p983090983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983090983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983090983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983090983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983090983090A983090 p983090983091

B983092 p983090983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983089 p983090983092B983090 p983090983092B983091 p983090983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983090983094C983091 p983090983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983090983094C983091 p983090983095

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1222

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983090 of 983090

SECOND EDITION

Unit 983092

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983091983092

B983090 p983091983095C983091 p983091983097D983090 p983092983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983092983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983091983096C983090 p983091983097

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983092983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983091983093A983091 p983091983093B983089 p983091983094B983091 p983091983095C983089 p983091983096C983090 p983091983097C983091 p983091983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983090 p983092983089

Can write very simple personal letters emails etc D983090 p983092983089

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983090 p983091983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

A983089 p983091983092C983089 p983091983096

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983091983093B983091 p983091983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983091983092A983091 p983091983093C983090 p983091983097

Can handle very short social exchanges using everyday polite forms of greeting and address D983090 p983092983089

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983091983096C983090 p983091983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1322

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983091 of 983090

SECOND EDITION

Unit 983093

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983092983092

B983089 p983092983094C983091 p983092983097D983090 p983093983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983093983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond invitations and apologiesCan say what they like and dislike

C983089 p983092983096C983090 p983092983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983092983093A983091 p983092983093B983092 p983092983095C983090 p983092983097C983091 p983092983097D983091 p983093983089

Can answer simple questions and respond to simple statements in an interview B983092 p983092983095D983089 p983093983089D983091 p983093983089

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983092983095C983089 p983092983096

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

C983089 p983092983096D983091 p983093983089

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983093983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983092983095D983089 p983093983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983092983093B983089 p983092983094B983090 p983092983094

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983092983093A983091 p983092983093B983091 p983092983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983092983096C983090 p983092983097C983091 p983092983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1422

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983092 of 983090

SECOND EDITION

Unit 983094

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983091 p983093983093

B983089 p983093983094B983091 p983093983095C983089 p983093983096C983091 p983093983097

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get from X to Y by foot or public transport

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Reading Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983094983088D983091 p983094983089

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983094983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983093983096C983090 p983093983097

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Can deal with common aspects of ever yday living such as travel ndash tourist information publictransport and accommodation shopping buying tickets and simple transactions in shops postoffices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the price

Can order a meal

C983091 p983093983097

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983093983092A983090 p983093983093B983090 p983093983095B983091 p983093983095C983091 p983093983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983091 p983094983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983093 of 983090983090

SECOND EDITION

Skill Goal Lesson

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983094983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983093983094

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983093983093B983089 p983093983094B983090 p983093983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983093983093B983089 p983093983094C983090 p983093983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983093983097C983090 p983093983097C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983094 of 983090

SECOND EDITION

Unit 983095

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983094983094

B983090 p983094983097C983089 p983095983088C983090 p983095983089C983091 p983095983089D983090 p983095983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983094983097C983089 p983095983088

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

D983090 p983095983091

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983090 p983095983091

Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983095983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983095983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations invitations and apologiesCan say what they like and dislike

A983090 p983094983095C983089 p983095983088C983090 p983095983089

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983094983095B983091 p983094983097C983089 p983095983088C983091 p983095983089

Can manage simple routine tasks such asbull asking for and providing things

bull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

B983091 p983094983097C983089 p983095983088

C983091 p983095983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983094983095C983089 p983095983088

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessions

Can use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

C983089 p983095983088

Writing Can write very simple personal letters emails etc D983090 p983095983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983095 of 983090

SECOND EDITION

Skill Goal Lesson

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983094983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement) A983089 p983094983094A983090 p983094983095B983091 p983094983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983094983094A983091 p983094983095B983089 p983094983096B983090 p983094983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983090 p983095983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983096 of 983090983090

SECOND EDITION

Unit 983096

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983095983094

B983090 p983095983097C983089 p983096983088C983090 p983096983089D983090 p983096983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983091 p983096983089

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983096983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologies

Can say what they like and dislike

C983089 p983096983088C983090 p983096983089C983091 p983096983089D983091 p983096983091

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983089 p983096983088C983090 p983096983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983095983095D983091 p983096983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983089 p983096983090D983090 p983096983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983096983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983096983091

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983095983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983095983094A983090 p983095983095B983091 p983095983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983095983094A983091 p983095983095B983089 p983095983096B983090 p983095983097B983091 p983095983097D983091 p983096983091

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983096983088C983090 p983096983089C983091 p983096983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983097 of 983090

SECOND EDITION

Unit 983097

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983096983094

A983091 p983096983095B983090 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089D983090 p983097983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983096983097

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983097983090D983091 p983097983091

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

B983091 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

B983089 p983096983096B983091 p983096983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessions

Can explain what they like or dislike about something

A983089 p983096983094A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

B983089 p983096983096D983091 p983097983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983097983091

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983096983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983096983094A983090 p983096983095B983091 p983089983088983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983096983095B983089 p983096983096

B983091 p983096983097C983089 p983097983088

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983097983088C983091 p983097983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983093 of 983090

SECOND EDITION

READING FOR ORIENTATIONCan find specific predictable information in simple everyday material such as advertisements websites catalogs menus reference lists and timetablesCan understand everyday signs and notices in public places

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983089 p983094983088 D983089 p983095983088D983091 p983094983089

READING FOR INFORMATION amp ARGUMENTCan identify specific information in simple written material such as letters brochures and short newspaper or online articles

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983089 p983096 D983089 p983089983096 D983089 p983090983096 D983089 p983092983088 D983089 p983093983088 D983089 p983094983088 D983089 p983095983088 D983089 p983096983088 D983089 p983097983090 D983089 p983089983088983092 D983089 p983089983089983092 D983089 p983089983090983092

D983091 p983090983097 D983091 p983097983091 D983091 p983089983088983093

Speaking

Overall spoken interactionAt A983090 learners can manage simple routine exchanges fairly easily but struggle with extended conversations andoften need help with understanding They can

ask and answer questions and exchange ideas and information on familiar topics in predictable everyday situations

handle very short social exchanges and simple transactions mostly understand speech in a standard accent directed at them which is delivered slowly and clearly provided they can

ask for repetition or reformulation from time to time

CONVERSATIONCan use simple everyday polite forms of g reeting address farewell introduction and giving thanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983089 p983090 C983089 p983089983094 C983089 p983090983094 C983089 p983091983096 C983089 p983092983096 C983089 p983093983096 A983090 p983094983095 C983089 p983096983088 B983091 p983096983097 A983091 p983097983097 A983090 p983089983088983097 A983091 p983089983089983097C983089 p983094 C983090 p983089983095 C983090 p983090983095 C983090 p983091983097 C983090 p983092983097 C983090 p983093983097 C983089 p983095983088 C983090 p983096983089 C983089 p983097983088 B983089 p983089983088983088 C983089 p983089983089983090 C983089 p983089983090983090C983090 p983095 C983091 p983089983095 C983091 p983090983095 C983090 p983095983089 C983091 p983096983089 C983090 p983097983089 C983089 p983089983088983090 C983090 p983089983089983091 C983090 p983089983090983091C983091 p983095 D983091 p983096983091 C983091 p983097983089 C983090 p983089983088983091 C983091 p983089983089983091

C983091 p983089983088983091

INFORMAL DISCUSSION (WITH FRIENDS)Can participate in a discussion about everyday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983091 p983097 B983090 p983089983092 A983091 p983090983091 D983089 p983092983089 A983091 p983094983095 A983090 p983097983097 D983089 p983089983090983093

C983091 p983089983095 C983091 p983090983095 B983091 p983094983097 B983091 p983089983088983089 D983090 p983089983090983093D983089 p983090983096 C983089 p983095983088 D983090 p983089983088983093

C983091 p983095983089 D983091 p983089983088983093

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983094 of 983090

SECOND EDITION

GOAL-ORIENTED COOPERATION (EG REPAIRING A CAR DISCUSSING A DOCUMENT OR ORGANIZING

AN EVENT)Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do next

bull making and responding to suggestionsbull asking for and giving directions

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983093983093 B983091 p983094983097 C983089 p983096983088 C983091 p983089983090983091B983090 p983093983095 C983089 p983095983088 C983090 p983096983089B983091 p983093983095 C983091 p983095983089

TRANSACTIONS TO OBTAIN GOODS amp SERVICESCan deal with common aspects of everyday living such as travel ndash tourist information public transport and accommodation shopping buying tickets andsimple transactions in shops post offices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the priceCan order a meal

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983091 p983093983097

INFORMATION EXCHANGECan ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange of informationCan exchange limited information on familiar and routine operational matters

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983090 A983091 p983089983091 A983089 p983090983090 A983090 p983091983093 A983090 p983092983093 A983089 p983093983092 A983090 p983094983095 A983091 p983095983095 B983089 p983096983096 C983091 p983089983088983091 A983091 p983089983088983097 A983089 p983089983089983097A983091 p983091 B983090 p983089983092 A983090 p983090983091 A983091 p983091983093 A983091 p983092983093 A983090 p983093983093 C983089 p983095983088 D983091 p983096983091 B983091 p983096983097 B983091 p983089983089983089 B983091 p983089983090983089A983092 p983091 D983090 p983089983097 A983091 p983090983091 B983089 p983091983094 B983092 p983092983095 B983090 p983093983095 D983091 p983089983089983093 C983089 p983089983090983090B983090 p983092 B983092 p983090983093 B983091 p983091983095 C983090 p983092983097 B983091 p983093983095

C983089 p983090983094 C983089 p983091983096 C983091 p983092983097 C983091 p983093983097C983090 p983091983097 D983091 p983093983089C983091 p983091983097

INTERVIEWING AND BEING INTERVIEWEDCan answer simple questions and respond to simple statements in an interview

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983089 p983090 A983090 p983089983091 B983092 p983092983095

A983091 p983089983091 D983089 p983093983089D983091 p983093983089

Overall spoken productionAt A983090 learners can give simple descriptions or presentations about everyday things as a short series of simplephrases and sentences linked into a list

SUSTAINED MONOLOGUE DESCRIBING EXPERIENCECan tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal ex periencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects and possessionsCan explain what they like or dislike about something

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090B983091 p983093 A983091 p983089983091 B983092 p983090983093 B983092 p983092983095 D983091 p983094983089 C983089 p983095983088 D983089 p983096983090 A983089 p983096983094

D983089 p983089983096 D983091 p983090983097 C983089 p983092983096 D983090 p983096983091 A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983095 of 983090

SECOND EDITION

Writing

Overall written production and interaction

At A983090 learners can write a series of simple phrases and sentences linked with simple connectors like and but and

because

OVERALL WRITTEN PRODUCTIONCan write short simple formulaic notes relating to matters in areas of immediate need

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983091 p983089983097 D983091 p983090983097 D983090 p983092983089

CORRESPONDENCECan write very simple personal letters emails etc

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983092983089 D983090 p983095983091

CREATIVE WRITINGCan write very short basic descriptions of events past activities and personal experiences

Can write a series of simple phrases and sentences about everyday andor personal matters (eg family people places a job or study experience livingconditions educational background present or most recent job)

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983096 A983091 p983089983091 A983090 p983091983093 C983089 p983092983096 D983091 p983094983089 D983091 p983096983091 B983089 p983096983096 D983091 p983089983088983093 B983089 p983089983089983088 D983090 p983089983090983093

D983091 p983089983097 D983091 p983093983089 D983091 p983097983091 D983093 p983089983089983093

COHERENCECan use the most frequently occurring connectors to link simple sentences and phrases in order to tell a story or describe something as a simplelist of points

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983096 D983091 p983089983097 D983091 p983090983097 D983091 p983093983089 D983091 p983096983091 D983091 p983097983091 D983091 p983089983088983093 D983090 p983089983090983093

Communicative language competence

VOCABULARY RANGECan understand high frequency job-related or e veryday languageHas sufficient vocabulary to conduct routine everyday tr ansactions and express basic communicative and survival needs

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090B983091 p983093 B983089 p983089983092 B983089 p983090983092 A983089 p983091983092 B983091 p983092983095 B983089 p983093983094 B983089 p983094983096 B983089 p983095983096 B983089 p983096983096 B983089 p983089983088983088 B983091 p983089983089983088 B983089 p983089983090983088

C983089 p983091983096 D983089 p983093983088 C983089 p983089983089983090

GRAMMATICAL ACCURACY Use some simple structures correctly but still systematically make basic mistakes (eg tend to mix up tenses and forget to mark agreement)

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983091 p983091 A983089 p983089983090 A983089 p983090983090 A983090 p983091983093 A983090 p983092983093 A983090 p983093983093 A983089 p983094983094 A983089 p983095983094 A983089 p983096983094 A983089 p983097983096 A983090 p983089983088983097 A983090 p983089983089983097B983090 p983092 A983090 p983089983091 A983090 p983090983091 B983091 p983091983095 B983089 p983092983094 B983089 p983093983094 A983090 p983094983095 A983090 p983095983095 A983090 p983096983095 A983090 p983097983097 B983091 p983089983089983089 B983090 p983089983090983089

B983092 p983089983093 B983092 p983090983093 B983090 p983092983094 B983090 p983093983095 B983091 p983094983097 B983091 p983095983097 B983091 p983089983088983089 B983091 p983089983088983089 B983091 p983089983090983089

PHONOLOGICAL CONTROLPronunciation is generally clear enough to be understood despite a noticeable foreign accent but conversational partners will need to ask for repetition fromtime to time

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983090 B983090 p983089983092 B983089 p983090983092 A983089 p983091983092 A983090 p983092983093 A983091 p983093983093 A983089 p983094983094 A983089 p983095983094 A983091 p983096983095 A983091 p983097983097 A983089 p983089983088983096 A983091 p983089983089983097

B983091 p983089983093 B983090 p983090983092 A983091 p983091983093 A983091 p983092983093 B983089 p983093983094 A983091 p983094983095 A983091 p983095983095 B983089 p983096983096 B983089 p983089983088983088 A983091 p983089983088983097 B983089 p983089983090983088B983091 p983090983093 C983090 p983091983097 B983091 p983092983095 C983090 p983093983097 B983089 p983094983096 B983089 p983095983096 B983091 p983096983097 C983089 p983089983088983090 C983090 p983089983089983091 C983089 p983089983090983090

B983090 p983094983097 B983090 p983095983097 C983089 p983097983088 C983090 p983089983088983091B983091 p983095983097D983091 p983096983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983096 of 983090

SECOND EDITION

SOCIOLINGUISTIC APPROPRIATENESSCan handle very short social exchanges using everyday polite forms of greeting and address

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 C983089 p983089983094 C983089 p983090983094 D983090 p983092983089 C983089 p983096983088 C983089 p983097983088 C983089 p983089983088983090 C983089 p983089983090983090

C983091 p983090983095 C983090 p983096983089 C983091 p983097983089 C983090 p983089983088983091 C983090 p983089983090983091C983091 p983096983089 C983091 p983089983088983091 C983091 p983089983090983091

Communication strategies

TAKING THE FLOOR (TURNTAKING) COOPERATING ASKING FOR CLARIFICATION COMPENSATING

MONITORING amp REPAIRCan use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask very simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 C983089 p983090983094 C983089 p983091983096 C983089 p983092983096 C983089 p983093983097 C983090 p983095983089 C983089 p983089983088983090 C983089 p983089983089983090C983090 p983095 C983091 p983090983095 C983090 p983091983097 C983090 p983092983097 C983090 p983093983097 C983090 p983089983089983091D983089 p983096 C983091 p983092983097 C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983097 of 983090

SECOND EDITION

How each unit relates to the CEFR

Unit 983089

Skill Goal LessonListening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)A983092 p983091B983089 p983092C983091 p983095

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983089 p983094C983091 p983095

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983089 p983090C983089 p983094C983090 p983095C983091 p983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983091 p983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983090A983091 p983091A983092 p983091B983090 p983092

Can answer simple questions and respond to simple statements in an interview A983089 p983090

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983091 p983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday personal matters (eg familypeople places a job or study experience living conditions educational background present ormost recent job)

D983090 p983096

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983096

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983093

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983091 p983091B983090 p983092

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983094

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983094C983090 p983095D983089 p983096

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1022

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983088 of 983090983090

SECOND EDITION

Unit 983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg very basic personal

and family information shopping local geography and employment)

B983091 p983089983093

C983089 p983089983094C983091 p983089983095

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

D983090 p983089983097

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983089983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983089983096

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983096

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983089983094C983090 p983089983095C983091 p983089983095

Can participate in a discussion about everyday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

B983090 p983089983092C983091 p983089983095

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983091B983090 p983089983092D983090 p983089983097

Can answer simple questions and respond to simple statements in an interview A983090 p983089983091A983091 p983089983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

A983091 p983089983091D983089 p983089983096

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983089983097

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983091 p983089983091D983091 p983089983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983089983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983089983090A983090 p983089983091B983092 p983089983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983090 p983089983092B983091 p983089983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983094

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983089 of 983090983090

SECOND EDITION

Unit 983091

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983090983090

A983091 p983090983091B983091 p983090983093D983090 p983090983097

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983091 p983090983091

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983090983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983091 p983090983097

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983090983096D983091 p983090983097

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983090983094C983090 p983090983095C983091 p983090983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983090983091C983091 p983090983095D983089 p983090983096

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983090983090A983090 p983090983091A983091 p983090983091B983092 p983090983093C983089 p983090983094

Can tell a story as a simple list of pointsCan give short basic descriptions of

bull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983090983093D983091 p983090983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983090983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983090983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983090983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983090983090A983090 p983090983091

B983092 p983090983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983089 p983090983092B983090 p983090983092B983091 p983090983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983090983094C983091 p983090983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983090983094C983091 p983090983095

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1222

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983090 of 983090

SECOND EDITION

Unit 983092

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983091983092

B983090 p983091983095C983091 p983091983097D983090 p983092983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983092983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983091983096C983090 p983091983097

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983092983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983091983093A983091 p983091983093B983089 p983091983094B983091 p983091983095C983089 p983091983096C983090 p983091983097C983091 p983091983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983090 p983092983089

Can write very simple personal letters emails etc D983090 p983092983089

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983090 p983091983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

A983089 p983091983092C983089 p983091983096

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983091983093B983091 p983091983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983091983092A983091 p983091983093C983090 p983091983097

Can handle very short social exchanges using everyday polite forms of greeting and address D983090 p983092983089

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983091983096C983090 p983091983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1322

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983091 of 983090

SECOND EDITION

Unit 983093

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983092983092

B983089 p983092983094C983091 p983092983097D983090 p983093983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983093983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond invitations and apologiesCan say what they like and dislike

C983089 p983092983096C983090 p983092983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983092983093A983091 p983092983093B983092 p983092983095C983090 p983092983097C983091 p983092983097D983091 p983093983089

Can answer simple questions and respond to simple statements in an interview B983092 p983092983095D983089 p983093983089D983091 p983093983089

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983092983095C983089 p983092983096

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

C983089 p983092983096D983091 p983093983089

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983093983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983092983095D983089 p983093983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983092983093B983089 p983092983094B983090 p983092983094

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983092983093A983091 p983092983093B983091 p983092983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983092983096C983090 p983092983097C983091 p983092983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1422

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983092 of 983090

SECOND EDITION

Unit 983094

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983091 p983093983093

B983089 p983093983094B983091 p983093983095C983089 p983093983096C983091 p983093983097

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get from X to Y by foot or public transport

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Reading Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983094983088D983091 p983094983089

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983094983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983093983096C983090 p983093983097

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Can deal with common aspects of ever yday living such as travel ndash tourist information publictransport and accommodation shopping buying tickets and simple transactions in shops postoffices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the price

Can order a meal

C983091 p983093983097

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983093983092A983090 p983093983093B983090 p983093983095B983091 p983093983095C983091 p983093983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983091 p983094983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983093 of 983090983090

SECOND EDITION

Skill Goal Lesson

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983094983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983093983094

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983093983093B983089 p983093983094B983090 p983093983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983093983093B983089 p983093983094C983090 p983093983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983093983097C983090 p983093983097C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983094 of 983090

SECOND EDITION

Unit 983095

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983094983094

B983090 p983094983097C983089 p983095983088C983090 p983095983089C983091 p983095983089D983090 p983095983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983094983097C983089 p983095983088

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

D983090 p983095983091

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983090 p983095983091

Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983095983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983095983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations invitations and apologiesCan say what they like and dislike

A983090 p983094983095C983089 p983095983088C983090 p983095983089

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983094983095B983091 p983094983097C983089 p983095983088C983091 p983095983089

Can manage simple routine tasks such asbull asking for and providing things

bull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

B983091 p983094983097C983089 p983095983088

C983091 p983095983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983094983095C983089 p983095983088

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessions

Can use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

C983089 p983095983088

Writing Can write very simple personal letters emails etc D983090 p983095983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983095 of 983090

SECOND EDITION

Skill Goal Lesson

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983094983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement) A983089 p983094983094A983090 p983094983095B983091 p983094983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983094983094A983091 p983094983095B983089 p983094983096B983090 p983094983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983090 p983095983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983096 of 983090983090

SECOND EDITION

Unit 983096

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983095983094

B983090 p983095983097C983089 p983096983088C983090 p983096983089D983090 p983096983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983091 p983096983089

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983096983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologies

Can say what they like and dislike

C983089 p983096983088C983090 p983096983089C983091 p983096983089D983091 p983096983091

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983089 p983096983088C983090 p983096983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983095983095D983091 p983096983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983089 p983096983090D983090 p983096983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983096983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983096983091

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983095983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983095983094A983090 p983095983095B983091 p983095983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983095983094A983091 p983095983095B983089 p983095983096B983090 p983095983097B983091 p983095983097D983091 p983096983091

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983096983088C983090 p983096983089C983091 p983096983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983097 of 983090

SECOND EDITION

Unit 983097

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983096983094

A983091 p983096983095B983090 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089D983090 p983097983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983096983097

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983097983090D983091 p983097983091

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

B983091 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

B983089 p983096983096B983091 p983096983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessions

Can explain what they like or dislike about something

A983089 p983096983094A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

B983089 p983096983096D983091 p983097983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983097983091

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983096983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983096983094A983090 p983096983095B983091 p983089983088983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983096983095B983089 p983096983096

B983091 p983096983097C983089 p983097983088

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983097983088C983091 p983097983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983094 of 983090

SECOND EDITION

GOAL-ORIENTED COOPERATION (EG REPAIRING A CAR DISCUSSING A DOCUMENT OR ORGANIZING

AN EVENT)Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do next

bull making and responding to suggestionsbull asking for and giving directions

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983093983093 B983091 p983094983097 C983089 p983096983088 C983091 p983089983090983091B983090 p983093983095 C983089 p983095983088 C983090 p983096983089B983091 p983093983095 C983091 p983095983089

TRANSACTIONS TO OBTAIN GOODS amp SERVICESCan deal with common aspects of everyday living such as travel ndash tourist information public transport and accommodation shopping buying tickets andsimple transactions in shops post offices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the priceCan order a meal

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983091 p983093983097

INFORMATION EXCHANGECan ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange of informationCan exchange limited information on familiar and routine operational matters

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983090 A983091 p983089983091 A983089 p983090983090 A983090 p983091983093 A983090 p983092983093 A983089 p983093983092 A983090 p983094983095 A983091 p983095983095 B983089 p983096983096 C983091 p983089983088983091 A983091 p983089983088983097 A983089 p983089983089983097A983091 p983091 B983090 p983089983092 A983090 p983090983091 A983091 p983091983093 A983091 p983092983093 A983090 p983093983093 C983089 p983095983088 D983091 p983096983091 B983091 p983096983097 B983091 p983089983089983089 B983091 p983089983090983089A983092 p983091 D983090 p983089983097 A983091 p983090983091 B983089 p983091983094 B983092 p983092983095 B983090 p983093983095 D983091 p983089983089983093 C983089 p983089983090983090B983090 p983092 B983092 p983090983093 B983091 p983091983095 C983090 p983092983097 B983091 p983093983095

C983089 p983090983094 C983089 p983091983096 C983091 p983092983097 C983091 p983093983097C983090 p983091983097 D983091 p983093983089C983091 p983091983097

INTERVIEWING AND BEING INTERVIEWEDCan answer simple questions and respond to simple statements in an interview

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983089 p983090 A983090 p983089983091 B983092 p983092983095

A983091 p983089983091 D983089 p983093983089D983091 p983093983089

Overall spoken productionAt A983090 learners can give simple descriptions or presentations about everyday things as a short series of simplephrases and sentences linked into a list

SUSTAINED MONOLOGUE DESCRIBING EXPERIENCECan tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal ex periencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects and possessionsCan explain what they like or dislike about something

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090B983091 p983093 A983091 p983089983091 B983092 p983090983093 B983092 p983092983095 D983091 p983094983089 C983089 p983095983088 D983089 p983096983090 A983089 p983096983094

D983089 p983089983096 D983091 p983090983097 C983089 p983092983096 D983090 p983096983091 A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983095 of 983090

SECOND EDITION

Writing

Overall written production and interaction

At A983090 learners can write a series of simple phrases and sentences linked with simple connectors like and but and

because

OVERALL WRITTEN PRODUCTIONCan write short simple formulaic notes relating to matters in areas of immediate need

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983091 p983089983097 D983091 p983090983097 D983090 p983092983089

CORRESPONDENCECan write very simple personal letters emails etc

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983092983089 D983090 p983095983091

CREATIVE WRITINGCan write very short basic descriptions of events past activities and personal experiences

Can write a series of simple phrases and sentences about everyday andor personal matters (eg family people places a job or study experience livingconditions educational background present or most recent job)

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983096 A983091 p983089983091 A983090 p983091983093 C983089 p983092983096 D983091 p983094983089 D983091 p983096983091 B983089 p983096983096 D983091 p983089983088983093 B983089 p983089983089983088 D983090 p983089983090983093

D983091 p983089983097 D983091 p983093983089 D983091 p983097983091 D983093 p983089983089983093

COHERENCECan use the most frequently occurring connectors to link simple sentences and phrases in order to tell a story or describe something as a simplelist of points

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983096 D983091 p983089983097 D983091 p983090983097 D983091 p983093983089 D983091 p983096983091 D983091 p983097983091 D983091 p983089983088983093 D983090 p983089983090983093

Communicative language competence

VOCABULARY RANGECan understand high frequency job-related or e veryday languageHas sufficient vocabulary to conduct routine everyday tr ansactions and express basic communicative and survival needs

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090B983091 p983093 B983089 p983089983092 B983089 p983090983092 A983089 p983091983092 B983091 p983092983095 B983089 p983093983094 B983089 p983094983096 B983089 p983095983096 B983089 p983096983096 B983089 p983089983088983088 B983091 p983089983089983088 B983089 p983089983090983088

C983089 p983091983096 D983089 p983093983088 C983089 p983089983089983090

GRAMMATICAL ACCURACY Use some simple structures correctly but still systematically make basic mistakes (eg tend to mix up tenses and forget to mark agreement)

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983091 p983091 A983089 p983089983090 A983089 p983090983090 A983090 p983091983093 A983090 p983092983093 A983090 p983093983093 A983089 p983094983094 A983089 p983095983094 A983089 p983096983094 A983089 p983097983096 A983090 p983089983088983097 A983090 p983089983089983097B983090 p983092 A983090 p983089983091 A983090 p983090983091 B983091 p983091983095 B983089 p983092983094 B983089 p983093983094 A983090 p983094983095 A983090 p983095983095 A983090 p983096983095 A983090 p983097983097 B983091 p983089983089983089 B983090 p983089983090983089

B983092 p983089983093 B983092 p983090983093 B983090 p983092983094 B983090 p983093983095 B983091 p983094983097 B983091 p983095983097 B983091 p983089983088983089 B983091 p983089983088983089 B983091 p983089983090983089

PHONOLOGICAL CONTROLPronunciation is generally clear enough to be understood despite a noticeable foreign accent but conversational partners will need to ask for repetition fromtime to time

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983090 B983090 p983089983092 B983089 p983090983092 A983089 p983091983092 A983090 p983092983093 A983091 p983093983093 A983089 p983094983094 A983089 p983095983094 A983091 p983096983095 A983091 p983097983097 A983089 p983089983088983096 A983091 p983089983089983097

B983091 p983089983093 B983090 p983090983092 A983091 p983091983093 A983091 p983092983093 B983089 p983093983094 A983091 p983094983095 A983091 p983095983095 B983089 p983096983096 B983089 p983089983088983088 A983091 p983089983088983097 B983089 p983089983090983088B983091 p983090983093 C983090 p983091983097 B983091 p983092983095 C983090 p983093983097 B983089 p983094983096 B983089 p983095983096 B983091 p983096983097 C983089 p983089983088983090 C983090 p983089983089983091 C983089 p983089983090983090

B983090 p983094983097 B983090 p983095983097 C983089 p983097983088 C983090 p983089983088983091B983091 p983095983097D983091 p983096983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983096 of 983090

SECOND EDITION

SOCIOLINGUISTIC APPROPRIATENESSCan handle very short social exchanges using everyday polite forms of greeting and address

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 C983089 p983089983094 C983089 p983090983094 D983090 p983092983089 C983089 p983096983088 C983089 p983097983088 C983089 p983089983088983090 C983089 p983089983090983090

C983091 p983090983095 C983090 p983096983089 C983091 p983097983089 C983090 p983089983088983091 C983090 p983089983090983091C983091 p983096983089 C983091 p983089983088983091 C983091 p983089983090983091

Communication strategies

TAKING THE FLOOR (TURNTAKING) COOPERATING ASKING FOR CLARIFICATION COMPENSATING

MONITORING amp REPAIRCan use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask very simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 C983089 p983090983094 C983089 p983091983096 C983089 p983092983096 C983089 p983093983097 C983090 p983095983089 C983089 p983089983088983090 C983089 p983089983089983090C983090 p983095 C983091 p983090983095 C983090 p983091983097 C983090 p983092983097 C983090 p983093983097 C983090 p983089983089983091D983089 p983096 C983091 p983092983097 C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983097 of 983090

SECOND EDITION

How each unit relates to the CEFR

Unit 983089

Skill Goal LessonListening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)A983092 p983091B983089 p983092C983091 p983095

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983089 p983094C983091 p983095

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983089 p983090C983089 p983094C983090 p983095C983091 p983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983091 p983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983090A983091 p983091A983092 p983091B983090 p983092

Can answer simple questions and respond to simple statements in an interview A983089 p983090

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983091 p983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday personal matters (eg familypeople places a job or study experience living conditions educational background present ormost recent job)

D983090 p983096

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983096

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983093

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983091 p983091B983090 p983092

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983094

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983094C983090 p983095D983089 p983096

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1022

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983088 of 983090983090

SECOND EDITION

Unit 983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg very basic personal

and family information shopping local geography and employment)

B983091 p983089983093

C983089 p983089983094C983091 p983089983095

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

D983090 p983089983097

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983089983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983089983096

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983096

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983089983094C983090 p983089983095C983091 p983089983095

Can participate in a discussion about everyday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

B983090 p983089983092C983091 p983089983095

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983091B983090 p983089983092D983090 p983089983097

Can answer simple questions and respond to simple statements in an interview A983090 p983089983091A983091 p983089983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

A983091 p983089983091D983089 p983089983096

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983089983097

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983091 p983089983091D983091 p983089983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983089983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983089983090A983090 p983089983091B983092 p983089983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983090 p983089983092B983091 p983089983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983094

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983089 of 983090983090

SECOND EDITION

Unit 983091

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983090983090

A983091 p983090983091B983091 p983090983093D983090 p983090983097

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983091 p983090983091

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983090983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983091 p983090983097

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983090983096D983091 p983090983097

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983090983094C983090 p983090983095C983091 p983090983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983090983091C983091 p983090983095D983089 p983090983096

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983090983090A983090 p983090983091A983091 p983090983091B983092 p983090983093C983089 p983090983094

Can tell a story as a simple list of pointsCan give short basic descriptions of

bull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983090983093D983091 p983090983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983090983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983090983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983090983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983090983090A983090 p983090983091

B983092 p983090983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983089 p983090983092B983090 p983090983092B983091 p983090983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983090983094C983091 p983090983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983090983094C983091 p983090983095

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1222

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983090 of 983090

SECOND EDITION

Unit 983092

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983091983092

B983090 p983091983095C983091 p983091983097D983090 p983092983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983092983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983091983096C983090 p983091983097

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983092983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983091983093A983091 p983091983093B983089 p983091983094B983091 p983091983095C983089 p983091983096C983090 p983091983097C983091 p983091983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983090 p983092983089

Can write very simple personal letters emails etc D983090 p983092983089

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983090 p983091983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

A983089 p983091983092C983089 p983091983096

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983091983093B983091 p983091983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983091983092A983091 p983091983093C983090 p983091983097

Can handle very short social exchanges using everyday polite forms of greeting and address D983090 p983092983089

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983091983096C983090 p983091983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1322

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983091 of 983090

SECOND EDITION

Unit 983093

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983092983092

B983089 p983092983094C983091 p983092983097D983090 p983093983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983093983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond invitations and apologiesCan say what they like and dislike

C983089 p983092983096C983090 p983092983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983092983093A983091 p983092983093B983092 p983092983095C983090 p983092983097C983091 p983092983097D983091 p983093983089

Can answer simple questions and respond to simple statements in an interview B983092 p983092983095D983089 p983093983089D983091 p983093983089

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983092983095C983089 p983092983096

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

C983089 p983092983096D983091 p983093983089

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983093983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983092983095D983089 p983093983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983092983093B983089 p983092983094B983090 p983092983094

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983092983093A983091 p983092983093B983091 p983092983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983092983096C983090 p983092983097C983091 p983092983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1422

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983092 of 983090

SECOND EDITION

Unit 983094

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983091 p983093983093

B983089 p983093983094B983091 p983093983095C983089 p983093983096C983091 p983093983097

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get from X to Y by foot or public transport

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Reading Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983094983088D983091 p983094983089

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983094983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983093983096C983090 p983093983097

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Can deal with common aspects of ever yday living such as travel ndash tourist information publictransport and accommodation shopping buying tickets and simple transactions in shops postoffices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the price

Can order a meal

C983091 p983093983097

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983093983092A983090 p983093983093B983090 p983093983095B983091 p983093983095C983091 p983093983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983091 p983094983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983093 of 983090983090

SECOND EDITION

Skill Goal Lesson

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983094983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983093983094

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983093983093B983089 p983093983094B983090 p983093983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983093983093B983089 p983093983094C983090 p983093983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983093983097C983090 p983093983097C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983094 of 983090

SECOND EDITION

Unit 983095

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983094983094

B983090 p983094983097C983089 p983095983088C983090 p983095983089C983091 p983095983089D983090 p983095983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983094983097C983089 p983095983088

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

D983090 p983095983091

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983090 p983095983091

Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983095983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983095983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations invitations and apologiesCan say what they like and dislike

A983090 p983094983095C983089 p983095983088C983090 p983095983089

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983094983095B983091 p983094983097C983089 p983095983088C983091 p983095983089

Can manage simple routine tasks such asbull asking for and providing things

bull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

B983091 p983094983097C983089 p983095983088

C983091 p983095983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983094983095C983089 p983095983088

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessions

Can use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

C983089 p983095983088

Writing Can write very simple personal letters emails etc D983090 p983095983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983095 of 983090

SECOND EDITION

Skill Goal Lesson

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983094983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement) A983089 p983094983094A983090 p983094983095B983091 p983094983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983094983094A983091 p983094983095B983089 p983094983096B983090 p983094983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983090 p983095983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983096 of 983090983090

SECOND EDITION

Unit 983096

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983095983094

B983090 p983095983097C983089 p983096983088C983090 p983096983089D983090 p983096983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983091 p983096983089

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983096983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologies

Can say what they like and dislike

C983089 p983096983088C983090 p983096983089C983091 p983096983089D983091 p983096983091

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983089 p983096983088C983090 p983096983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983095983095D983091 p983096983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983089 p983096983090D983090 p983096983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983096983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983096983091

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983095983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983095983094A983090 p983095983095B983091 p983095983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983095983094A983091 p983095983095B983089 p983095983096B983090 p983095983097B983091 p983095983097D983091 p983096983091

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983096983088C983090 p983096983089C983091 p983096983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983097 of 983090

SECOND EDITION

Unit 983097

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983096983094

A983091 p983096983095B983090 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089D983090 p983097983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983096983097

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983097983090D983091 p983097983091

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

B983091 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

B983089 p983096983096B983091 p983096983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessions

Can explain what they like or dislike about something

A983089 p983096983094A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

B983089 p983096983096D983091 p983097983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983097983091

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983096983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983096983094A983090 p983096983095B983091 p983089983088983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983096983095B983089 p983096983096

B983091 p983096983097C983089 p983097983088

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983097983088C983091 p983097983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983095 of 983090

SECOND EDITION

Writing

Overall written production and interaction

At A983090 learners can write a series of simple phrases and sentences linked with simple connectors like and but and

because

OVERALL WRITTEN PRODUCTIONCan write short simple formulaic notes relating to matters in areas of immediate need

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983091 p983089983097 D983091 p983090983097 D983090 p983092983089

CORRESPONDENCECan write very simple personal letters emails etc

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983092983089 D983090 p983095983091

CREATIVE WRITINGCan write very short basic descriptions of events past activities and personal experiences

Can write a series of simple phrases and sentences about everyday andor personal matters (eg family people places a job or study experience livingconditions educational background present or most recent job)

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983096 A983091 p983089983091 A983090 p983091983093 C983089 p983092983096 D983091 p983094983089 D983091 p983096983091 B983089 p983096983096 D983091 p983089983088983093 B983089 p983089983089983088 D983090 p983089983090983093

D983091 p983089983097 D983091 p983093983089 D983091 p983097983091 D983093 p983089983089983093

COHERENCECan use the most frequently occurring connectors to link simple sentences and phrases in order to tell a story or describe something as a simplelist of points

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090D983090 p983096 D983091 p983089983097 D983091 p983090983097 D983091 p983093983089 D983091 p983096983091 D983091 p983097983091 D983091 p983089983088983093 D983090 p983089983090983093

Communicative language competence

VOCABULARY RANGECan understand high frequency job-related or e veryday languageHas sufficient vocabulary to conduct routine everyday tr ansactions and express basic communicative and survival needs

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090B983091 p983093 B983089 p983089983092 B983089 p983090983092 A983089 p983091983092 B983091 p983092983095 B983089 p983093983094 B983089 p983094983096 B983089 p983095983096 B983089 p983096983096 B983089 p983089983088983088 B983091 p983089983089983088 B983089 p983089983090983088

C983089 p983091983096 D983089 p983093983088 C983089 p983089983089983090

GRAMMATICAL ACCURACY Use some simple structures correctly but still systematically make basic mistakes (eg tend to mix up tenses and forget to mark agreement)

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983091 p983091 A983089 p983089983090 A983089 p983090983090 A983090 p983091983093 A983090 p983092983093 A983090 p983093983093 A983089 p983094983094 A983089 p983095983094 A983089 p983096983094 A983089 p983097983096 A983090 p983089983088983097 A983090 p983089983089983097B983090 p983092 A983090 p983089983091 A983090 p983090983091 B983091 p983091983095 B983089 p983092983094 B983089 p983093983094 A983090 p983094983095 A983090 p983095983095 A983090 p983096983095 A983090 p983097983097 B983091 p983089983089983089 B983090 p983089983090983089

B983092 p983089983093 B983092 p983090983093 B983090 p983092983094 B983090 p983093983095 B983091 p983094983097 B983091 p983095983097 B983091 p983089983088983089 B983091 p983089983088983089 B983091 p983089983090983089

PHONOLOGICAL CONTROLPronunciation is generally clear enough to be understood despite a noticeable foreign accent but conversational partners will need to ask for repetition fromtime to time

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090A983090 p983090 B983090 p983089983092 B983089 p983090983092 A983089 p983091983092 A983090 p983092983093 A983091 p983093983093 A983089 p983094983094 A983089 p983095983094 A983091 p983096983095 A983091 p983097983097 A983089 p983089983088983096 A983091 p983089983089983097

B983091 p983089983093 B983090 p983090983092 A983091 p983091983093 A983091 p983092983093 B983089 p983093983094 A983091 p983094983095 A983091 p983095983095 B983089 p983096983096 B983089 p983089983088983088 A983091 p983089983088983097 B983089 p983089983090983088B983091 p983090983093 C983090 p983091983097 B983091 p983092983095 C983090 p983093983097 B983089 p983094983096 B983089 p983095983096 B983091 p983096983097 C983089 p983089983088983090 C983090 p983089983089983091 C983089 p983089983090983090

B983090 p983094983097 B983090 p983095983097 C983089 p983097983088 C983090 p983089983088983091B983091 p983095983097D983091 p983096983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983096 of 983090

SECOND EDITION

SOCIOLINGUISTIC APPROPRIATENESSCan handle very short social exchanges using everyday polite forms of greeting and address

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 C983089 p983089983094 C983089 p983090983094 D983090 p983092983089 C983089 p983096983088 C983089 p983097983088 C983089 p983089983088983090 C983089 p983089983090983090

C983091 p983090983095 C983090 p983096983089 C983091 p983097983089 C983090 p983089983088983091 C983090 p983089983090983091C983091 p983096983089 C983091 p983089983088983091 C983091 p983089983090983091

Communication strategies

TAKING THE FLOOR (TURNTAKING) COOPERATING ASKING FOR CLARIFICATION COMPENSATING

MONITORING amp REPAIRCan use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask very simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 C983089 p983090983094 C983089 p983091983096 C983089 p983092983096 C983089 p983093983097 C983090 p983095983089 C983089 p983089983088983090 C983089 p983089983089983090C983090 p983095 C983091 p983090983095 C983090 p983091983097 C983090 p983092983097 C983090 p983093983097 C983090 p983089983089983091D983089 p983096 C983091 p983092983097 C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983097 of 983090

SECOND EDITION

How each unit relates to the CEFR

Unit 983089

Skill Goal LessonListening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)A983092 p983091B983089 p983092C983091 p983095

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983089 p983094C983091 p983095

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983089 p983090C983089 p983094C983090 p983095C983091 p983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983091 p983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983090A983091 p983091A983092 p983091B983090 p983092

Can answer simple questions and respond to simple statements in an interview A983089 p983090

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983091 p983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday personal matters (eg familypeople places a job or study experience living conditions educational background present ormost recent job)

D983090 p983096

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983096

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983093

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983091 p983091B983090 p983092

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983094

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983094C983090 p983095D983089 p983096

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1022

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983088 of 983090983090

SECOND EDITION

Unit 983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg very basic personal

and family information shopping local geography and employment)

B983091 p983089983093

C983089 p983089983094C983091 p983089983095

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

D983090 p983089983097

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983089983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983089983096

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983096

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983089983094C983090 p983089983095C983091 p983089983095

Can participate in a discussion about everyday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

B983090 p983089983092C983091 p983089983095

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983091B983090 p983089983092D983090 p983089983097

Can answer simple questions and respond to simple statements in an interview A983090 p983089983091A983091 p983089983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

A983091 p983089983091D983089 p983089983096

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983089983097

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983091 p983089983091D983091 p983089983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983089983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983089983090A983090 p983089983091B983092 p983089983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983090 p983089983092B983091 p983089983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983094

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983089 of 983090983090

SECOND EDITION

Unit 983091

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983090983090

A983091 p983090983091B983091 p983090983093D983090 p983090983097

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983091 p983090983091

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983090983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983091 p983090983097

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983090983096D983091 p983090983097

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983090983094C983090 p983090983095C983091 p983090983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983090983091C983091 p983090983095D983089 p983090983096

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983090983090A983090 p983090983091A983091 p983090983091B983092 p983090983093C983089 p983090983094

Can tell a story as a simple list of pointsCan give short basic descriptions of

bull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983090983093D983091 p983090983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983090983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983090983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983090983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983090983090A983090 p983090983091

B983092 p983090983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983089 p983090983092B983090 p983090983092B983091 p983090983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983090983094C983091 p983090983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983090983094C983091 p983090983095

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1222

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983090 of 983090

SECOND EDITION

Unit 983092

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983091983092

B983090 p983091983095C983091 p983091983097D983090 p983092983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983092983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983091983096C983090 p983091983097

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983092983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983091983093A983091 p983091983093B983089 p983091983094B983091 p983091983095C983089 p983091983096C983090 p983091983097C983091 p983091983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983090 p983092983089

Can write very simple personal letters emails etc D983090 p983092983089

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983090 p983091983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

A983089 p983091983092C983089 p983091983096

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983091983093B983091 p983091983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983091983092A983091 p983091983093C983090 p983091983097

Can handle very short social exchanges using everyday polite forms of greeting and address D983090 p983092983089

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983091983096C983090 p983091983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1322

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983091 of 983090

SECOND EDITION

Unit 983093

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983092983092

B983089 p983092983094C983091 p983092983097D983090 p983093983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983093983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond invitations and apologiesCan say what they like and dislike

C983089 p983092983096C983090 p983092983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983092983093A983091 p983092983093B983092 p983092983095C983090 p983092983097C983091 p983092983097D983091 p983093983089

Can answer simple questions and respond to simple statements in an interview B983092 p983092983095D983089 p983093983089D983091 p983093983089

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983092983095C983089 p983092983096

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

C983089 p983092983096D983091 p983093983089

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983093983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983092983095D983089 p983093983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983092983093B983089 p983092983094B983090 p983092983094

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983092983093A983091 p983092983093B983091 p983092983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983092983096C983090 p983092983097C983091 p983092983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1422

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983092 of 983090

SECOND EDITION

Unit 983094

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983091 p983093983093

B983089 p983093983094B983091 p983093983095C983089 p983093983096C983091 p983093983097

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get from X to Y by foot or public transport

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Reading Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983094983088D983091 p983094983089

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983094983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983093983096C983090 p983093983097

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Can deal with common aspects of ever yday living such as travel ndash tourist information publictransport and accommodation shopping buying tickets and simple transactions in shops postoffices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the price

Can order a meal

C983091 p983093983097

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983093983092A983090 p983093983093B983090 p983093983095B983091 p983093983095C983091 p983093983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983091 p983094983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983093 of 983090983090

SECOND EDITION

Skill Goal Lesson

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983094983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983093983094

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983093983093B983089 p983093983094B983090 p983093983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983093983093B983089 p983093983094C983090 p983093983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983093983097C983090 p983093983097C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983094 of 983090

SECOND EDITION

Unit 983095

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983094983094

B983090 p983094983097C983089 p983095983088C983090 p983095983089C983091 p983095983089D983090 p983095983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983094983097C983089 p983095983088

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

D983090 p983095983091

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983090 p983095983091

Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983095983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983095983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations invitations and apologiesCan say what they like and dislike

A983090 p983094983095C983089 p983095983088C983090 p983095983089

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983094983095B983091 p983094983097C983089 p983095983088C983091 p983095983089

Can manage simple routine tasks such asbull asking for and providing things

bull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

B983091 p983094983097C983089 p983095983088

C983091 p983095983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983094983095C983089 p983095983088

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessions

Can use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

C983089 p983095983088

Writing Can write very simple personal letters emails etc D983090 p983095983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983095 of 983090

SECOND EDITION

Skill Goal Lesson

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983094983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement) A983089 p983094983094A983090 p983094983095B983091 p983094983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983094983094A983091 p983094983095B983089 p983094983096B983090 p983094983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983090 p983095983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983096 of 983090983090

SECOND EDITION

Unit 983096

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983095983094

B983090 p983095983097C983089 p983096983088C983090 p983096983089D983090 p983096983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983091 p983096983089

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983096983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologies

Can say what they like and dislike

C983089 p983096983088C983090 p983096983089C983091 p983096983089D983091 p983096983091

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983089 p983096983088C983090 p983096983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983095983095D983091 p983096983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983089 p983096983090D983090 p983096983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983096983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983096983091

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983095983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983095983094A983090 p983095983095B983091 p983095983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983095983094A983091 p983095983095B983089 p983095983096B983090 p983095983097B983091 p983095983097D983091 p983096983091

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983096983088C983090 p983096983089C983091 p983096983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983097 of 983090

SECOND EDITION

Unit 983097

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983096983094

A983091 p983096983095B983090 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089D983090 p983097983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983096983097

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983097983090D983091 p983097983091

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

B983091 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

B983089 p983096983096B983091 p983096983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessions

Can explain what they like or dislike about something

A983089 p983096983094A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

B983089 p983096983096D983091 p983097983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983097983091

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983096983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983096983094A983090 p983096983095B983091 p983089983088983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983096983095B983089 p983096983096

B983091 p983096983097C983089 p983097983088

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983097983088C983091 p983097983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983096 of 983090

SECOND EDITION

SOCIOLINGUISTIC APPROPRIATENESSCan handle very short social exchanges using everyday polite forms of greeting and address

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 C983089 p983089983094 C983089 p983090983094 D983090 p983092983089 C983089 p983096983088 C983089 p983097983088 C983089 p983089983088983090 C983089 p983089983090983090

C983091 p983090983095 C983090 p983096983089 C983091 p983097983089 C983090 p983089983088983091 C983090 p983089983090983091C983091 p983096983089 C983091 p983089983088983091 C983091 p983089983090983091

Communication strategies

TAKING THE FLOOR (TURNTAKING) COOPERATING ASKING FOR CLARIFICATION COMPENSATING

MONITORING amp REPAIRCan use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask very simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

Unit 983089 Unit 983090 Unit 983091 Unit 983092 Unit 983093 Unit 983094 Unit 983095 Unit 983096 Unit 983097 Unit 983089983088 Unit 983089983089 Unit 983089983090C983089 p983094 C983089 p983090983094 C983089 p983091983096 C983089 p983092983096 C983089 p983093983097 C983090 p983095983089 C983089 p983089983088983090 C983089 p983089983089983090C983090 p983095 C983091 p983090983095 C983090 p983091983097 C983090 p983092983097 C983090 p983093983097 C983090 p983089983089983091D983089 p983096 C983091 p983092983097 C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983097 of 983090

SECOND EDITION

How each unit relates to the CEFR

Unit 983089

Skill Goal LessonListening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)A983092 p983091B983089 p983092C983091 p983095

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983089 p983094C983091 p983095

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983089 p983090C983089 p983094C983090 p983095C983091 p983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983091 p983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983090A983091 p983091A983092 p983091B983090 p983092

Can answer simple questions and respond to simple statements in an interview A983089 p983090

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983091 p983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday personal matters (eg familypeople places a job or study experience living conditions educational background present ormost recent job)

D983090 p983096

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983096

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983093

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983091 p983091B983090 p983092

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983094

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983094C983090 p983095D983089 p983096

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1022

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983088 of 983090983090

SECOND EDITION

Unit 983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg very basic personal

and family information shopping local geography and employment)

B983091 p983089983093

C983089 p983089983094C983091 p983089983095

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

D983090 p983089983097

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983089983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983089983096

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983096

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983089983094C983090 p983089983095C983091 p983089983095

Can participate in a discussion about everyday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

B983090 p983089983092C983091 p983089983095

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983091B983090 p983089983092D983090 p983089983097

Can answer simple questions and respond to simple statements in an interview A983090 p983089983091A983091 p983089983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

A983091 p983089983091D983089 p983089983096

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983089983097

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983091 p983089983091D983091 p983089983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983089983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983089983090A983090 p983089983091B983092 p983089983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983090 p983089983092B983091 p983089983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983094

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983089 of 983090983090

SECOND EDITION

Unit 983091

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983090983090

A983091 p983090983091B983091 p983090983093D983090 p983090983097

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983091 p983090983091

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983090983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983091 p983090983097

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983090983096D983091 p983090983097

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983090983094C983090 p983090983095C983091 p983090983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983090983091C983091 p983090983095D983089 p983090983096

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983090983090A983090 p983090983091A983091 p983090983091B983092 p983090983093C983089 p983090983094

Can tell a story as a simple list of pointsCan give short basic descriptions of

bull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983090983093D983091 p983090983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983090983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983090983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983090983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983090983090A983090 p983090983091

B983092 p983090983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983089 p983090983092B983090 p983090983092B983091 p983090983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983090983094C983091 p983090983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983090983094C983091 p983090983095

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1222

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983090 of 983090

SECOND EDITION

Unit 983092

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983091983092

B983090 p983091983095C983091 p983091983097D983090 p983092983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983092983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983091983096C983090 p983091983097

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983092983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983091983093A983091 p983091983093B983089 p983091983094B983091 p983091983095C983089 p983091983096C983090 p983091983097C983091 p983091983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983090 p983092983089

Can write very simple personal letters emails etc D983090 p983092983089

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983090 p983091983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

A983089 p983091983092C983089 p983091983096

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983091983093B983091 p983091983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983091983092A983091 p983091983093C983090 p983091983097

Can handle very short social exchanges using everyday polite forms of greeting and address D983090 p983092983089

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983091983096C983090 p983091983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1322

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983091 of 983090

SECOND EDITION

Unit 983093

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983092983092

B983089 p983092983094C983091 p983092983097D983090 p983093983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983093983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond invitations and apologiesCan say what they like and dislike

C983089 p983092983096C983090 p983092983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983092983093A983091 p983092983093B983092 p983092983095C983090 p983092983097C983091 p983092983097D983091 p983093983089

Can answer simple questions and respond to simple statements in an interview B983092 p983092983095D983089 p983093983089D983091 p983093983089

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983092983095C983089 p983092983096

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

C983089 p983092983096D983091 p983093983089

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983093983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983092983095D983089 p983093983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983092983093B983089 p983092983094B983090 p983092983094

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983092983093A983091 p983092983093B983091 p983092983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983092983096C983090 p983092983097C983091 p983092983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1422

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983092 of 983090

SECOND EDITION

Unit 983094

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983091 p983093983093

B983089 p983093983094B983091 p983093983095C983089 p983093983096C983091 p983093983097

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get from X to Y by foot or public transport

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Reading Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983094983088D983091 p983094983089

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983094983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983093983096C983090 p983093983097

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Can deal with common aspects of ever yday living such as travel ndash tourist information publictransport and accommodation shopping buying tickets and simple transactions in shops postoffices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the price

Can order a meal

C983091 p983093983097

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983093983092A983090 p983093983093B983090 p983093983095B983091 p983093983095C983091 p983093983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983091 p983094983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983093 of 983090983090

SECOND EDITION

Skill Goal Lesson

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983094983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983093983094

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983093983093B983089 p983093983094B983090 p983093983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983093983093B983089 p983093983094C983090 p983093983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983093983097C983090 p983093983097C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983094 of 983090

SECOND EDITION

Unit 983095

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983094983094

B983090 p983094983097C983089 p983095983088C983090 p983095983089C983091 p983095983089D983090 p983095983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983094983097C983089 p983095983088

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

D983090 p983095983091

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983090 p983095983091

Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983095983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983095983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations invitations and apologiesCan say what they like and dislike

A983090 p983094983095C983089 p983095983088C983090 p983095983089

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983094983095B983091 p983094983097C983089 p983095983088C983091 p983095983089

Can manage simple routine tasks such asbull asking for and providing things

bull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

B983091 p983094983097C983089 p983095983088

C983091 p983095983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983094983095C983089 p983095983088

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessions

Can use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

C983089 p983095983088

Writing Can write very simple personal letters emails etc D983090 p983095983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983095 of 983090

SECOND EDITION

Skill Goal Lesson

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983094983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement) A983089 p983094983094A983090 p983094983095B983091 p983094983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983094983094A983091 p983094983095B983089 p983094983096B983090 p983094983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983090 p983095983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983096 of 983090983090

SECOND EDITION

Unit 983096

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983095983094

B983090 p983095983097C983089 p983096983088C983090 p983096983089D983090 p983096983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983091 p983096983089

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983096983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologies

Can say what they like and dislike

C983089 p983096983088C983090 p983096983089C983091 p983096983089D983091 p983096983091

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983089 p983096983088C983090 p983096983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983095983095D983091 p983096983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983089 p983096983090D983090 p983096983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983096983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983096983091

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983095983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983095983094A983090 p983095983095B983091 p983095983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983095983094A983091 p983095983095B983089 p983095983096B983090 p983095983097B983091 p983095983097D983091 p983096983091

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983096983088C983090 p983096983089C983091 p983096983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983097 of 983090

SECOND EDITION

Unit 983097

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983096983094

A983091 p983096983095B983090 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089D983090 p983097983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983096983097

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983097983090D983091 p983097983091

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

B983091 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

B983089 p983096983096B983091 p983096983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessions

Can explain what they like or dislike about something

A983089 p983096983094A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

B983089 p983096983096D983091 p983097983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983097983091

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983096983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983096983094A983090 p983096983095B983091 p983089983088983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983096983095B983089 p983096983096

B983091 p983096983097C983089 p983097983088

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983097983088C983091 p983097983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983097 of 983090

SECOND EDITION

How each unit relates to the CEFR

Unit 983089

Skill Goal LessonListening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)A983092 p983091B983089 p983092C983091 p983095

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983089 p983094C983091 p983095

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983089 p983090C983089 p983094C983090 p983095C983091 p983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983091 p983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983090A983091 p983091A983092 p983091B983090 p983092

Can answer simple questions and respond to simple statements in an interview A983089 p983090

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983091 p983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday personal matters (eg familypeople places a job or study experience living conditions educational background present ormost recent job)

D983090 p983096

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983096

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983093

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983091 p983091B983090 p983092

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983094

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983094C983090 p983095D983089 p983096

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1022

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983088 of 983090983090

SECOND EDITION

Unit 983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg very basic personal

and family information shopping local geography and employment)

B983091 p983089983093

C983089 p983089983094C983091 p983089983095

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

D983090 p983089983097

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983089983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983089983096

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983096

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983089983094C983090 p983089983095C983091 p983089983095

Can participate in a discussion about everyday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

B983090 p983089983092C983091 p983089983095

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983091B983090 p983089983092D983090 p983089983097

Can answer simple questions and respond to simple statements in an interview A983090 p983089983091A983091 p983089983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

A983091 p983089983091D983089 p983089983096

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983089983097

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983091 p983089983091D983091 p983089983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983089983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983089983090A983090 p983089983091B983092 p983089983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983090 p983089983092B983091 p983089983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983094

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983089 of 983090983090

SECOND EDITION

Unit 983091

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983090983090

A983091 p983090983091B983091 p983090983093D983090 p983090983097

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983091 p983090983091

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983090983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983091 p983090983097

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983090983096D983091 p983090983097

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983090983094C983090 p983090983095C983091 p983090983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983090983091C983091 p983090983095D983089 p983090983096

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983090983090A983090 p983090983091A983091 p983090983091B983092 p983090983093C983089 p983090983094

Can tell a story as a simple list of pointsCan give short basic descriptions of

bull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983090983093D983091 p983090983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983090983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983090983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983090983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983090983090A983090 p983090983091

B983092 p983090983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983089 p983090983092B983090 p983090983092B983091 p983090983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983090983094C983091 p983090983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983090983094C983091 p983090983095

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1222

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983090 of 983090

SECOND EDITION

Unit 983092

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983091983092

B983090 p983091983095C983091 p983091983097D983090 p983092983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983092983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983091983096C983090 p983091983097

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983092983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983091983093A983091 p983091983093B983089 p983091983094B983091 p983091983095C983089 p983091983096C983090 p983091983097C983091 p983091983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983090 p983092983089

Can write very simple personal letters emails etc D983090 p983092983089

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983090 p983091983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

A983089 p983091983092C983089 p983091983096

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983091983093B983091 p983091983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983091983092A983091 p983091983093C983090 p983091983097

Can handle very short social exchanges using everyday polite forms of greeting and address D983090 p983092983089

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983091983096C983090 p983091983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1322

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983091 of 983090

SECOND EDITION

Unit 983093

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983092983092

B983089 p983092983094C983091 p983092983097D983090 p983093983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983093983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond invitations and apologiesCan say what they like and dislike

C983089 p983092983096C983090 p983092983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983092983093A983091 p983092983093B983092 p983092983095C983090 p983092983097C983091 p983092983097D983091 p983093983089

Can answer simple questions and respond to simple statements in an interview B983092 p983092983095D983089 p983093983089D983091 p983093983089

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983092983095C983089 p983092983096

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

C983089 p983092983096D983091 p983093983089

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983093983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983092983095D983089 p983093983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983092983093B983089 p983092983094B983090 p983092983094

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983092983093A983091 p983092983093B983091 p983092983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983092983096C983090 p983092983097C983091 p983092983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1422

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983092 of 983090

SECOND EDITION

Unit 983094

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983091 p983093983093

B983089 p983093983094B983091 p983093983095C983089 p983093983096C983091 p983093983097

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get from X to Y by foot or public transport

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Reading Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983094983088D983091 p983094983089

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983094983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983093983096C983090 p983093983097

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Can deal with common aspects of ever yday living such as travel ndash tourist information publictransport and accommodation shopping buying tickets and simple transactions in shops postoffices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the price

Can order a meal

C983091 p983093983097

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983093983092A983090 p983093983093B983090 p983093983095B983091 p983093983095C983091 p983093983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983091 p983094983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983093 of 983090983090

SECOND EDITION

Skill Goal Lesson

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983094983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983093983094

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983093983093B983089 p983093983094B983090 p983093983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983093983093B983089 p983093983094C983090 p983093983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983093983097C983090 p983093983097C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983094 of 983090

SECOND EDITION

Unit 983095

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983094983094

B983090 p983094983097C983089 p983095983088C983090 p983095983089C983091 p983095983089D983090 p983095983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983094983097C983089 p983095983088

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

D983090 p983095983091

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983090 p983095983091

Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983095983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983095983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations invitations and apologiesCan say what they like and dislike

A983090 p983094983095C983089 p983095983088C983090 p983095983089

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983094983095B983091 p983094983097C983089 p983095983088C983091 p983095983089

Can manage simple routine tasks such asbull asking for and providing things

bull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

B983091 p983094983097C983089 p983095983088

C983091 p983095983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983094983095C983089 p983095983088

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessions

Can use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

C983089 p983095983088

Writing Can write very simple personal letters emails etc D983090 p983095983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983095 of 983090

SECOND EDITION

Skill Goal Lesson

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983094983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement) A983089 p983094983094A983090 p983094983095B983091 p983094983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983094983094A983091 p983094983095B983089 p983094983096B983090 p983094983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983090 p983095983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983096 of 983090983090

SECOND EDITION

Unit 983096

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983095983094

B983090 p983095983097C983089 p983096983088C983090 p983096983089D983090 p983096983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983091 p983096983089

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983096983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologies

Can say what they like and dislike

C983089 p983096983088C983090 p983096983089C983091 p983096983089D983091 p983096983091

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983089 p983096983088C983090 p983096983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983095983095D983091 p983096983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983089 p983096983090D983090 p983096983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983096983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983096983091

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983095983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983095983094A983090 p983095983095B983091 p983095983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983095983094A983091 p983095983095B983089 p983095983096B983090 p983095983097B983091 p983095983097D983091 p983096983091

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983096983088C983090 p983096983089C983091 p983096983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983097 of 983090

SECOND EDITION

Unit 983097

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983096983094

A983091 p983096983095B983090 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089D983090 p983097983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983096983097

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983097983090D983091 p983097983091

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

B983091 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

B983089 p983096983096B983091 p983096983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessions

Can explain what they like or dislike about something

A983089 p983096983094A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

B983089 p983096983096D983091 p983097983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983097983091

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983096983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983096983094A983090 p983096983095B983091 p983089983088983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983096983095B983089 p983096983096

B983091 p983096983097C983089 p983097983088

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983097983088C983091 p983097983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1022

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983088 of 983090983090

SECOND EDITION

Unit 983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg very basic personal

and family information shopping local geography and employment)

B983091 p983089983093

C983089 p983089983094C983091 p983089983095

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

D983090 p983089983097

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983089983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983089983096

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983096

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983089983094C983090 p983089983095C983091 p983089983095

Can participate in a discussion about everyday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

B983090 p983089983092C983091 p983089983095

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983091B983090 p983089983092D983090 p983089983097

Can answer simple questions and respond to simple statements in an interview A983090 p983089983091A983091 p983089983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

A983091 p983089983091D983089 p983089983096

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983089983097

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983091 p983089983091D983091 p983089983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983089983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983089983090A983090 p983089983091B983092 p983089983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983090 p983089983092B983091 p983089983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983094

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983089 of 983090983090

SECOND EDITION

Unit 983091

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983090983090

A983091 p983090983091B983091 p983090983093D983090 p983090983097

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983091 p983090983091

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983090983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983091 p983090983097

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983090983096D983091 p983090983097

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983090983094C983090 p983090983095C983091 p983090983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983090983091C983091 p983090983095D983089 p983090983096

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983090983090A983090 p983090983091A983091 p983090983091B983092 p983090983093C983089 p983090983094

Can tell a story as a simple list of pointsCan give short basic descriptions of

bull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983090983093D983091 p983090983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983090983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983090983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983090983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983090983090A983090 p983090983091

B983092 p983090983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983089 p983090983092B983090 p983090983092B983091 p983090983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983090983094C983091 p983090983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983090983094C983091 p983090983095

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1222

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983090 of 983090

SECOND EDITION

Unit 983092

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983091983092

B983090 p983091983095C983091 p983091983097D983090 p983092983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983092983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983091983096C983090 p983091983097

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983092983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983091983093A983091 p983091983093B983089 p983091983094B983091 p983091983095C983089 p983091983096C983090 p983091983097C983091 p983091983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983090 p983092983089

Can write very simple personal letters emails etc D983090 p983092983089

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983090 p983091983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

A983089 p983091983092C983089 p983091983096

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983091983093B983091 p983091983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983091983092A983091 p983091983093C983090 p983091983097

Can handle very short social exchanges using everyday polite forms of greeting and address D983090 p983092983089

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983091983096C983090 p983091983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1322

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983091 of 983090

SECOND EDITION

Unit 983093

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983092983092

B983089 p983092983094C983091 p983092983097D983090 p983093983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983093983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond invitations and apologiesCan say what they like and dislike

C983089 p983092983096C983090 p983092983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983092983093A983091 p983092983093B983092 p983092983095C983090 p983092983097C983091 p983092983097D983091 p983093983089

Can answer simple questions and respond to simple statements in an interview B983092 p983092983095D983089 p983093983089D983091 p983093983089

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983092983095C983089 p983092983096

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

C983089 p983092983096D983091 p983093983089

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983093983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983092983095D983089 p983093983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983092983093B983089 p983092983094B983090 p983092983094

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983092983093A983091 p983092983093B983091 p983092983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983092983096C983090 p983092983097C983091 p983092983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1422

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983092 of 983090

SECOND EDITION

Unit 983094

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983091 p983093983093

B983089 p983093983094B983091 p983093983095C983089 p983093983096C983091 p983093983097

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get from X to Y by foot or public transport

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Reading Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983094983088D983091 p983094983089

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983094983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983093983096C983090 p983093983097

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Can deal with common aspects of ever yday living such as travel ndash tourist information publictransport and accommodation shopping buying tickets and simple transactions in shops postoffices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the price

Can order a meal

C983091 p983093983097

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983093983092A983090 p983093983093B983090 p983093983095B983091 p983093983095C983091 p983093983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983091 p983094983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983093 of 983090983090

SECOND EDITION

Skill Goal Lesson

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983094983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983093983094

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983093983093B983089 p983093983094B983090 p983093983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983093983093B983089 p983093983094C983090 p983093983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983093983097C983090 p983093983097C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983094 of 983090

SECOND EDITION

Unit 983095

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983094983094

B983090 p983094983097C983089 p983095983088C983090 p983095983089C983091 p983095983089D983090 p983095983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983094983097C983089 p983095983088

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

D983090 p983095983091

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983090 p983095983091

Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983095983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983095983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations invitations and apologiesCan say what they like and dislike

A983090 p983094983095C983089 p983095983088C983090 p983095983089

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983094983095B983091 p983094983097C983089 p983095983088C983091 p983095983089

Can manage simple routine tasks such asbull asking for and providing things

bull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

B983091 p983094983097C983089 p983095983088

C983091 p983095983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983094983095C983089 p983095983088

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessions

Can use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

C983089 p983095983088

Writing Can write very simple personal letters emails etc D983090 p983095983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983095 of 983090

SECOND EDITION

Skill Goal Lesson

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983094983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement) A983089 p983094983094A983090 p983094983095B983091 p983094983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983094983094A983091 p983094983095B983089 p983094983096B983090 p983094983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983090 p983095983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983096 of 983090983090

SECOND EDITION

Unit 983096

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983095983094

B983090 p983095983097C983089 p983096983088C983090 p983096983089D983090 p983096983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983091 p983096983089

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983096983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologies

Can say what they like and dislike

C983089 p983096983088C983090 p983096983089C983091 p983096983089D983091 p983096983091

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983089 p983096983088C983090 p983096983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983095983095D983091 p983096983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983089 p983096983090D983090 p983096983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983096983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983096983091

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983095983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983095983094A983090 p983095983095B983091 p983095983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983095983094A983091 p983095983095B983089 p983095983096B983090 p983095983097B983091 p983095983097D983091 p983096983091

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983096983088C983090 p983096983089C983091 p983096983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983097 of 983090

SECOND EDITION

Unit 983097

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983096983094

A983091 p983096983095B983090 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089D983090 p983097983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983096983097

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983097983090D983091 p983097983091

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

B983091 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

B983089 p983096983096B983091 p983096983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessions

Can explain what they like or dislike about something

A983089 p983096983094A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

B983089 p983096983096D983091 p983097983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983097983091

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983096983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983096983094A983090 p983096983095B983091 p983089983088983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983096983095B983089 p983096983096

B983091 p983096983097C983089 p983097983088

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983097983088C983091 p983097983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983089 of 983090983090

SECOND EDITION

Unit 983091

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983090983090

A983091 p983090983091B983091 p983090983093D983090 p983090983097

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983091 p983090983091

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

A983089 p983090983090

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983091 p983090983097

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983090983096D983091 p983090983097

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983090983094C983090 p983090983095C983091 p983090983095

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983090983091C983091 p983090983095D983089 p983090983096

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983090983090A983090 p983090983091A983091 p983090983091B983092 p983090983093C983089 p983090983094

Can tell a story as a simple list of pointsCan give short basic descriptions of

bull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983090983093D983091 p983090983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983091 p983090983097

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983090983097

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983090983092

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983090983090A983090 p983090983091

B983092 p983090983093

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

B983089 p983090983092B983090 p983090983092B983091 p983090983093

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983090983094C983091 p983090983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983090983094C983091 p983090983095

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1222

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983090 of 983090

SECOND EDITION

Unit 983092

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983091983092

B983090 p983091983095C983091 p983091983097D983090 p983092983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983092983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983091983096C983090 p983091983097

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983092983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983091983093A983091 p983091983093B983089 p983091983094B983091 p983091983095C983089 p983091983096C983090 p983091983097C983091 p983091983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983090 p983092983089

Can write very simple personal letters emails etc D983090 p983092983089

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983090 p983091983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

A983089 p983091983092C983089 p983091983096

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983091983093B983091 p983091983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983091983092A983091 p983091983093C983090 p983091983097

Can handle very short social exchanges using everyday polite forms of greeting and address D983090 p983092983089

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983091983096C983090 p983091983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1322

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983091 of 983090

SECOND EDITION

Unit 983093

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983092983092

B983089 p983092983094C983091 p983092983097D983090 p983093983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983093983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond invitations and apologiesCan say what they like and dislike

C983089 p983092983096C983090 p983092983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983092983093A983091 p983092983093B983092 p983092983095C983090 p983092983097C983091 p983092983097D983091 p983093983089

Can answer simple questions and respond to simple statements in an interview B983092 p983092983095D983089 p983093983089D983091 p983093983089

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983092983095C983089 p983092983096

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

C983089 p983092983096D983091 p983093983089

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983093983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983092983095D983089 p983093983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983092983093B983089 p983092983094B983090 p983092983094

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983092983093A983091 p983092983093B983091 p983092983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983092983096C983090 p983092983097C983091 p983092983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1422

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983092 of 983090

SECOND EDITION

Unit 983094

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983091 p983093983093

B983089 p983093983094B983091 p983093983095C983089 p983093983096C983091 p983093983097

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get from X to Y by foot or public transport

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Reading Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983094983088D983091 p983094983089

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983094983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983093983096C983090 p983093983097

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Can deal with common aspects of ever yday living such as travel ndash tourist information publictransport and accommodation shopping buying tickets and simple transactions in shops postoffices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the price

Can order a meal

C983091 p983093983097

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983093983092A983090 p983093983093B983090 p983093983095B983091 p983093983095C983091 p983093983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983091 p983094983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983093 of 983090983090

SECOND EDITION

Skill Goal Lesson

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983094983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983093983094

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983093983093B983089 p983093983094B983090 p983093983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983093983093B983089 p983093983094C983090 p983093983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983093983097C983090 p983093983097C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983094 of 983090

SECOND EDITION

Unit 983095

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983094983094

B983090 p983094983097C983089 p983095983088C983090 p983095983089C983091 p983095983089D983090 p983095983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983094983097C983089 p983095983088

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

D983090 p983095983091

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983090 p983095983091

Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983095983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983095983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations invitations and apologiesCan say what they like and dislike

A983090 p983094983095C983089 p983095983088C983090 p983095983089

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983094983095B983091 p983094983097C983089 p983095983088C983091 p983095983089

Can manage simple routine tasks such asbull asking for and providing things

bull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

B983091 p983094983097C983089 p983095983088

C983091 p983095983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983094983095C983089 p983095983088

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessions

Can use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

C983089 p983095983088

Writing Can write very simple personal letters emails etc D983090 p983095983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983095 of 983090

SECOND EDITION

Skill Goal Lesson

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983094983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement) A983089 p983094983094A983090 p983094983095B983091 p983094983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983094983094A983091 p983094983095B983089 p983094983096B983090 p983094983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983090 p983095983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983096 of 983090983090

SECOND EDITION

Unit 983096

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983095983094

B983090 p983095983097C983089 p983096983088C983090 p983096983089D983090 p983096983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983091 p983096983089

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983096983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologies

Can say what they like and dislike

C983089 p983096983088C983090 p983096983089C983091 p983096983089D983091 p983096983091

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983089 p983096983088C983090 p983096983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983095983095D983091 p983096983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983089 p983096983090D983090 p983096983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983096983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983096983091

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983095983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983095983094A983090 p983095983095B983091 p983095983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983095983094A983091 p983095983095B983089 p983095983096B983090 p983095983097B983091 p983095983097D983091 p983096983091

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983096983088C983090 p983096983089C983091 p983096983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983097 of 983090

SECOND EDITION

Unit 983097

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983096983094

A983091 p983096983095B983090 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089D983090 p983097983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983096983097

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983097983090D983091 p983097983091

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

B983091 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

B983089 p983096983096B983091 p983096983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessions

Can explain what they like or dislike about something

A983089 p983096983094A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

B983089 p983096983096D983091 p983097983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983097983091

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983096983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983096983094A983090 p983096983095B983091 p983089983088983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983096983095B983089 p983096983096

B983091 p983096983097C983089 p983097983088

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983097983088C983091 p983097983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1222

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983090 of 983090

SECOND EDITION

Unit 983092

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983091983092

B983090 p983091983095C983091 p983091983097D983090 p983092983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983092983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983091983096C983090 p983091983097

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983092983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983091983093A983091 p983091983093B983089 p983091983094B983091 p983091983095C983089 p983091983096C983090 p983091983097C983091 p983091983097

Writing Can write shor t simple formulaic notes relating to mat ters in areas of immediate need D983090 p983092983089

Can write very simple personal letters emails etc D983090 p983092983089

Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

A983090 p983091983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

A983089 p983091983092C983089 p983091983096

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983091983093B983091 p983091983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983091983092A983091 p983091983093C983090 p983091983097

Can handle very short social exchanges using everyday polite forms of greeting and address D983090 p983092983089

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983091983096C983090 p983091983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1322

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983091 of 983090

SECOND EDITION

Unit 983093

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983092983092

B983089 p983092983094C983091 p983092983097D983090 p983093983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983093983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond invitations and apologiesCan say what they like and dislike

C983089 p983092983096C983090 p983092983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983092983093A983091 p983092983093B983092 p983092983095C983090 p983092983097C983091 p983092983097D983091 p983093983089

Can answer simple questions and respond to simple statements in an interview B983092 p983092983095D983089 p983093983089D983091 p983093983089

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983092983095C983089 p983092983096

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

C983089 p983092983096D983091 p983093983089

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983093983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983092983095D983089 p983093983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983092983093B983089 p983092983094B983090 p983092983094

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983092983093A983091 p983092983093B983091 p983092983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983092983096C983090 p983092983097C983091 p983092983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1422

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983092 of 983090

SECOND EDITION

Unit 983094

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983091 p983093983093

B983089 p983093983094B983091 p983093983095C983089 p983093983096C983091 p983093983097

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get from X to Y by foot or public transport

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Reading Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983094983088D983091 p983094983089

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983094983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983093983096C983090 p983093983097

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Can deal with common aspects of ever yday living such as travel ndash tourist information publictransport and accommodation shopping buying tickets and simple transactions in shops postoffices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the price

Can order a meal

C983091 p983093983097

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983093983092A983090 p983093983093B983090 p983093983095B983091 p983093983095C983091 p983093983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983091 p983094983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983093 of 983090983090

SECOND EDITION

Skill Goal Lesson

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983094983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983093983094

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983093983093B983089 p983093983094B983090 p983093983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983093983093B983089 p983093983094C983090 p983093983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983093983097C983090 p983093983097C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983094 of 983090

SECOND EDITION

Unit 983095

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983094983094

B983090 p983094983097C983089 p983095983088C983090 p983095983089C983091 p983095983089D983090 p983095983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983094983097C983089 p983095983088

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

D983090 p983095983091

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983090 p983095983091

Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983095983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983095983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations invitations and apologiesCan say what they like and dislike

A983090 p983094983095C983089 p983095983088C983090 p983095983089

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983094983095B983091 p983094983097C983089 p983095983088C983091 p983095983089

Can manage simple routine tasks such asbull asking for and providing things

bull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

B983091 p983094983097C983089 p983095983088

C983091 p983095983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983094983095C983089 p983095983088

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessions

Can use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

C983089 p983095983088

Writing Can write very simple personal letters emails etc D983090 p983095983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983095 of 983090

SECOND EDITION

Skill Goal Lesson

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983094983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement) A983089 p983094983094A983090 p983094983095B983091 p983094983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983094983094A983091 p983094983095B983089 p983094983096B983090 p983094983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983090 p983095983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983096 of 983090983090

SECOND EDITION

Unit 983096

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983095983094

B983090 p983095983097C983089 p983096983088C983090 p983096983089D983090 p983096983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983091 p983096983089

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983096983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologies

Can say what they like and dislike

C983089 p983096983088C983090 p983096983089C983091 p983096983089D983091 p983096983091

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983089 p983096983088C983090 p983096983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983095983095D983091 p983096983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983089 p983096983090D983090 p983096983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983096983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983096983091

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983095983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983095983094A983090 p983095983095B983091 p983095983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983095983094A983091 p983095983095B983089 p983095983096B983090 p983095983097B983091 p983095983097D983091 p983096983091

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983096983088C983090 p983096983089C983091 p983096983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983097 of 983090

SECOND EDITION

Unit 983097

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983096983094

A983091 p983096983095B983090 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089D983090 p983097983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983096983097

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983097983090D983091 p983097983091

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

B983091 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

B983089 p983096983096B983091 p983096983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessions

Can explain what they like or dislike about something

A983089 p983096983094A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

B983089 p983096983096D983091 p983097983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983097983091

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983096983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983096983094A983090 p983096983095B983091 p983089983088983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983096983095B983089 p983096983096

B983091 p983096983097C983089 p983097983088

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983097983088C983091 p983097983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1322

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983091 of 983090

SECOND EDITION

Unit 983093

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983092983092

B983089 p983092983094C983091 p983092983097D983090 p983093983089

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983093983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond invitations and apologiesCan say what they like and dislike

C983089 p983092983096C983090 p983092983097

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983092983093A983091 p983092983093B983092 p983092983095C983090 p983092983097C983091 p983092983097D983091 p983093983089

Can answer simple questions and respond to simple statements in an interview B983092 p983092983095D983089 p983093983089D983091 p983093983089

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

B983092 p983092983095C983089 p983092983096

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

C983089 p983092983096D983091 p983093983089

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983093983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983092983095D983089 p983093983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983092983093B983089 p983092983094B983090 p983092983094

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983090 p983092983093A983091 p983092983093B983091 p983092983095

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983092983096C983090 p983092983097C983091 p983092983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1422

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983092 of 983090

SECOND EDITION

Unit 983094

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983091 p983093983093

B983089 p983093983094B983091 p983093983095C983089 p983093983096C983091 p983093983097

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get from X to Y by foot or public transport

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Reading Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983094983088D983091 p983094983089

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983094983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983093983096C983090 p983093983097

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Can deal with common aspects of ever yday living such as travel ndash tourist information publictransport and accommodation shopping buying tickets and simple transactions in shops postoffices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the price

Can order a meal

C983091 p983093983097

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983093983092A983090 p983093983093B983090 p983093983095B983091 p983093983095C983091 p983093983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983091 p983094983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983093 of 983090983090

SECOND EDITION

Skill Goal Lesson

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983094983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983093983094

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983093983093B983089 p983093983094B983090 p983093983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983093983093B983089 p983093983094C983090 p983093983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983093983097C983090 p983093983097C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983094 of 983090

SECOND EDITION

Unit 983095

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983094983094

B983090 p983094983097C983089 p983095983088C983090 p983095983089C983091 p983095983089D983090 p983095983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983094983097C983089 p983095983088

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

D983090 p983095983091

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983090 p983095983091

Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983095983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983095983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations invitations and apologiesCan say what they like and dislike

A983090 p983094983095C983089 p983095983088C983090 p983095983089

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983094983095B983091 p983094983097C983089 p983095983088C983091 p983095983089

Can manage simple routine tasks such asbull asking for and providing things

bull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

B983091 p983094983097C983089 p983095983088

C983091 p983095983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983094983095C983089 p983095983088

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessions

Can use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

C983089 p983095983088

Writing Can write very simple personal letters emails etc D983090 p983095983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983095 of 983090

SECOND EDITION

Skill Goal Lesson

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983094983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement) A983089 p983094983094A983090 p983094983095B983091 p983094983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983094983094A983091 p983094983095B983089 p983094983096B983090 p983094983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983090 p983095983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983096 of 983090983090

SECOND EDITION

Unit 983096

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983095983094

B983090 p983095983097C983089 p983096983088C983090 p983096983089D983090 p983096983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983091 p983096983089

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983096983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologies

Can say what they like and dislike

C983089 p983096983088C983090 p983096983089C983091 p983096983089D983091 p983096983091

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983089 p983096983088C983090 p983096983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983095983095D983091 p983096983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983089 p983096983090D983090 p983096983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983096983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983096983091

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983095983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983095983094A983090 p983095983095B983091 p983095983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983095983094A983091 p983095983095B983089 p983095983096B983090 p983095983097B983091 p983095983097D983091 p983096983091

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983096983088C983090 p983096983089C983091 p983096983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983097 of 983090

SECOND EDITION

Unit 983097

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983096983094

A983091 p983096983095B983090 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089D983090 p983097983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983096983097

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983097983090D983091 p983097983091

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

B983091 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

B983089 p983096983096B983091 p983096983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessions

Can explain what they like or dislike about something

A983089 p983096983094A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

B983089 p983096983096D983091 p983097983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983097983091

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983096983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983096983094A983090 p983096983095B983091 p983089983088983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983096983095B983089 p983096983096

B983091 p983096983097C983089 p983097983088

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983097983088C983091 p983097983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1422

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983092 of 983090

SECOND EDITION

Unit 983094

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983091 p983093983093

B983089 p983093983094B983091 p983093983095C983089 p983093983096C983091 p983093983097

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get from X to Y by foot or public transport

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Reading Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983094983088D983091 p983094983089

Can identify specific information in simple written material such as letters brochures and shortnewspaper or online articles

D983089 p983094983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

C983089 p983093983096C983090 p983093983097

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

A983090 p983093983093B983090 p983093983095B983091 p983093983095

Can deal with common aspects of ever yday living such as travel ndash tourist information publictransport and accommodation shopping buying tickets and simple transactions in shops postoffices or banksCan give and receive information about quantities numbers prices etcCan make simple purchases by stating what is wanted and asking the price

Can order a meal

C983091 p983093983097

Can ask for and provide personal infor mation (eg habits routines pastimes and past ac tivities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983093983092A983090 p983093983093B983090 p983093983095B983091 p983093983095C983091 p983093983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983091 p983094983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983093 of 983090983090

SECOND EDITION

Skill Goal Lesson

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983094983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983093983094

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983093983093B983089 p983093983094B983090 p983093983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983093983093B983089 p983093983094C983090 p983093983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983093983097C983090 p983093983097C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983094 of 983090

SECOND EDITION

Unit 983095

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983094983094

B983090 p983094983097C983089 p983095983088C983090 p983095983089C983091 p983095983089D983090 p983095983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983094983097C983089 p983095983088

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

D983090 p983095983091

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983090 p983095983091

Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983095983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983095983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations invitations and apologiesCan say what they like and dislike

A983090 p983094983095C983089 p983095983088C983090 p983095983089

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983094983095B983091 p983094983097C983089 p983095983088C983091 p983095983089

Can manage simple routine tasks such asbull asking for and providing things

bull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

B983091 p983094983097C983089 p983095983088

C983091 p983095983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983094983095C983089 p983095983088

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessions

Can use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

C983089 p983095983088

Writing Can write very simple personal letters emails etc D983090 p983095983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983095 of 983090

SECOND EDITION

Skill Goal Lesson

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983094983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement) A983089 p983094983094A983090 p983094983095B983091 p983094983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983094983094A983091 p983094983095B983089 p983094983096B983090 p983094983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983090 p983095983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983096 of 983090983090

SECOND EDITION

Unit 983096

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983095983094

B983090 p983095983097C983089 p983096983088C983090 p983096983089D983090 p983096983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983091 p983096983089

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983096983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologies

Can say what they like and dislike

C983089 p983096983088C983090 p983096983089C983091 p983096983089D983091 p983096983091

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983089 p983096983088C983090 p983096983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983095983095D983091 p983096983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983089 p983096983090D983090 p983096983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983096983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983096983091

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983095983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983095983094A983090 p983095983095B983091 p983095983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983095983094A983091 p983095983095B983089 p983095983096B983090 p983095983097B983091 p983095983097D983091 p983096983091

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983096983088C983090 p983096983089C983091 p983096983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983097 of 983090

SECOND EDITION

Unit 983097

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983096983094

A983091 p983096983095B983090 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089D983090 p983097983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983096983097

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983097983090D983091 p983097983091

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

B983091 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

B983089 p983096983096B983091 p983096983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessions

Can explain what they like or dislike about something

A983089 p983096983094A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

B983089 p983096983096D983091 p983097983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983097983091

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983096983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983096983094A983090 p983096983095B983091 p983089983088983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983096983095B983089 p983096983096

B983091 p983096983097C983089 p983097983088

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983097983088C983091 p983097983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1522

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983093 of 983090983090

SECOND EDITION

Skill Goal Lesson

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983094983089

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983093983094

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983093983093B983089 p983093983094B983090 p983093983095

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983093983093B983089 p983093983094C983090 p983093983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983093983097C983090 p983093983097C983091 p983093983097

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983094 of 983090

SECOND EDITION

Unit 983095

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983094983094

B983090 p983094983097C983089 p983095983088C983090 p983095983089C983091 p983095983089D983090 p983095983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983094983097C983089 p983095983088

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

D983090 p983095983091

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983090 p983095983091

Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983095983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983095983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations invitations and apologiesCan say what they like and dislike

A983090 p983094983095C983089 p983095983088C983090 p983095983089

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983094983095B983091 p983094983097C983089 p983095983088C983091 p983095983089

Can manage simple routine tasks such asbull asking for and providing things

bull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

B983091 p983094983097C983089 p983095983088

C983091 p983095983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983094983095C983089 p983095983088

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessions

Can use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

C983089 p983095983088

Writing Can write very simple personal letters emails etc D983090 p983095983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983095 of 983090

SECOND EDITION

Skill Goal Lesson

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983094983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement) A983089 p983094983094A983090 p983094983095B983091 p983094983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983094983094A983091 p983094983095B983089 p983094983096B983090 p983094983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983090 p983095983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983096 of 983090983090

SECOND EDITION

Unit 983096

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983095983094

B983090 p983095983097C983089 p983096983088C983090 p983096983089D983090 p983096983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983091 p983096983089

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983096983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologies

Can say what they like and dislike

C983089 p983096983088C983090 p983096983089C983091 p983096983089D983091 p983096983091

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983089 p983096983088C983090 p983096983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983095983095D983091 p983096983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983089 p983096983090D983090 p983096983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983096983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983096983091

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983095983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983095983094A983090 p983095983095B983091 p983095983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983095983094A983091 p983095983095B983089 p983095983096B983090 p983095983097B983091 p983095983097D983091 p983096983091

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983096983088C983090 p983096983089C983091 p983096983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983097 of 983090

SECOND EDITION

Unit 983097

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983096983094

A983091 p983096983095B983090 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089D983090 p983097983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983096983097

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983097983090D983091 p983097983091

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

B983091 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

B983089 p983096983096B983091 p983096983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessions

Can explain what they like or dislike about something

A983089 p983096983094A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

B983089 p983096983096D983091 p983097983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983097983091

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983096983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983096983094A983090 p983096983095B983091 p983089983088983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983096983095B983089 p983096983096

B983091 p983096983097C983089 p983097983088

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983097983088C983091 p983097983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1622

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983094 of 983090

SECOND EDITION

Unit 983095

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983094983094

B983090 p983094983097C983089 p983095983088C983090 p983095983089C983091 p983095983089D983090 p983095983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983094983097C983089 p983095983088

Can understand and extract the essential information from short recorded passagesCan identify the main point of T V news items reporting events accidents etc where the visualsupports the commentary

D983090 p983095983091

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983090 p983095983091

Can find specific predictable information in simple everyday material such as adver tisementswebsites catalogs menus reference lists and t imetablesCan understand everyday signs and notices in public places

D983089 p983095983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983095983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations invitations and apologiesCan say what they like and dislike

A983090 p983094983095C983089 p983095983088C983090 p983095983089

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

A983091 p983094983095B983091 p983094983097C983089 p983095983088C983091 p983095983089

Can manage simple routine tasks such asbull asking for and providing things

bull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

B983091 p983094983097C983089 p983095983088

C983091 p983095983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983090 p983094983095C983089 p983095983088

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal exper iencesbull their family living conditions educational background present or most recent jobbull people places and possessions

Can use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

C983089 p983095983088

Writing Can write very simple personal letters emails etc D983090 p983095983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983095 of 983090

SECOND EDITION

Skill Goal Lesson

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983094983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement) A983089 p983094983094A983090 p983094983095B983091 p983094983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983094983094A983091 p983094983095B983089 p983094983096B983090 p983094983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983090 p983095983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983096 of 983090983090

SECOND EDITION

Unit 983096

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983095983094

B983090 p983095983097C983089 p983096983088C983090 p983096983089D983090 p983096983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983091 p983096983089

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983096983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologies

Can say what they like and dislike

C983089 p983096983088C983090 p983096983089C983091 p983096983089D983091 p983096983091

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983089 p983096983088C983090 p983096983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983095983095D983091 p983096983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983089 p983096983090D983090 p983096983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983096983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983096983091

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983095983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983095983094A983090 p983095983095B983091 p983095983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983095983094A983091 p983095983095B983089 p983095983096B983090 p983095983097B983091 p983095983097D983091 p983096983091

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983096983088C983090 p983096983089C983091 p983096983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983097 of 983090

SECOND EDITION

Unit 983097

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983096983094

A983091 p983096983095B983090 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089D983090 p983097983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983096983097

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983097983090D983091 p983097983091

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

B983091 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

B983089 p983096983096B983091 p983096983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessions

Can explain what they like or dislike about something

A983089 p983096983094A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

B983089 p983096983096D983091 p983097983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983097983091

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983096983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983096983094A983090 p983096983095B983091 p983089983088983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983096983095B983089 p983096983096

B983091 p983096983097C983089 p983097983088

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983097983088C983091 p983097983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1722

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983095 of 983090

SECOND EDITION

Skill Goal Lesson

Communicativelanguage

competence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983094983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement) A983089 p983094983094A983090 p983094983095B983091 p983094983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983094983094A983091 p983094983095B983089 p983094983096B983090 p983094983097

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983090 p983095983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983096 of 983090983090

SECOND EDITION

Unit 983096

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983095983094

B983090 p983095983097C983089 p983096983088C983090 p983096983089D983090 p983096983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983091 p983096983089

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983096983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologies

Can say what they like and dislike

C983089 p983096983088C983090 p983096983089C983091 p983096983089D983091 p983096983091

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983089 p983096983088C983090 p983096983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983095983095D983091 p983096983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983089 p983096983090D983090 p983096983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983096983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983096983091

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983095983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983095983094A983090 p983095983095B983091 p983095983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983095983094A983091 p983095983095B983089 p983095983096B983090 p983095983097B983091 p983095983097D983091 p983096983091

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983096983088C983090 p983096983089C983091 p983096983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983097 of 983090

SECOND EDITION

Unit 983097

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983096983094

A983091 p983096983095B983090 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089D983090 p983097983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983096983097

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983097983090D983091 p983097983091

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

B983091 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

B983089 p983096983096B983091 p983096983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessions

Can explain what they like or dislike about something

A983089 p983096983094A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

B983089 p983096983096D983091 p983097983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983097983091

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983096983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983096983094A983090 p983096983095B983091 p983089983088983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983096983095B983089 p983096983096

B983091 p983096983097C983089 p983097983088

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983097983088C983091 p983097983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1822

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983096 of 983090983090

SECOND EDITION

Unit 983096

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983095983094

B983090 p983095983097C983089 p983096983088C983090 p983096983089D983090 p983096983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

C983091 p983096983089

Reading Can understand basic types of standard routine letters emails short simple personal letters etc D983089 p983096983088

Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983096983088

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologies

Can say what they like and dislike

C983089 p983096983088C983090 p983096983089C983091 p983096983089D983091 p983096983091

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983089 p983096983088C983090 p983096983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983095983095D983091 p983096983091

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessionsCan explain what they like or dislike about something

D983089 p983096983090D983090 p983096983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983091 p983096983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983096983091

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983095983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983095983094A983090 p983095983095B983091 p983095983097

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983095983094A983091 p983095983095B983089 p983095983096B983090 p983095983097B983091 p983095983097D983091 p983096983091

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983096983088C983090 p983096983089C983091 p983096983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983097 of 983090

SECOND EDITION

Unit 983097

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983096983094

A983091 p983096983095B983090 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089D983090 p983097983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983096983097

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983097983090D983091 p983097983091

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

B983091 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

B983089 p983096983096B983091 p983096983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessions

Can explain what they like or dislike about something

A983089 p983096983094A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

B983089 p983096983096D983091 p983097983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983097983091

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983096983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983096983094A983090 p983096983095B983091 p983089983088983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983096983095B983089 p983096983096

B983091 p983096983097C983089 p983097983088

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983097983088C983091 p983097983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 1922

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983089983097 of 983090

SECOND EDITION

Unit 983097

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983096983094

A983091 p983096983095B983090 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089D983090 p983097983091

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983096983097

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983097983090D983091 p983097983091

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

B983091 p983096983097C983089 p983097983088C983090 p983097983089C983091 p983097983089

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

B983089 p983096983096B983091 p983096983097

Can tell a story as a simple list of pointsCan give short basic descriptions ofbull events and activitiesbull plans and arrangements habits and routines past activities and personal experiencesbull their family living conditions educational background present or most recent jobbull people places and possessionsCan use simple descriptive language to make brief statements about and compare objects andpossessions

Can explain what they like or dislike about something

A983089 p983096983094A983091 p983096983095C983091 p983097983089D983089 p983097983090D983090 p983097983091

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

B983089 p983096983096D983091 p983097983091

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983091 p983097983091

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983096983096

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983089 p983096983094A983090 p983096983095B983091 p983089983088983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983096983095B983089 p983096983096

B983091 p983096983097C983089 p983097983088

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983097983088C983091 p983097983089

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2022

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2122

CEFR GUIDE LEVEL

Touchstone Second Edition

Level 983090 CEFR Guide copy Cambridge University Press 983090983088983089983092 Photocopiable Page 983090983089 of 983090983090

SECOND EDITION

Unit 983089983089

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983088983096

B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

A983089 p983089983088983096B983090 p983089983089983089C983089 p983089983089983090C983091 p983089983089983091D983090 p983089983089983093

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983089983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanksCan participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983090 p983089983088983097C983089 p983089983089983090C983090 p983089983089983091C983091 p983089983089983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983091 p983089983088983097B983091 p983089983089983089D983091 p983089983089983093

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters(eg family people places a job or study experience living conditions educational backgroundpresent or most recent job)

B983089 p983089983089983088D983093 p983089983089983093

Communicative

languagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983091 p983089983089983088C983089p983089983089983090

Use some simple structures correctly but still systematically make basic mistakes (eg tend to mixup tenses and forget to mark agreement)

A983090 p983089983088983097B983091 p983089983089983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983089 p983089983088983096A983091 p983089983088983097C983090 p983089983089983091

Communicationstrategies

Can use simple techniques to start maintain or end a short conversationCan initiate maintain and close simple face-to-face conversationCan ask ver y simply for repetition when they do not understandCan ask for clarification about key words or phrases not understood using stock phrasesCan indicate whether they are following or not

C983089 p983089983089983090C983090 p983089983089983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091

892019 Touchstone2ndEd_Level2_CEFR

httpslidepdfcomreaderfulltouchstone2ndedlevel2cefr 2222

CEFR GUIDE LEVEL

SECOND EDITION

Unit 983089983090

Skill Goal Lesson

Listening Can understand phrases and expressions related to ver y familiar topics (eg basic personal and

family information shopping local geography and employment)

A983089 p983089983089983096

B983089 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can generally identify the topic of discussion around them as long as it is conducted slowly andclearly

B983090 p983089983090983089C983089 p983089983090983090C983091 p983089983090983091D983090 p983089983090983093

Can catch the main point in short clear simple messages and announcementsCan understand simple directions relating to how to get f rom X to Y by foot or public transport

C983091 p983089983090983091

Reading Can identify specific information in simple writ ten material such as letters brochures and shor tnewspaper or online articles

D983089 p983089983090983092

Speaking Can use simple everyday polite forms of greeting address farewell introduction and givingthanks

Can participate in short conversations in routine contexts on topics of interestCan express how they feel in simple termsCan make and respond to invitations and apologiesCan say what they like and dislike

A983091 p983089983089983097C983089 p983089983090983090

C983090 p983089983090983091

Can participate in a discussion about ever yday practical issues in a simple wayCan make and respond to suggestionsCan agree and disagree with othersCan discuss what to do where to go and make arrangements to meet

D983089 p983089983090983093D983090 p983089983090983093

Can manage simple routine tasks such asbull asking for and providing thingsbull getting simple informationbull discussing what to do nextbull making and responding to suggestionsbull asking for and giving directions

C983091 p983089983090983091

Can ask for and provide personal information (eg habits routines pastimes and past activities)Can give and follow simple directions and instructions (eg explain how to get somewhere)Can communicate about basic and routine tasks that require a simple and direct exchange ofinformationCan exchange limited information on familiar and routine operational matters

A983089 p983089983089983097B983091 p983089983090983089C983089 p983089983090983090

Writing Can write very shor t basic descriptions of events past activities and personal experiencesCan write a series of simple phrases and sentences about everyday andor personal matters (egfamily people places a job or study e xperience living conditions educational backgroundpresent or most recent job)

D983090 p983089983090983093

Can link a series of shorter discrete simple elements into a connected linear sequence of points D983090 p983089983090983093

Communicativelanguagecompetence

Can understand high frequency job-related or everyday languageHas sufficient vocabulary to conduct routine ever yday transactions and express basiccommunicative and survival needs

B983089 p983089983090983088

Use some simple structures correc tly but still systematically make basic mistakes (eg tend to mix

up tenses and forget to mark agreement)

A983090 p983089983089983097

B983090 p983089983090983089B983091 p983089983090983089

Pronunciation is generally clear enough to be understood despite a noticeable foreign accent butconversational partners will need to ask for repetition from time to time

A983091 p983089983089983097B983089 p983089983090983088C983089 p983089983090983090

Can handle very short social exchanges using everyday polite forms of greeting and address C983089 p983089983090983090C983090 p983089983090983091C983091 p983089983090983091