Searching for functional regions (coding or non-coding) in mammalian genomes
description
Transcript of Searching for functional regions (coding or non-coding) in mammalian genomes
![Page 1: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/1.jpg)
Searching for functional regions (coding or non-coding) Searching for functional regions (coding or non-coding) in mammalian genomes in mammalian genomes
Human genome sequence: 1300 Mb (38 %) available in GenBank (November 22 1999) Draft sequence 90% complete in 2000 Finished sequence in 2003 Experimental characterization of all human genes. How many years ?
Organization of the human genome Prediction of functional elements by computer analysis of genomic sequences
State of the art Success and pitfalls of different approaches
Prediction of function by homology Orthology/paralogy
![Page 2: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/2.jpg)
Functional elements in the human genomeFunctional elements in the human genome
3.4 109 nt 50,000-100,000 protein-coding genes
81% no known function43%38%introns4%12%protein-coding regions
centromeres, telomeres,
RNA2%intergenic
Untranslated RNAs: Xist, H19, His-1, bic, etc.
Regulatory elements: promoters, enhancers, etc.
Repeated sequences (SINES, LINES, HERV, etc.) : 40% of the human genome
![Page 3: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/3.jpg)
Structure of human protein genesStructure of human protein genes
1396 complete human genes (exons + introns) from GenBank Average size (25%, 75%)
Gene 15 kb ± 23 kb (4, 16) (10% > 35 kb) CDS 1300 nt ± 1200 (600, 1500) Exon (coding) 200 nt ± 180 (110, 200) Intron 1800 nt ± 3000 (500, 2000) 5'UTR 210 nt (Pesole et al. 1999) 3'UTR 740 nt (Pesole et al. 1999)
Intron/exon Number of introns: 6 ±3 introns / kb CDS Introns / (introns + CDS): 80% 5' introns in 15% of genes (more ?), 3 ’introns very rare
Alternative splicing in more than 30% of human genes (Hanke et al. 1999)
![Page 4: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/4.jpg)
Structure of human protein genesStructure of human protein genes GenBank: bias towards short genes 1396 complete human genes (exons + introns)
≤949596979899Publication date48121620Gene size (coding exons+introns) kb
5101520253035≤949596979899Publication dateGene size (coding exons+introns) kb
![Page 5: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/5.jpg)
Structure of human protein genesStructure of human protein genes GenBank: bias towards short genes 1396 complete human genes (exons + introns) 9268 complete human mRNA
Sequence:cDNA
complete gene (exons+introns)
400800120016002000889092949698Average CDS size (nt)Publication date
![Page 6: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/6.jpg)
Isochore organization of the human genomeIsochore organization of the human genome
Insertion of repeated sequences (A. Smit 1996) Recombination frequency (Eyre-Walker 1993) Chromosome banding (Saccone, 1993) Replication timing (Bernardi, 1998) Gene density (Mouchiroud, 1991) Gene expression ?? -> No Gene structure (Duret, 1995)
isochore %C+G % total genomic DNA
L1+L2 : 33%-44% 62 %
H1+H2 : 44%-51% 31%
H3 : 51%-60% 3-5%
H1+H2L1+L2H3H1+H2L1+L2L1+L2>300 kbBernardi et al. 1985
![Page 7: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/7.jpg)
Isochores and insertion of repeat sequencesIsochores and insertion of repeat sequences
4%8%12%16%20%AluLINE-1LTR-
elements
Density in repeat sequencesG+C content of genomic sequence:G+C < 39%G+C > 47%G+C 39%-47%
4419 human genomic sequences > 50 kb4419 human genomic sequences > 50 kb
![Page 8: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/8.jpg)
Isochores and gene densityIsochores and gene density
MHC locus (3.6 Mb) MHC locus (3.6 Mb) (The MHC sequencing consortium 1999)(The MHC sequencing consortium 1999)
Class I, class II (H1-H2 isochores): 20 genes/Mb, many pseudogenesClass I, class II (H1-H2 isochores): 20 genes/Mb, many pseudogenesClass III (H3 isochore): 84 genes/Mb, no pseudogeneClass III (H3 isochore): 84 genes/Mb, no pseudogene
Class II boundaries correlate with switching of replication timingClass II boundaries correlate with switching of replication timing
isochore % total genomic DNA %total genes
L1+L2 : 62 % 31%
H1+H2 : 31% 39%
H3 : 3-5% 30%
2060100140Number of genes / MbL1+L2H1+H2H3Mouchiroud et al. 1991
![Page 9: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/9.jpg)
Isochores and introns lengthIsochores and introns length
760 complete human genes L1L2: intron G+C content < 46% H1H2: intron G+C content 46-54% H3: intron G+C content >54%
Average intron length (bp)Gene compaction (intron length/coding region length)40080012001600200024681012L1L2H1H2H3L1L2H1H2H3
Duret, Mouchiroud and Gautier, 1995
![Page 10: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/10.jpg)
Prediction of functional elements (1)Prediction of functional elements (1) Ab initio methods
Ruled-based or statistical methods e.g.: protein genes prediction, promoter prediction, … Very useful but ...
Limits in sensibility/specificity No method available for many functional elements (non-coding RNA genes, regulatory elements, …)
Large scale transcriptome projects: ESTs, full-length cDNA Identification of transcribed genes (protein or non-coding RNA) Information on alternative splicing, polyadenylation (Hanke et al. 1999, Gautheret et al. 1998),
expression pattern Very useful but ...
Problems with genes expressed at low level, narrow tissue distribution, stage-specific expression, … Limited tissue sampling Artifacts in ESTs (introns, partially matured RNA, …) Limited to polyadenylated RNA
![Page 11: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/11.jpg)
Prediction of functional elements (2)Prediction of functional elements (2) Comparative sequence analysis (phylogenetic footprinting)
Function => selective pressure
Corollary Sequence conservation = selective pressure = function
provided the number of aligned homologous sequences represents enough evolutionary time for the accumulation of mutations at the less constrained (presumably selectively neutral)
base positions.
Evolutionary rate in non-functional DNA: ~ 0.3% / My (± 0.069)
Man/Mouse: ~ 80 Myrs 46-58% identity
Mammals/Birds: ~ 300 Myr 26-28% identity
Random sequences 25% identity
![Page 12: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/12.jpg)
Analyse comparative des gènes de Analyse comparative des gènes de -actine de l'homme et de la carpe-actine de l'homme et de la carpe
CarpeHomme5’UTR 3’UTR site polyA échelle de similarité: pas de similarité significative70 - 80% identité80 - 90% identitérégions codantes: éléments régulateurs:introns:ATGcodon stop
![Page 13: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/13.jpg)
Phylogenetic footprintingPhylogenetic footprinting Advantages
Works for all kinds of functional elements (transcribed or not, coding or not) as far as the information is in the primary sequence
Does not require any a priori knowledge of the functional elements
Limits Absence of evolutionary conservation does not mean absence of function No efficient method to detect unknown conserved secondary structure in RNA Function, but what function ? Depends on the sequencing status of other genomes
Human, mouse, fugu, C. elegans, drosophila, yeast, A. thaliana Number of sequences to compare : > 200 Myrs of evolution
Mammals/birds: 310 Myrs Human + mouse + bovine : 240 Myrs
![Page 14: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/14.jpg)
Prédiction de fonction par homologie ?Prédiction de fonction par homologie ? Similarité entre séquences homologie Homologie structure conservée Structure conservée fonction conservée
Oui, mais … Fonction: concept flou
– activité biochimique identique ? e.g. même ligand pour un récepteur, même substrat pour une enzyme, même gènes cibles pour un facteur de transcription.
– distribution tissulaire ? (isoformes tissu-spécifiques).– compartimentalisation cellulaire: cytoplasme, mitochondrie, etc.
Protéines homologues de fonction différentes – Protéines homologues ligands (activateur/répresseur) d ’un même récepteur– Recrutement pour une fonction totalement différente: -cristalline / -énolase
Orthologie/paralogie
Évolution modulaire
![Page 15: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/15.jpg)
Prédiction de fonction par homologie ?Prédiction de fonction par homologie ?
MZEORFG: 1 ILNSPDRACNLAKQAFDEAISELDSLGEESYKDSTLIMQLLXDNLTLWTSDTNEDGGDE 59
I N+P++AC LAKQAFD+AI+ELD+L E+SYKDSTLIMQLL DNLTLWTSD ++ E
BOV1433P: 186 IQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGE 244
Score = 87.4 bits (213), Expect = 1e-17
Identities = 41/59 (69%), Positives = 50/59 (84%)
LOCUS BOV1433P 1696 bp mRNA MAM 26-APR-1993
DEFINITION Bovine brain-specific 14-3-3 protein eta chain mRNA, complete cds.
ACCESSION J03868
LOCUS MZEORFG 187 bp mRNA PLN 31-MAY-1994
DEFINITION Zea mays putative brain specific 14-3-3 protein, tau protein
homolog mRNA, partial cds.
![Page 16: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/16.jpg)
Orthologie/paralogieOrthologie/paralogiespéciationduplicationPrimatesRongeursHommeRatGène ancestral
de l’insulineSourisRatSourisINSINS1INS1INS1INS2INS2INS2Homologie: deux gènes sont homologues si ils ont un ancêtre commun
Orthologie: deux gènes sont orthologues si ils ont divergé à la suite d’un évènement de spéciation
Paralogie: deux gènes sont paralogues si ils ont divergé à la suite d’un évènement de duplication
Orthologie ≠ équivalence fonctionnelle
!
![Page 17: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/17.jpg)
Diversification fonctionnelle par duplication de gènes au cours de l'évolution des métazoaires
Iwabe et al. MBE 13:483-493 (1996):
Analyse phylogénétique de 25 familles de gènes
isoformes compartimentalisées: duplications avant la divergence animaux/champignons
paralogues avec activités différentes: duplication avant la divergence vertébrés/arthropode
isoformes tissu-spécifiques: duplication avant la divergence poissons/tétrapodes
![Page 18: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/18.jpg)
Approche phylogénétique pour la prédiction de fonction
1) Identifier les homologues
2) Aligner les séquences
3) Calculer l’arbre phylogénétique
2A3A1A1B2B3B2A3A1A1B2B3B2A3A1A1B2B3B2A3A1A1B2B3B2ADuplication de gènes4) Placer les fonctions connues sur l’arbre
5) Inférer la fonction probable des gènes
![Page 19: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/19.jpg)
Orthologie/paralogie: abus de langageOrthologie/paralogie: abus de langage
Fitch (1970) Syst. Zool. 19:99-113:
"Where the homology is the result of gene duplication [...] the genes should be called paralogous. Where the homology is the result of speciation [...] the genes should be called orthologous."
Koonin (1996) TIG, PNAS,Curr. Opin. Genet. Dev.
"By definition, orthologs are genes that are related by vertical descent from a common ancestor and encode proteins with the same function in different species. By contrast, paralogs are homologous genes that have evolved by duplication and code for proteins with similar, but not identical functions".
Corrigé dans Science 1997
![Page 20: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/20.jpg)
Evolution modulaire
ABC
![Page 21: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/21.jpg)
Prédiction de régions régulatricesPrédiction de régions régulatrices
Méthodes ab initio
Prédiction de promoteurs Îlots CpG
Approche comparative
![Page 22: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/22.jpg)
Prédiction de promoteurs eucaryotesPrédiction de promoteurs eucaryotes
Combinaison de sites de fixation de facteur de transcription (ordre, orientation, distance)
Motifs courts, dégénérés Difficile de distinguer les vrais sites des faux positifs: Motif à 4 bases: ≈1/256 pb (1/128 pb sur les deux brins)
Boîtes TATA, CAAT , GC: absents dans beaucoup de promoteurs
Banques de données de sites de fixation de facteurs de transcription (TRANSFAC), de promoteurs caractérisés expérimentalement (EPD)
PromoterScan (Prestridge 1995): Mesure de la densité en sites potentiels de fixation de facteurs de transcription de long de la séquence (pondération en fonction de la fréquence des sites dans ou en dehors des vrais promoteurs)
![Page 23: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/23.jpg)
Prédiction de promoteurs: sensibilité, spécificitéPrédiction de promoteurs: sensibilité, spécificité
Sensibilité: fraction des promoteurs qui sont trouvés par le logiciel
PromoterScan: sensibilité = 70% (promoteurs à boîte TATA) Spécificité: fraction des vrais promoteurs parmi ceux qui ont été prédits
PromoterScan: spécificité = 20% Un faux positif / 10 kb
Génome humain: ≈100 000 gènes, ≈1 promoteur/30 kb
sensibilité=vrais_ positifs
vrais_ positifs+faux_ négatifs
spécificité=vrais_ positifs
vrais_ positifs+faux_ positifs
SpécificitéSensibilité1000Seuil
![Page 24: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/24.jpg)
Prédiction de promoteurs eucaryotes: Prédiction de promoteurs eucaryotes: recherches en coursrecherches en cours
Prise en compte de l'orientation relative et des distances entre sites de fixation de facteurs de transcription COMPEL (Kolchanov 1998): banque de données d'éléments composites FastM : recherche dans une séquence génomique d'une combinaison de deux sites
de fixation de facteurs de transcription à une distance définie l'un de l'autre
Recherche de corrélations entre sites Prospector (Werner 2000)
– Sensibilité: 50%– Spécificité: 80%
http://www.gsf.de/biodv/index.html
Combinaison recherche ab initio / approche comparative: recherche de sites potentiels parmi les régions conservées
![Page 25: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/25.jpg)
Îlots CpGÎlots CpG Génome de vertébrés :
méthylation des C dans les dinucléotides 5 ’-CG-3 ’(CpG) Me-C fortement mutable -> T
5 ’-CG- 3 ’ 5 ’-TG-3 ’ 5 ’-CA-3 ’
3 ’-GC- 5 ’ 3 ’-AC-5 ’ 3 ’-GT-5 ’
Génome des vertébrés: globalement dépourvu en CpG (excès de TG, CA)
Certaines régions (200 nt à plusieurs kb) échappent à la méthylation Pas de déplétion en CpG: CpGo/e proche de 1 Riche en G+C Îlot CpG:
Longueur > 500 nt
CpGo/e > 0.6
G+C > 50%
ouou
CpGo /e =Nombre_ de_ CpG_ observéNombre_ de_CpG_ attendu
=0.25
01CpGo/e
![Page 26: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/26.jpg)
Îlots CpG: associé aux régions promotrices ?Îlots CpG: associé aux régions promotrices ?
Bird (1986), Gardiner-Garden (1987) Larsen (1992) ref 40% des gènes tissu-spécifiques possèdent un îlot CpG en 5 ’ 100% des gènes ‘ housekeeping ’ possèdent un îlot CpG en 5 ’
Rechercher des îlots CpG pour prédire des régions promotrices ? Sensibilité: 40-100% Spécificité ?? (Quelle fraction des îlots CpG correspond effectivement à des
régions promotrices ?)
Ponger (1999): comparaison des îlot CpG qui recouvre ou non le site d ’initiation de la transcription
![Page 27: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/27.jpg)
Fréquence des gènes humains avec un îlot CpG Fréquence des gènes humains avec un îlot CpG recouvrant le site d ’initiation de la transcriptionrecouvrant le site d ’initiation de la transcription
800 gènes humains avec promoteur décrit Mesure de la distribution tissulaire à l ’aide d ’EST (20 tissus)
0%20%40%60%80%0-23-67-20Nombre de tissus où le gène est exprimé
![Page 28: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/28.jpg)
Comparaison des îlots CpG recouvrant ou non le site Comparaison des îlots CpG recouvrant ou non le site d ’initiation de la transcriptiond ’initiation de la transcription
272 îlots start CpG recouvrant le site d ’initiation de la transcription
1078 îlots CpG en dehors d ’un promoteur connu
0 2460.50.70.91.11.350%60%70%80%otherstartG+C%CpGo/eLongueur(kb)
![Page 29: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/29.jpg)
Recherche de régions régulatrices par analyse Recherche de régions régulatrices par analyse comparative (empreintes phylogénétiques)comparative (empreintes phylogénétiques)
Goodman et al. 1988: régulation de l’expression des gènes du cluster -globine au cours du développement
– Alignement de séquences orthologues de 6 mammifères (> 270 Ma d’évolution)
– 13 empreintes phylogénétiques: ≥ 6 nt, conservation 100%– Analyse par retard de bande sur gel: – 12/13 (92%) correspondent à des sites de fixation de protéines
1996: 35 empreintes phylogénétiques avec protéines fixatrices identifiées
Enhancers de gènes HOX (Fugu/souris) (Aparicio et al. 1995)
enhancer TCR (homme/souris) (Luo, 1998)
promoteur COX5B (11 primates) (Bachman, 1996)
promoteur uPAR (homme/souris) (Soravia, 1995)
![Page 30: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/30.jpg)
Large scale phylogenetic Large scale phylogenetic footprintingfootprinting
Non-coding sequences : 325,247 sequences 145 Mb
everything except protein-coding regions and structural RNA genes (rRNA, tRNA, snRNA, scRNA)
Introns, 5' and 3' untranslated regions, intergenic sequences
Filtering of microsatellite repeats and cloning vectors: XBLAST
Similarity search: BLASTN + LFASTA
Vertebrates, insects, nematode
![Page 31: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/31.jpg)
Metazoan Genome ProjectsMetazoan Genome ProjectsMillion yearsPorifera (sponge)Nematodes (C. elegans)Arthropods (Drosophila)EchinodermsUrochordataCephalochordata (amphioxus)Jawless fisheschondrichthyes (ray, shark)actinopterygii (bony fishes)amphibians mammals birds reptiles600400200800VertebratesSequencing effort: 9 to 100 Mb 0.8 to 2.4 Mb less than 0.2 Mb
![Page 32: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/32.jpg)
Sequence SimilaritiesSequence Similarities1- Identification of new genes
protein-genes, RNA-genes: intronic snoRNA genes
2- Retroviral elements, retrotransposons
3- Low complexity sequences:
GC-rich, AT-rich, cryptic microsatellites
4- Artefacts:
annotation errors, sample contamination (sponge insulin, ascidian RNA, chicken TGFB1)
5- 326 highly conserved regions (HCRs)
- do not code for proteins
- do not correspond to any known structural RNA
![Page 33: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/33.jpg)
326 Highly Conserved 326 Highly Conserved Regions (HCRs)Regions (HCRs)
• > 70% identity over 50 to 2000 nt after more than 300 Myrs
• Unique sequences
• Generally specific of only one gene
• Longest HCR:
84% identity over 1930 nt after 300 Myrs
3’UTR deltaEF1 transcription factor
• Oldest HCRs: 500 to 600 Myrs
• No HCR between vertebrates and insects or nematode
![Page 34: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/34.jpg)
Oldest HCRsOldest HCRsMillion yearsPorifera (sponge)Nematodes (C. elegans)Arthropods (Drosophila)EchinodermsUrochordataCephalochordata (amphioxus)Jawless fisheschondrichthyes (ray, shark)actinopterygii (bony fishes)amphibians mammals birds reptiles600400200800Sequencing effort: 9 to 100 Mb 0.8 to 2.4 Mb less than 0.2 MbHistone 3’UTR- actin3’UTR
3 5’HOX UTRVertebrates
![Page 35: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/35.jpg)
Conservation pattern in Conservation pattern in 3’UTRs3’UTRs
position relative to the stop codon (nt)10005000150020002400c-fosTransferrin receptorbirdmammalEndoplasmic-reticulum Ca2+ ATPase birdmammalbirdmammalsimilarity: <60% ≥60% ≥70% ≥80%
![Page 36: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/36.jpg)
Distribution of HCRs within Distribution of HCRs within genesgenes3'-non-coding5'-non-codingintrons0%10%20%30%40%mammals / birdsmammals / amphibiansmammals / bony fishes2841917296512563812 Frequency of orthologous
genes containing HCRs
![Page 37: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/37.jpg)
HCRs and multigenic familiesHCRs and multigenic familiesHistone replacement variant H3.3A0400600100014001800AAAAAAAAUGStopAUGStopAAAAAAAHistone replacement variant H3.3BHistone replacement variant H3.3A and H3.3B, Calmodulinsnt• several genes coding for a same protein
• non-coding sequences are distinct, and conserved
![Page 38: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/38.jpg)
Function of 3’HCRs: Function of 3’HCRs: mRNA stability, translationmRNA stability, translationA+U-rich element: stability, translationposition relative to the stop codon (nt)10005000150020002400c-fosTransferrin receptorbirdmammalbirdmammalsimilarity: <60% ≥60% ≥70% ≥80%IRE : Iron Responsive Element
IRP : Iron Regulatory Protein
CCAGUGN5'3'
![Page 39: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/39.jpg)
Function of 3’HCRs:Function of 3’HCRs:mRNA subcellular localizationmRNA subcellular localization
Myosin heavy chain, c-myc, vimentin, -actin
chickencarp (bony fish)site poly(A)site poly(A)0200400600800position relative to the stop codon (nt)localization signalssimilarity: <60% ≥60% ≥70% ≥80%- 3’actin UTR
![Page 40: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/40.jpg)
ACUTS: compilation of ACUTS: compilation of Ancient Conserved Ancient Conserved
UnTranslated SequencesUnTranslated Sequences
Annotated multiple alignments:
˘ age of the conserved element
˘ gene function
˘ function of the conserved element
˘ bibliographic references (MEDLINE)
˘ sequences available from different species (EMBL)
˘ description of sequence features
http://pbil.univ-lyon1.fr/acuts/ACUTS.html
![Page 41: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/41.jpg)
Comparaison des régions non-codantes de 77 gènes Comparaison des régions non-codantes de 77 gènes orthologues homme/souris orthologues homme/souris (Jareborg et al. 1999)(Jareborg et al. 1999)
0.20.40.60.81Upstream(1 kb)5’UTRIntrons3’UTRs
Upstream015’UTRcoding exon
intron3’UTR
Fraction des régions non-codantes conservées entre homme et souris
![Page 42: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/42.jpg)
Prédiction Prédiction ab initioab initio de gènes eucaryotes de gènes eucaryotes
Prédiction d ’exons codants Recherche de phases ouvertes de lecture (ORF: open reading frame)
– Taille moyenne des exons: ± 150 nt Statistiques sur les nucléotides, usage des codons
– Périodicité d'ordre 3, fréquence d ’hexamères– Modèles de Markov cachés
Signaux d ’épissage– Profils, modèles de Markov cachés, réseau neuronaux
Construction d ’un modèle de gène protéique Combinaison d ’exons de phases compatibles (pondération en fonction des scores de chaque exon
potentiel) Recherche de limites de gènes
– Exons terminaux (5 ’, 3 ’)– Promoteur– Signal de polyadénylation
Epissage alternatif ?? Exons non codants ?? Gène transcrits non codants (Xist, …) ??
![Page 43: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/43.jpg)
Prédiction de gènes eucaryotes: Prédiction de gènes eucaryotes: qualité de la prédictionqualité de la prédiction
Comparaison des différents logiciels: sensibilité/spécificité Sn: sensibilité Sp: spécificité par exon (sn_e, sp_e) ou par nucéotide (sn_e, sp_e)
Jeu de données Burset-Guigo (1996): 570 gènes de vertébrés
Jeu de données Salamov et al (1998): 660 gènes humains
Sn_e Sp_e Sn_n Sp_nGenScan 0.78 0.81 0.93 0.93FGENES 1.6 0.83 0.82 0.92 0.93Grail2 0.36 0.43 0.72 0.87
Sn_e Sp_e Sn_n Sp_nGenScan 0.70 0.71 0.92 0.90FGENES 1.6 0.77 0.77 0.90 0.91
![Page 44: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/44.jpg)
Prédiction de gènes eucaryotes: Prédiction de gènes eucaryotes: qualité de la prédictionqualité de la prédiction
Comparaison des différents logiciels: sensibilité/spécificité Sn: sensibilité Sp: spécificité par exon (sn_e, sp_e) ou par nucéotide (sn_e, sp_e)
Locus BRCA2 (1.4 Mb, chrom. 13q) (Sanger Centre 1999): région "difficile" pour les logiciels de prédiction. 159 exons
Sn_e Sp_e Sn_n Sp_nGenScan 0.66 0.36 0.81 0.44FGENES 1.6 0.69 0.57 0.79 0.66FGENES 1.6 masked 0.69 0.65 0.79 0.74GenScan+FGENES 0.61 0.82 0.67 0.90
![Page 45: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/45.jpg)
Prédiction de gènes protéiques completsPrédiction de gènes protéiques complets C. elegans: la plupart des ‘ gènes ’ annotés sont seulement des prédictions Peut-on utiliser ces méthodes pour annoter les séquences génomique humaines ?
+ les faux positifs !
00.20.40.60.8113579111315Sensibilité par exon:90%80%
Probabilité de détecter tous les exons d’un gènesNombre d’exons du gène
![Page 46: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/46.jpg)
Un peu d ’optimismeUn peu d ’optimisme Fraction de la longueur des gènes correctement prédits:
70-80%
Probabilité que deux exons potentiels consécutifs soient réels (et donc positifs en RT-PCR)
0.5
![Page 47: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/47.jpg)
Prédiction de gènes eucaryotes (suite)Prédiction de gènes eucaryotes (suite)
Utilisation des EST Alignement séquence génomique / cDNA (EST): SIM4 (alignement de séquences
nucléiques très fortement similaires avec ‘ épissage ’)
Approche comparative Comparaison d ’une séquence génomique avec des gènes déjà caractérisés dans d ’autres
espèces (WISE2: alignement ADN/protéine avec épissage) Comparaison de séquences génomiques (non-annotées) homologues
– Locus mnd2 (homme souris) (Jang et al. 1999): >80 kb– Prédiction d ’exons internes basée sur la conservation de séquence
ORF ≥ 80 nt
Séquence protéique ≥ 70% similarité
Séquence ADN ≥50% identité
GT AG conservés
=> détection de tous les exons internes du gène D6Mm5e
– Généralisation de la méthode (Guigo 2000). Sensibilité ? Spécificité ?
![Page 48: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/48.jpg)
Stratégies de recherche de similarités: ADN ou protéine ?Stratégies de recherche de similarités: ADN ou protéine ? Limites des recherches de similarité au niveau ADN
Alphabet réduit (4 lettres) Dégénérescence du code génétique
Mais … tout n'est pas codant régions régulatrices, ARN structuraux, ...
Deux brins!Deux brins!
![Page 49: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/49.jpg)
Traitement du bruit de fond: filtres et masquesTraitement du bruit de fond: filtres et masques Séquences de faible complexité (protéines, ADN):
40% des protéines ADN: microsatellites
15% du total des résidus exemple: CACACACACACACACACA
Ala, Gly, Pro, Ser, Glu, Gln
logiciels de filtrage: SEG, XNU, DUST
RSPPR--KPQGPPQQEGNNPQGPPPPAGGNPQQPQAPPAGQPQGPP . ::: : :: : : ::::: : :: :.: :: : :::::QGPPRPGNQQCPPPQGG--PQGPPRP--GNQQRP--PPQGGPQGPP
(filtré par défaut par BLAST)
Séquences abondantes
3000 Immunoglobulines dans GenBank
106 Alu, 105 L1 dans le génome humain
logiciels de masquage: XBLAST, RepeatMasker
NNNNNNNNNNNNN
![Page 50: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/50.jpg)
Quelle approche adopter ?Quelle approche adopter ? Recherche rapide de similarité dans les banques
algorithme (BLAST, FASTA) matrices de substitution, pondération des gaps stratégie de recherche (nucléique, protéique) traitement du bruit de fond complétude des banques de données, répéter la recherche régulièrement
Comparaison d'une séquence génomique à un cDNA (EST) BLASTN < LFASTA << SIM4 (épissage)
Comparaison d'une séquence génomique à une protéine BLASTX, FASTX << WISE2 (épissage)
Comparaison de deux séquences génomiques ADN: BLASTN < LFASTA << Smith-Waterman (SIM, LALIGN) Protéique: TBLASTX
![Page 51: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/51.jpg)
Alignement par bloc ou alignement global : comparaison BLAST / FASTA
protéine 1protéine 2A1B1C1A'1A2C2B2A2A1B1C1A'1A2C2B2A1B1C1A'1A2C2B2Recherche desimilitudeFASTABLAST
![Page 52: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/52.jpg)
Représentation graphique des similarités entre séquences: DOTTERReprésentation graphique des similarités entre séquences: DOTTER
![Page 53: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/53.jpg)
Représentation graphique des similarités entre séquences: LALNVIEWReprésentation graphique des similarités entre séquences: LALNVIEW
![Page 54: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/54.jpg)
Représentation graphique des similarités entre séquences: PIP-makerReprésentation graphique des similarités entre séquences: PIP-maker
![Page 55: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/55.jpg)
Limitation des comparaisons deux à deux (BLAST, Limitation des comparaisons deux à deux (BLAST, FASTA, ...)FASTA, ...)
Seq A CGRRLILFMLATCGECDTDSSE … HICCIKQCDVQDIIRVCC
:: : ::: :: : :
Insuline CGSHLVEALYLVCGERGFFYTP … EQCCTSICSLYQLENYCN
::: : : : :: : :
Seq B YQSHLLIVLLAITLECFFSDRK … KRQWISIFDLQTLRPMTA
Comparaisons 2 à 2:
Insuline / Seq A : 25% d'identité
Insuline / Seq B : 25% d'identité
![Page 56: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/56.jpg)
Alignement de séquences de la famille des insulinesAlignement de séquences de la famille des insulines
B-chain A-chain
INSL4 Q14641 ELRGCGPRFGKHLLSYCPMPEKTFTTTPGG...[x]58 ....SGRHRFDPFCCEVICDDGTSVKLCT
INSL3 P51460 REKLCGHHFVRALVRVCGGPRWSTEA.......[x]51 ....AAATNPARYCCLSGCTQQDLLTLCPY
RLN1 P04808 VIKLCGRELVRAQIAICGMSTWS..........[x]109 ....PYVALFEKCCLIGCTKRSLAKYC
BBXA P26732 VHTYCGRHLARTLADLCWEAGVD..........[x]25 ........GIVDECCLRPCSVDVLLSYC
BBXB P26733 ARTYCGRHLADTLADLCF--GVE..........[x]23 ........GVVDECCFRPCTLDVLLSYCG
BBXC P26735 SQFYCGDFLARTMSILCWPDMP...........[x]25 ........GIVDECCYRPCTTDVLKLYCDKQI
BBXD P26736 GHIYCGRYLAYKMADLCWRAGFE..........[x]25 ........GIADECCLQPCTNDVLLSYC
LIRP P15131 VARYCGEKLSNALKLVCRGNYNTMF........[x]58 ........GVFDECCRKSCSISELQTYCGRR
MIP I P07223 RRGVCGSALADLVDFACSSSNQPAMV.......[x]29 ....QGTTNIVCECCMKPCTLSELRQYCP
MIP II P25289 PRGICGSNLAGFRAFICSNQNSPSMV.......[x]44 ....QRTTNLVCECCFNYCTPDVVRKYCY
MIP III P80090 PRGLCGSTLANMVQWLCSTYTTSSKV.......[x]30 ....ESRPSIVCECCFNQCTVQELLAYC
MIP V P31241 PRGICGSDLADLRAFICSRRNQPAMV.......[x]44 ....QRTTNLVCECCYNVCTVDVFYEYCY
MIP VII P91797 PRGLCGNRLARAHANLCFLLRNTYPDIFPR...[x]86 ..EVMAEPSLVCDCCYNECSVRKLATYC
ILP P22334 AEYLCGSTLADVLSFVCGNRGYNSQP.......[x]31 ........GLVEECCYNVCDYSQLESYCNPYS
INS P01308 NQHLCGSHLVEALYLVCGERGFFYTPKT.....[x]35 ........GIVEQCCTSICSLYQLENYCN
IGF1 P01343 PETLCGAELVDALQFVCGDRGFYF.........[x]12 ........GIVDECCFRSCDLRRLEMYCAPLK
IGF2 P01344 SETLCGGELVDTLQFVCGDRGFYF.........[x]12 ........GIVEECCFRSCDLALLETYCATPA
*. .* ** * . *
![Page 57: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/57.jpg)
NH3-SSSSSSA-chain- COOHB-chainC-peptideSSSSSS signal peptideB chainA chainC peptide
Structure des insulines
![Page 58: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/58.jpg)
Représentation d ’un motif conservé par une Représentation d ’un motif conservé par une matrice de matrice de fréquences (profil)fréquences (profil)
Exemple: site donneur d ’épissage (vertébrés)
Matrice de fréquence (pourcentage):
Base Position
-3 -2 -1 +1 +2 +3 +4 +5 +6
A 33 60 8 0 0 49 71 6 15
C 37 13 4 0 0 3 7 5 19
G 18 14 81 100 0 45 12 84 20
T 12 13 7 0 100 3 9 5 46
Cons. M A G G T R A G T
Exon IntronExon Intron
![Page 59: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/59.jpg)
Recherche d ’un motif dans une séquence à l ’aide d ’un Recherche d ’un motif dans une séquence à l ’aide d ’un profilprofil
Calcul des scores de similarité en faisant glisser une fenêtre de la longueur du motif le long de la séquence. Exemple:
A 33 60 8 0 0 49 71 6 15
C 37 13 4 0 0 3 7 5 19
G 18 14 81 100 0 45 12 84 20
T 12 13 7 0 100 3 9 5 46
GAAAGGTGAGTCAT...
GAAAGGTGA S=18+60+8+0+0+45+9+84+15=239
.AAAGGTGAG S=33+60+8+100+0+3+12+6+20=242
..AAGGTGAGT S=33+60+81+100+100+45+71+84+46=620
...AGGTGAGTC S=33+14+81+0+0+49+12+5+19=213
....GGTGAGTCA …etc
![Page 60: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/60.jpg)
PSI-BLASTPSI-BLAST
Position-Specific Iterated BLAST 1-recherche BLAST classique (protéine) 2-construction d'une matrice de pondération (profil) avec les séquences
similaires détectées 3-recherche BLAST à partir de ce nouveau profil 4-itération des étapes 2-3 jusqu'à convergence
plus sensible que Smith-Waterman 40 fois plus rapide
![Page 61: Searching for functional regions (coding or non-coding) in mammalian genomes](https://reader034.fdocuments.in/reader034/viewer/2022051401/568144ea550346895db1bb2c/html5/thumbnails/61.jpg)
Comparaison d ’une séquence génomique à un Comparaison d ’une séquence génomique à un motif ou à une banque de motifsmotif ou à une banque de motifs
Banques de données de motifs protéiques PROSITE BLOCKS PFAM PRODOM PRINTS
Logiciels de comparaison d ’une séquence à une banque de motifs, ou de comparaison d ’un motif à une banque de séquences Pfscan: profils WISE2