Running title: groEL Vibrio vulnificusmicrobiology.scu.edu.tw/MIB/wong/research/pdf/2004-8.pdf · 1...
Transcript of Running title: groEL Vibrio vulnificusmicrobiology.scu.edu.tw/MIB/wong/research/pdf/2004-8.pdf · 1...
1
FSAC #92607
Cloning, sequencing and expression of a GroEL-like protein gene of
Vibrio vulnificus
Hin-chung Wong1*, Kai-Hsi Lu1 and James D. Oliver2
1Department of Microbiology, Soochow University, Taipei, Taiwan,
Republic of China and 2Department of Biology, University of North
Carolina at Charlotte, Charlotte, North Carolina, U.S.A.
Running title: groEL gene of Vibrio vulnificus
*To whom correspondence and reprint requests should be addressed.
Mailing address: Department of Microbiology, Soochow University,
Taipei, Taiwan 111, Republic of China. Tel: 8862-8819471 Ext. 6852; Fax
8862-28831193; E-mail: wonghc@ scu.edu.tw
First Draft: Dec. 23, 2003
Revised: Sept. 12, 2004
2
ABSTRACT
Vibrio vulnificus causes wound infection and septicemia in
humans with high mortality via the consumption of contaminated
seafood. This study cloned, sequenced and analyzed the general
properties of the GroEL-like protein gene of this pathogen. A 1.6 kb
amplified DNA fragment from V. vulnificus ATCC27562 was cloned
into pGEM-T Vector and nucleotide sequenced. The open reading
frame consisted of 1,644 bp, and encoded for a 57.7 kDa GroEL-like
protein of 547 amino acids. The amino acid sequence of the V.
vulnificus GroEL-like protein showed high identity (82-92%) with
other GroEL proteins, especially those of vibrios, E. coli and S.
enterica Typhi. The amino acid residues 269 to 282 of the V. vulnificus
GroEL-like protein were significantly more hydrophobic than others,
with two basic lysine residues replaced by hydrophobic isoleucine
residues. The groEL-like gene of V. vulnificus was cloned into the
pQE-30 expression vector and expression of a His-tagged GroEL-like
protein was rapidly induced by isopropyl-β-D- thiogalactopyranoside
and confirmed by immunoblotting with anti-GroEL and Penta-His
antibodies. The over-produced GroEL-like protein of V. vulnificus
was present largely in an insoluble form. Results of this report may
facilitate the study of responses of V. vulnificus to environmental
stresses.
Key Words: Vibrio vulnificus, GroEL, heat shock protein, nucleotide
sequence
3
INTRODUCTION
Vibrio vulnificus causes human wound infection and septicemia,
largely a result of occupational activities around seawater. V. vulnificus
occurs in high numbers in molluscan shellfish, primarily oysters, and its
ingestion in raw oysters results in a ca. 60% mortality in those persons
who are susceptible to this bacterium (Linkous and Oliver 1999). In
addition to humans, V. vulnificus is also pathogenic to aquatic and other
animals, such as eels, shrimp, mice, etc. (Amaro et al, 1994; Biosca et al,
1999).
The physiology and virulence of pathogenic vibrios are affected by
environmental stresses (Parsot and Mekalanos 1990; Yildiz and Schoolnik
1998). In V. vulnificus, highly variable responses to environmental
stresses are found in different strains. Starvation enhances freeze-thaw
resistance and heat tolerance for some strains (Bang and Drake 2002).
Other than studies on the viable but nonculturable state, the effect of
various stresses on V. vulnificus has not been well characterized. Since the
presence of the environmental stress mediator ToxRS protein has been
shown in V. vulnificus (Lee et al, 2000), V. vulnificus may also have
tightly regulated responses to environmental changes, as do V. cholerae,
V. parahaemolyticus and other vibrios.
Beside their chaperone activity, GroEL proteins are also associated
with the virulence of some pathogenic bacteria. The GroEL-like protein
of Actinobacillus actinomycetemcomitans is found in extracellular
material and is strongly toxic for HaCaT epithelial cells (Goulhen et al,
4
1998). A significant amount of GroEL homolog protein is absorbed on
the surface of Helicobacter pylori (Dunn et al, 1997). The GroEL-like
protein of Campylobacter rectus stimulates both interleukin-6 and IL-8
secretion by a confluent monolayer of human gingival fibroblast cells
(Hinode et al, 1998). During infection, V. vulnificus moves from the
environment into the human body and is challenged by a shift-up of
incubation temperature. Heat shock proteins like GroEL may be produced
and play a role in the pathogenesis of this bacterium. In this study, the
groEL-like gene of V. vulnificus was cloned using polymerase chain
reaction (PCR) method with primers derived from the conserved
sequences of the Salmonella enterica serotype Typhi groEL gene (Lindler
and Hayes 1994; Rusanganwa et al, 1992), and the cloned gene was
sequenced and analyzed.
MATERIALS AND METHODS
Bacterial strain and cultivation
The type strain V. vulnificus ATCC27562 was used for the cloning of
the groEL-like gene in this study. It is a hemolytic strain isolated from a
human blood sample (Okada et al, 1987). Bacterial strains were stored in
culture broth with 10% glycerol at–85°C. V. vulnificus was cultured in
Tryptic Soy Agar (TSA, Difco Laboratories, Detroit, MI, USA) with a
supplement of 3% NaCl, or Luria-Bertani Agar Medium (LA, Difco)-3%
NaCl (pH 7.5) at 37C. For the purification of chromosomal DNA, a
single colony of V. vulnificus was inoculated into 100 ml Luria-Bertani
Broth Medium (LB, Difco)-3% NaCl and cultured at 37°C for 16 h.
5
Escherichia coli JM109 was cultured in these media without additional
NaCl.
DNA techniques
Purification of plasmids and genomic DNA, analysis of DNA by
agarose gel electrophoresis, preparation of competent cells and plasmid
transformation techniques were as described by Sambrook et al.
(Sambrook et al, 1989). PCR amplified products were separated by gel
electrophoresis and purified by a gel band purification kit (Pharmacia,
Uppsala, Sweden).
Cloning and sequencing
The groEL-like gene of V. vulnificus was amplified by PCR using
primers (5’-CGCGGATCCGCGATGG
ACGCTAAAGACGTAAAATTCGG,3’-CGCGGATCCGCGTTACAT
CATGCCGCCCATGCCAC) designed according to the S. typhi groEL
gene sequence (Lindler and Hayes 1994). PCR was performed by a
Personal cycler 20 (Biometra biomedizinische analytik Gmbh, Gottingen,
Germany) with the following parameters: 94 °C for 1 min, followed by
30 cycles of 94 °C for 1 min, 55 °C for 1 min, and 72 °C for 1.5 min, and
finally, an additional 10 min at 72 oC (Wong et al, 1998).
The 1.6 kb amplified fragment was cloned into pGEM-T Vector
(Promega Corp., Madison, WI, USA) by the TA cloning techniques (Zhou
and Gomez-Sanchez 2000) and transformed into E. coli JM109 recipient
cells (Sambrook et al, 1989).
6
The DNA sequence of the insert in the recombinant plasmid was
determined in both strands with primers for the vector and internal
primers. DNA sequencing was performed on an ALFexpress DNA
Sequencer (Pharmacia) by fluorescence-based dideoxy-sequence
reactions. The sequence was confirmed by repeating the determinations
with an ABI Prism dye terminator cycle sequence kit and an ABI model
377-96 DNA Sequencer (Applied Biosystems, Foster City, CA, USA).
The Deep Vents DNA polymerase of high PCR fidelity (New England
Biolabs, Beverly, MA, USA) was used in these sequencing reactions
(Cline et al, 1996).
Sequence analysis
The sequence determined in this study was compared with homologous
sequences from the GenBank Library using BLAST software from the
National Center for Biotechnology Information. The amino acid sequence
was generated and its properties analyzed by the Expert Protein Analysis
System of the Swiss Institute of Bioinformatics. Human leukocyte
antigens (HLA) peptide motifs prediction was done using the world wide
web (http://bimas.dcrt.nih.gov/) based on Parker et al. 1994 (Parker et al,
1994). The B cells epitope prediction of the amino acid sequences were
done manually (Cancino-Diaz et al, 1998).
Expression and analysis of the GroEL-like protein
The insert from the recombinant plasmid was excised by BamH1
digestion, cloned into the QIAexpressionist pQE-30 expression vector
7
(Qiagen GmbH, Hilden, Germany) and transformed into E. coli JM109
(Chow et al, 2000). The transformed bacteria were cultured in
Luria-Bertani Broth (Difco) supplemented with ampicillin (200 μg/ml)
and expression of the recombinant protein was induced with 1 mM
isopropyl-β-D- thiogalactopyranoside (IPTG) at 37°C for 30 min to five
hours. The bacterial cells were harvested by centrifugation and lysed by a
lysozyme treatment (Thies et al, 1999). Soluble and insoluble fractions
were separated by centrifugation at 10,000g for 15 min at 4°C. The
GroEL-like protein was analyzed by SDS-polyacrylamide gel
electrophoresis and immunobloting using an anti-GroEL antibody (Sigma
Co., St. Louis, MO, USA) or Penta-His antibody (Qiagen)(Wong et al,
1998; Wong et al, 2002). A prestained protein ladder (Gibco-BRL,
Gaithersburg, MD, USA) was used as molecular size markers.
Accession numbers
The groEL-like gene sequence of V. vulnificus reported in this paper
has been submitted in 2000 to the GenBank Data Library under the
accession number AY017169.
RESULTS AND DISCUSSION
A 1.6 kb amplified DNA fragment from V. vulnificus ATCC27562 was
cloned into a pGEM-T Vector and nucleotide sequenced (GenBank
accession number AY017169). The open reading frame consisted of 1,644
bp and encoded a 57.7 kDa GroEL-like protein. The properties of this V.
vulnificus deduced GroEL-like protein were similar to those of other
8
Vibrio species, S. enterica serotype Typhi and E. coli. The V. vulnificus
GroEL-like protein consisted of 547 amino acids with a theoretical pI of
ca. 4.71. The GroEL protein of V. cholerae (GenBank accession no
AAF95805) consisted of 544 amino acids, 57.2 kDa, and pI of 4.78,
while the GroEL protein of V. parahaemolyticus (GenBank accession no
AAF27528) consisted of 548 amino acids, 57.6 kDa, and a pI of 4.68. A
typical structure of GroEL molecules, a Gly-Gly-Met repeat at the
C-terminus, was found in the V. vulnificus groEL-like sequence (Fig. 1).
The deduced amino acid sequence of the V. vulnificus GroEL-like
protein was compared to known bacterial HSP60 or GroEL protein
sequences. It is highly similar to the groEL sequences of V. vulnificus
YJ016 and CMCP6 which were released after the completion of our
present study (Table 1). High amino acid identity (82-92%) was found in
all other sequences, and the amino acid sequence of the V. vulnificus
GroEL-like protein showed especially high identity with GroEL proteins
of V. cholerae (91%) and V. parahaemolyticus (92%) (Table 1).
Alignment of the deduced amino acid sequence of V. vulnificus with
GroEL protein sequences of other vibrios, E. coli and S. enterica Typhi
(Fig. 1) showed extensive similarity throughout its length, confirming its
identity as a GroEL homolog.
GroEL proteins are strong human leukocyte antigens (HLA), and are
associated with inflammatory diseases, such as ankylosing spondylitis
(Cancino-Diaz et al, 1998). Epitopes with a strong affinity for HLA have
been identified using computer software (Parker et al, 1994). In this study,
9
the GroEL proteins of V. vulnificus, V. cholerae, V. parahaemolyticus, E.
coli, and S. enterica Typhi were compared. These pathogens differ in
pathogenesis, however, when the motifs for different HLA molecules
were analyzed, their GroEL proteins exhibited similar but not identical
patterns. All the motifs for the HLA-B27 molecule have an arginine
residue in the second position of the nonapeptides (Cancino-Diaz et al,
1998). Twenty-three arginine residues were present in the GroEL-like
protein of V. vulnificus; therefore, 23 nonapeptides with affinity for the
HLA-B27 molecule, were identified; among these, three showed high
affinity, namely residues 57-65 (AREIELEDK, score of 2000, score is the
estimation of half time of disassociation of a molecule containing this
sequence), residues 284-292 (RRKAMLQDI, score of 1800) and residues
444-452 (LRAMEAPLR, score of 1000). All the GroEL-like proteins of
these three Vibrio species exhibited similar motif sequences, except for
the nonapeptide residues 117-125 (KRGIDKAVA), in which the V.
cholerae GroEL-like protein had a isoleucine rather than an alanine
residue in the last position and had an affinity score increased from 600 to
1800. Motif sequences of GroEL-like proteins of these three Vibrio
species differed from those of E. coli and S. enterica Typhi by a single
nonapeptide (residues 12-20, ARVKMLEGV) with a glutamic acid as a
substitute for an arginine.
Three B cell epitopes, corresponding to those of E. coli, were identified
in the GroEL-like proteins of V. vulnificus, V. cholerae and V.
parahaemmolyticus species (Cancino-Diaz et al, 1998); they were
residues 283-291 (DRRKAMLQD), 361-369 (DKEKLQERV) and
10
390-398 (KEKKDRVED) with only a single amino acid switch in the last
two sequences (Fig. 1). The arginine and alanine in residue 362 and 394
of the E. coli GroEL were replaced by lysine and aspartic acid,
respectively, in the GroEL-like proteins of these three vibrios. The HLA
and B cell epitope analysis showed that the antigenic properties of
GroEL-like protein of V. vulnificus were similar to other GroEL proteins.
The hydrophobicity of the GroEL-like protein amino acid sequence of
V. vulnificus (Fig. 2A) was compared with the E. coli GroEL (Fig. 2B).
Identical hydrophobicity profile was observed in both sequences,
although amino acid residues 269 to 282 of the V. vulnificus GroEL-like
protein were significantly more hydrophobic than the relative segment of
E. coli GroEL (Fig. 2B). In this segment, two basic lysine residues were
replaced by two hydrophobic isoleucine residues in the V. vulnificus
GroEL (Fig. 1). GroEL proteins are chaperonins forming ring-shaped
oligomeric protein complexes that are of crucial importance for protein
folding in vivo. The interior cavity of GroEL offers a hydrophilic-like
environment to the substrate protein (Betancourt and Thirumalai 1999).
The hydrophobic portion of the GroEL protein sequence is involved in
the recognition and stabilization of the protein and substrate complexes
(Fenton and Horwich 1997; Sparrer et al, 1996). Such enhancement of
hydrophobicity of certain segments of the GroEL protein may affect its
chaperonin activity.
The three-dimensional configuration of the V. vulnificus GroEL-like
protein was also generated by the Expert Protein Analysis System of
11
Swiss Institute of Bioinformatics and showed similar spatial
configuration with the GroEL of E. coli (data not shown).
The groEL-like gene of V. vulnificus was excised by BamH1
digestion and cloned into the QIAexpressionist pQE-30 expression vector
and transformed into E. coli JM109. Expression of the His-tagged V.
vulnificus GroEL-like protein was analyzed and confirmed by gel
electrophoresis followed by immunoblotting with anti-GroEL or
Penta-His antibody. It was slightly larger than the deduced 57.7 kDa
GroEL-like protein (Fig. 3). Expression of the V. vulnificus GroEL-like
protein was induced by IPTG for 30 min to two hours, and a high
quantity of GroEL-like protein was detected that reached a maximum
level in about one hour (Fig. 3).
The IPTG-induced bacterial cultures were lysed and the soluble and
insoluble fractions were analyzed. Only small amounts of V. vulnificus
GroEL-like protein were detected in the soluble fraction, while large
amounts were in the insoluble fraction (Fig. 3). GroEL and DnaK are
known to be antagonist controllers of inclusion body formation by
promoting and preventing, respectively, the aggregation of proteins in the
cytoplasm (Carrio and Villaverde 2003). It was thus reasonable to
observe the presence of inclusion bodies of the over-produced V.
vulnificus GroEL-like protein while DnaK protein did not simultaneously
enhance inclusion body formation. The solublized form may be produced
by reducing the IPTG stimulation or by simultaneous over-producing
both GroEL or DnaK proteins to obtain the functional V. vulnificus
12
GroEL-like protein for further study.
In conclusion, the GroEL-like protein gene of V. vulnificus was cloned,
sequenced and over-produced by IPTG induction, largely in an inclusion
body form. Properties of this GroEL-like protein were similar to other
corresponding proteins of other bacterial species.
ACKNOWLEDGEMENT
The authors would like to thank the National Science Council of the
Republic of China (Contract No. NSC91-2311-B-031-001) for financially
supporting this research.
13
REFERENCES
Amaro C, Biosca EG, Fouz B, Toranzo AE and Garay E. 1994. Role of
iron, capsule, and toxins in the pathogenicity of Vibrio vulnificus
biotype 2 for mice. Infect. Immun. 62: 759-763.
Bang W and Drake MA. 2002. Resistance of cold- and starvation-stressed
Vibrio vulnificus to heat and freeze-thaw exposure. J. Food Prot. 65:
975-980.
Betancourt MR and Thirumalai D. 1999. Exploring the kinetic
requirements for enhancement of protein folding rates in the GroEL
cavity. J. Mol. Biol. 287: 627-644.
Biosca EG, Collado RM, Oliver JD and Amaro C. 1999. Comparative
study of biological properties and electrophoretic characteristics of
lipopolysaccharide from Eel-virulent and Eel-avirulent Vibrio
vulnificus strains. Appl. Environ. Microbiol. 65: 856-858.
Cancino-Diaz M, Curiel-Quesada E, Garcia-Latorre E and
Jimenez-Zamudio L. 1998. Cloning and sequencing of the gene that
codes for the Klebsiella pneumoniae GroEL-like protein associated
with ankylosing spondylitis. Microb. Path. 25: 23-32.
Carrio MM and Villaverde A. 2003. Role of molecular chaperones in
inclusion body formation. FEBS Lett. 537: 215-221.
Chow LP, Chiou SH, Hsiao MC, Yu CJ and Chiang BL. 2000.
Characterization of Pen n 13, a major allergen from the mold
14
Penicillium notatum. Biochem. Biophys. Res. Commun. 269: 14-20.
Cline J, Braman JC and Hogrefe HH. 1996. PCR fidelity of pfu DNA
polymerase and other thermostable DNA polymerases. Nucleic
Acids Res. 24: 3546-3551.
Dunn BE, Vakil NB, Schneider BG, Miller MM, Zitzer JB, Peutz T and
Phadnis SH. 1997. Localization of Helicobacter pylori urease and
heat shock protein in human gastric biopsies. Infect. Immun. 65:
1181-1188.
Fenton WA and Horwich AL. 1997. GroEL-mediated protein folding.
Protein Sci. 6: 743-760.
Goulhen F, Hafezi A, Utto V-J, Hinode D, Nakamura R, Grenier D and
Mayrand D. 1998. Subcellular localization and cytotoxic activity of
the GroEL-like protein isolated from Actinobacillus
actinomycetemcomitans. Infect. Immun. 66: 5307-5313.
Hinode D, Yoshioka M, Tanabe S, Miki O, Masuda K and Nakamura R.
1998. The GroEL-like protein from Campylobacter rectus:
immunological characterization and interleukin-6 and -8 induction in
human gingival fibroblast. FEMS Microbiol. Lett. 167: 1-6.
Lee SE, Shin SH, Kim SY, Kim YR, Shin DH, Chung SS, Lee ZH, Lee
JY, Jeong KC, Choi SH and Rhee JH. 2000. Vibrio vulnificus has the
transmembrane transcription activator ToxRS stimulating the
expression of the hemolysin gene vvhA. J. Bacteriol. 182:
3405-3415.
15
Lindler LE and Hayes JM. 1994. Nucleotide sequence of the Salmonella
typhi groEL heat shock gene. Microb. Path. 17: 271-275.
Linkous DA and Oliver JD. 1999. Pathogenesis of Vibrio vulnificus. Fems
Microbiol. Lett. 174: 207-214.
Okada K, Mitsuyama M, Miake S and Amako K. 1987. Monoclonal
antibodies against the haemolysin of Vibrio vulnificus. J. Gen.
Microbiol. 133 ( Pt 8): 2279-2284.
Parker KC, Bednarek MA and Coligan JE. 1994. Scheme for ranking
potential HLA-A2 binding peptides based on independent binding of
individual peptide side-chains. J. Immunol. 152: 163-175.
Parsot C and Mekalanos JJ. 1990. Expression of ToxR, the transcriptional
activator of the virulence factors in Vibrio cholerae, is modulated by
the heat shock response. Proc. Natl. Acad. Sci. U.S.A. 87:
9898-9902.
Rusanganwa E, Singh B and Gupta RS. 1992. Cloning of HSP60 (GroEL)
operon from Clostridium perfringens using a polymerase chain
reaction based approach. Biochim. Biophys. Acta. 1130: 90-94.
Sambrook, J., Fritsch, E. F. and Maniatis, T. (1989) Molecular cloning: a
laboratory manual. Cold Spring Harbor, New York: Cold Spring
Harbor Laboratory Press.
Sparrer H, Lilie H and Buchner J. 1996. Dynamics of the GroEL-protein
complex: effects of nucleotides and folding mutants. J. Mol. Biol.
258: 74-87.
16
Thies FL, Weishaupt A, Karch H, Hartung HP and Giegerich G. 1999.
Cloning, sequencing and molecular analysis of the Campylobacter
jejuni groESL bicistronic operon. Microbiology 145 ( Pt 1): 89-98.
Wong HC, Peng PY, Han JM, Chang CY and Lan SL. 1998. Effect of
mild acid treatment on the survival, enteropathogenicity, and protein
production in Vibrio parahaemolyticus. Infect. Immun. 66:
3066-3071.
Wong HC, Peng PY, Lan SL, Chen YC, Lu KH, Shen CT and Lan SF.
2002. Effects of heat shock on the thermotolerance, protein
composition, and toxin production of Vibrio parahaemolyticus. J.
Food Prot. 65: 499-507.
Yildiz FH and Schoolnik GK. 1998. Role of rpoS in stress survival and
virulence of Vibrio cholerae. J. Bacteriol. 180: 773-784.
Zhou MY and Gomez-Sanchez CE. 2000. Universal TA cloning. Curr.
Issues Mol. Biol. 2: 1-7.
17
Table 1. Comparison of the amino acid sequence of the GroEL-like
protein of Vibrio vulnificus with other published bacterial sequences.
SpeciesGenBank Accession
NumberIdentity, %
Vibrio vulnificus YJ016 AP005342 97
Vibrio vulnificus CMCP6 AE016801 96
Vibrio parahaemolyticus AAF27528 92
Vibrio cholerae AAF95805 91
Escherichia coli O157:H7 BAB38547 84
Pasteurella multocida AAK03191 84
Actinobacillus
actinomycetemcomitansBAA05977 84
Salmonella enterica Typhi AAA85277 84
Enterobacter aerogenes BAA25215 83
Haemophilus influenzae AAC22201 83
Klebsiella pneumoniae BAA25225 83
Yersinia enterocolitica S26423 82
18
Legends for Figures
Fig. 1. Aligment of the amino acid sequence of the GroEL-like protein of
Vibrio vulnificus with the corresponding published sequences of
V. parahaemolyticus (VP), V. cholerae (VC), Salmonella enterica
serotype Typhi (SE) and Escherichia coli (EC). Positions that are
identical in all five bacterial species are noted with asterisks.
Gaps have been introduced to maximize similarity. The
hydrophobic amino acid residues 269 to 282 are in bold. The
underlined amino acid sequences are the predicted B cell
epitopes.
Fig. 2. Hydrophobicity of the amino acid sequences of the GroEL-like
protein of Vibrio vulnificus (A) and Escherichia coli (B). The
score represents the hydrophobicity of the amino acid residue in
the sequence. Higher the number represent higher hydrophobicity
of the residue.
Fig. 3. Expression of the recombinant GroEL-like protein of Vibrio
vulnificus in the soluble (A) and insoluble fraction (B). The
bacterial culture was induced by ITPG for 30 min (lane 1), 1 h
(lane 2) and 2 h (lane 3), and the proteins separated into soluble
and insoluble fractions (B) and visualized by immunoblotting
with Penta-His antibody. Lane M contains the prestained protein
ladder markers (Gibco-BRL), 79.6, 61.3 and 49.0 kDa, from top.
19
VV MAAKDVKFGNDARVKMLEGVNILADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIVP .....................V......................................VC ......R.....................................................SE .................R...V......................................EC .................R...V......................................
****** ********** *** **************************************VV ELEDKFQNMGAQMVKQVASQANDVAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIVP ...............E...K...A....................................VC ...............E.......A....................................SE ......E........E...K...A.............S.IT...................EC ......E........E...K...A...............IT...................
****** ******** *** *** ************* * *******************VV DKAVAAAVEELKAMSKDCSTSTEIEQVGTISANSDSSVGKIIAEAMEKVGRDGVITVEEGVP .........Q..EL.VE.NDTKA.AQ.............N.......R............VC ....I........L.VP.ADTKA.A..............N....................SE .............L.VP..D.KA.A..........ET...L.....D...KE......D.EC ....T........L.VP..D.KA.A..........ET...L.....D...KE......D.
**** **** *** * * * ********* ** ***** ** ****** *VV QALHDELDVVEGMQFDRGYLSPYFINNQESGSVELESPFFLLVDKKISNIRELLPALEAVVP ...Q.........................A......N.......................VC ...Q...............................DN..I...............V..G.SE TG.Q......................KP.T.A.......I..A.........M..V....EC TG.Q......................KP.T.A.......I..A.........M..V....
* ********************** * * *** ** ** ********* ** ** *VV AKASRPLLIIAEDVEDEALATLVVNNMRGIVIVAAVIAPGFGDRRKAMLQDIAILTGGTVVP ...............................K............................VC .........V.....G...............K....K.....................V.SE ...GK..........G.........T.....K....K................T......EC ...GK..........G.........T.....K....K................T......
*** **** ***** ********* ***** **** **************** **** *VV ISEEVGLELEKATLEDLGQAKRVSITKENTTIIDGVGEEAMIQGRVAQIRQQIEDATSDYVP ....I..............................A........................VC ....I........................S.....A.DQ.A.............E.....SE ....I.M................V.N.DT...........A.............E.....EC ....I.M................V.N.DT...........A.............E.....
**** * **************** * * ***** * * ************* *****VV DKEKLQERVAKLAGGVAVIKVGAATEVKMKEKKDRVEDALHATRAAVEEGIVAGGGVALIVP ...........................E......................V.........VC ...........................E......................V.........SE .R.........................E.....A................V.........EC .R.........................E.....A................V.........
* ************************* ***** **************** *********VV RAASKIVDLQGDNEEQNVGIRVALRAMEAPLRQITKNAGDEESVVANNVRAGEASYGYNAVP .........E...........................................G......VC .....LSS.V........................V..................GN.....SE .V....A..K.Q..D.....K.............VL.C.E.P.....T.KG.DGN.....EC .V...LA..R.Q..D.....K.............VL.C.E.P.....T.KG.DGN.....
* *** * * ** ***** ************* * * * ***** * * *****VV ATGVYGDMLEMGILDPTKVTRSALQFAASVAGLMITTEAMVTDLPQKDS----GMPDMGGVP ...E...........................................E.AGMPD.GG...VC ........I...............................I.E..K..AP---A....-.SE ..EE..N.ID...............Y............C......KS.A------..L.AEC ..EE..N.ID...............Y............C......KN.AADLGAAGG...
** ** * *************** ************ * * **VV MGGMGGMVP .......VC .......SE A......EC .......
******
20
Fig. 1
21
A
B
Fig. 2
22
A
M 1 2 3
B
M 1 2 3
Fig. 3