POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution...
Transcript of POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution...
![Page 1: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/1.jpg)
1
Student Profile Book 2011
POISEDFOR THE WORLD
![Page 2: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/2.jpg)
2 3
Student Profile Book 2011
Indian School of Business
![Page 3: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/3.jpg)
4 5
ContentsDean’s message 6
About the ISB 7
Class of 2011 8
Student clubs: Class of 2011 9
Placement process at the ISB 10
Important dates 11
Contact details 11
PGP core courses 2010 - 11 13
PGP elective courses 2010 - 11 14
Student Profiles - 8 years and above experience 18
Student Profiles - 6 to 8 years experience 28
Student Profiles - 4 to 6 years experience 44
Student Profiles - up to 4 years experience 82
Student Index 123
![Page 4: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/4.jpg)
6 7
Associate Schools
Dear Associate,
It is with great pride that I introduce to you the ISB’s tenth graduating class of the Post Graduate Programme in Management.
In keeping with the ISB’s vision of grooming future leaders, the ISB has over the nine years, consistently shaped high quality
business leaders, who are valued as much for their analytical capabilities, as for their maturity and leadership skills. The 571
students of the Class of 2011 are well equipped to take this tradition forward.
The Class is diverse in terms of academic, professional and cultural backgrounds. Many of them have international work
experience and have worked across different countries and cultures. They are well-rounded individuals, with much more than
academic achievement to their credit.
At the ISB, we pride ourselves in providing our students with a transformational experience. I am sure that they will bring to
their professional pursuits, a global perspective with an understanding of business practices in emerging markets, and more
importantly, a perceptive mindset to adapt to changing business realities.
We look forward to working with you to provide the best talent for your organisation.
Best Regards,
Ajit Rangnekar
Dean, Indian School of BusinessThe Indian School of Business (ISB) is a
research driven, internationally top ranked,
management institution that grooms business
leaders for India and the world. In a rapidly
changing business landscape, this would
require young leaders with an understanding of
evolving economies and global perspectives.
The ISB is committed to its role in creating
such leaders through its innovative
programmes, outstanding faculty and thought
leadership. With a strong focus on emerging
markets, the ISB brings together best global
practices and relevant research insights
to further its vision of becoming a leading
business school.
Associations with international B-schools
Academic associations with The Wharton
School, The Kellogg School of Management
and The London Business School have helped
the ISB develop a world-class curriculum that
enables students to gain unique insights into
global business. The one year post graduate
programme at the ISB compares with the best
around the world. It is an intense programme,
designed for the most talented students and
taught by world renowned faculty.
Global recognitionThe ISB was ranked 12 among the top
B-schools in the world by the Financial Times,
London. This achievement is particularly
laudable, as it was achieved in just eight years
since the School’s inception. The ISB is the first
Indian B-school to feature in this elite list.
Dean’s message
About the ISB
![Page 5: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/5.jpg)
8 9
Class size - 571
No.of Students %
Men 424 72%
Women 147 28%
GMAT distribution
750 and above 14%
700 - 740 59%
650 - 690 21%
600 - 640 6%
Industry distribution
Information Technology 27%
Finance 15%
Consulting 14%
Telecom 6%
FMCG 4%
Energy 4%
Real Estate 3%
Automobile 3%
Advertising 3%
Healthcare 2%
Education and Research 2%
Govt./ PSU 1%
Manufacturing 1%
Armed Forces 1%
Others 14%
Work function distribution
IT Consulting/ Products 21%
Operations 19%
Marketing 15%
Finance 9%
Consulting 6%
General Management/ Administration 5%
Accounting 2%
Medicine 1%
Advertising/ Media 1%
Others 21%
Age distribution Avg 27 yrs
35 and above 1%
30 - 35 13%
25 - 30 72%
Below 25 14%
Work experience Avg 5 yrs
8 years and above 6%
7 - 8 years 4%
6 - 7 years 9%
5 - 6 years 14%
4 - 5 years 24%
3 - 4 years 25%
2 - 3 years 18%
The Class of 2011 at the ISB is a diverse pool of experience and exposure. The one year post graduate programme at the
School attracts some of the finest talent from across industries with cross-functional expertise. Diverse backgrounds, including
consulting, finance, marketing, technology, and even defence and medicine ensure a healthy exchange of ideas and a rich
classroom experience.
Business Technology Club
Members 270
Years of Average Experience 5.3
Emerging Markets Club
Members 350
Years of Average Experience 5.7
Entrepreneurship and Venture Capital
Club
Members 320
Years of Average Experience 5.0
Consulting Club
Members 415
Years of Average Experience 4.5
Energy, Manufacturing and Operations
Club
Members 214
Years of Average Experience 4.5
Finance Club
Members 337
Years of Average Experience 4.5
General Management Club
Members 430
Years of Average Experience 4.9
Marketing Club
Members 334
Years of Average Experience 5.0
Net Impact Club
Members 254
Years of Average Experience 5.0
Healthcare Club
Members 130
Years of Average Experience 5.3
Media and Entertainment Club
Members 173
Years of Average Experience 4.8
Real Estate and Infrastructure Club
Members 142
Years of Average Experience 5.0
Retail Club
Members 178
Years of Average Experience 5.0
The wide variety of Student Clubs reflect the diversity of the ISB community.
The Clubs give students opportunities to apply what has been learnt in the
classroom and to gain invaluable leadership and life skills. In addition to
connecting them with others who have similar interests, the students get a
platform to interact with alumni and professionals in their respective fields
of interest, helping them build formal and informal networks, while exploring
career opportunities.
Class of 2011 Student clubs: Class of 2011
![Page 6: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/6.jpg)
10 11
Policies for Recruiters
The placement process is designed to ensure that both the
recruiter and the student are able to spend quality time with
each other and arrive at satisfying decisions. The Career
Advancement Services (CAS) office at the ISB will work
towards ensuring a flawless placement process.
To optimise the recruiting experience, CAS follows a five-
step process:
• OnlineRegistration
• Pre-placementTalks
• Jobpostings,Applications(ExpressionofInterestand
Resume) and Shortlists
• Interviews
• JobOffersandAcceptances
Online Registration
Recruiters are required to register online at
www.isb.edu/placement. For any assistance in registering,
the CAS team may be contacted. Recruiters are required to
accept the terms and conditions by mailing a printed signed
copy of ‘Terms and Conditions for campus recruitment’
available on the website to the CAS office.
Companies offering Experiential Learning Projects (ELPs)
and wishing to make Pre-placement Offers (PPOs) should
inform the CAS Office and PGP Projects Office before
January01,2011.IfastudentreceivesaPPOitwillbe
considered as One Offer of the two which s/he is eligible for,
and if accepted, it will be treated as an ‘Accepted Offer’ and
the student will be out of the placement process. All other
companies would follow the Placement Process as detailed
below.
Pre-placement Talks (PPTs)
November 01, 2010 onwards
This is an ideal opportunity for companies to share
information about their organisations with students and to
make it possible for them to explore career options.
• TimeslotsforPPTvarybydayoftheweek:
Monday to Friday - 1930 hrs to 2300 hrs
Saturday and Sunday - 1100 hrs to 1730 hrs
• ISBgivesequalopportunitytoallrecruiters.EachPPT
therefore is allotted 45 minutes:
• 30minutesforpresentation
• And15minutestorespondtostudents’queries
• ToregisteradateandtimeforPPT,pleaselogontoour
placement website www.isb.edu/placement
• TheCASOfficewillarrangeforfacilities(audio-visual
and support services) that may be needed for the
presentation. Companies are requested to let CAS
know about their requirements in advance
Job Posting, Applications and Shortlist
• Jobpostingscanbeuploadedbytherecruiteronthe
ISB placement website
• Studentswillrespondbysubmittingtheirapplications
(Expression of Interest and Resume) according to the
company’s deadlines
• Companiesarerequestedtoforwardshortlisttothe
CAS office at least 7 Days before the interview date.
The CAS office will inform the shortlisted students
Interviews
January14,2010onwards:Interviewswillbeheldbetween
0900 hrs to 1800 hrs. The schedule is as below:
Slot Dates Offer opening date & time
Day01 Jan14-16,2011 Jan16,2011@1800hrs
Day02 Jan29-30,2011 Jan30,2011@1800hrs
Day03 Feb12-13,2011 Feb13,2011@1800hrs
Day04 Feb14,2011 Feb14,2011@1800hrs
Day05 Feb15,2011 Feb15,2011@1800hrs
Day06 Feb16,2011 Feb16,2011@1800hrs
Day07 Feb17,2011 Feb17,2011@1800hrs
Day08 Feb18,2011 Feb18,2011@1800hrs
Day09 Feb19,2011 Feb19,2011@1800hrs
Day10 Feb20,2011 Feb20,2011@1800hrs
Subsequently the interview process will continue till March 31, 2011.
Pre-Interview Process: Companies can visit campus to
complete Pre-interview processes earlier to DAY 01.
Companies cannot make offers on these dates. Pre-
interview process includes:
a) Any Questionnaire, written assessment / psychometric
test or group discussions.
Policy for senior students
ISB has senior students with 8 or more years of work
experience. They need a separate process, as they may
have to go through multiple rounds of detailed interviews,
considering their seniority. The placement process for these
students will start earlier.
Job Offers and Acceptance policy
• TheISBallowsastudenttoreceiveTWOoffersor
accept ONE offer. Thereafter, the student exits the
placement process
• Tofacilitatelogisticsforinternationalcompanies/teams,
who cannot come in during the regular placement
schedulestartingonJanuary14,2011,CASallows
them to complete the process earlier. The dates could
be fixed in consultation with CAS. Such companies will
have to hand over sealed Final Interview Forms (FIF)
& offers to CAS and these offers will be opened only
attheendofthefirstdayofPlacements(January16,
2011)
• CompaniesarerequestedtoprocesstheVisa
requirements and other travel formalities, for students
who may have to attend an interview in any of the
client’s international/ domestic locations
• Allcompaniesarerequestedtohandoverthefilledin
FIF to CAS, on completion of the process and to send
the Formal Offer Letter within seven days, to the CAS
Office
• FinalInterviewForm:Tomakeanoffertoastudent,
companies need to complete the FIF
• Attheendofthefinalinterview,ifcompany
representatives are considering making an offer to
the student, they have to fill in the FIF with details of
offer which is then signed by the student
• Ondecidingtomakeanoffer,theofferconfirmation
portion is completed, by the recruiter and then the
FIF is handed over to the CAS Office in a sealed
envelope
• CASwillbroadcastthestudentstatusonthe
placement website at the end of each placement day.
All companies are advised to check the status of their
shortlisted students on the website
• StudentsarerequiredtoconfirmtheirAcceptance/
Rejection of job offers according to the company’s
deadline. The earliest offer acceptance deadline that a
recruiter can ask for is the end of the next placement
day
Placement process at the ISB• Pre-placementoffers:OnorbeforeJanuary01,2011
• Pre-placementstalks:November01,2010onwards
• Jobposting,applications:November01,2010onwards
• Shortlists:Atleast7daysbeforeinterviews
• Interviews:January14,2011onwards
• Joboffersletters:OnorbeforeMarch31,2011
• Youmayusethestudentprofilehandbookasa
reference to understand the diversity at the ISB. We
urge you not to use the handbook for shortlisting
candidates
• Pleasechannelallcommunicationrelatedto
placements only through the CAS office
• DetailedCASpoliciesareavailableonthe
website: www.isb.edu/placement
Shrinivas Hari, [email protected],+919394568035
Kartik Agarwal, ISB Campus [email protected],+919963288022
Kiran Neti, ISB [email protected],+919701473666
Aakash Nagpal, [email protected],+919899040111
Sachiin Rai, [email protected],+919810412821
Vishal Goyal, [email protected],+919818002792
Anil S Kumar, South & [email protected],+919342564953
Amitesh Gir, [email protected],+919920629505
Bhishm Chugani, West [email protected],+919833070100
Important Dates
Contact Details
![Page 7: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/7.jpg)
12 13
Course Title Faculty and Affiliation
Term1:April26-June6,2010
Financial Accounting in Decision Making Mary Lea McAnally, Texas A&M Shivaram Rajagopal, Foster School of Business MohanVenkatachalam,DukeUniversity
Managerial Economics Amit Bubna, ISB TarunJain,ISB Mudit Kapoor, ISB Bruce W Allen, The Wharton School
Marketing Management Asim Ansari, University of Columbia Rajdeep Grewal, Pennsylvania State University Sundar Bharadwaj, Goizueta Business School ZJohnZhang,TheWhartonSchool
Statistical Methods for Management Decisions Amit Mehra, ISB Ravi Mantena, University of Rochester
Term2:June7-July18,2010
Competitive Strategy Naga Lakshmi Damaraju, ISB Harbir Singh, The Wharton School Raveendra Chittoor, ISB Akbar Zaheer, Carlson School of Management PrashantKale,JesseHJonesGraduateSchoolofManagement
Decision Models and Optimisation Sumit M Kunnumkal, ISB Milind G Sohoni, ISB
Global Economics Sudip Gupta, ISB Amartya Lahiri, University of British Columbia Krishna B Kumar, RAND Corporation
Marketing Decision Making Pradeep Bhardwaj, Sauder School of Business JagmohanSRaju,TheWhartonSchool S Sajeesh, Zicklin School of Business
Term3:July19-August29,2010
Corporate Finance Bhagwan Chowdhry, UCLA Anderson School of Management Suren Mansinghka, University of California, Irvine N R Prabhala, Robert H Smith School of Business Amit Bubna, ISB
Entrepreneurship Atul Nerkar, Kenan Flagler Business School RamakrishnaSVelamuri,CEIBS-China
Leadership Development Programme (One credit compulsory Pass/ Fail Course) E S Srinivas, XLRI Lalitha Maheswaran Rajeshwar Upadhyaya S Ramnarayan, ISB
Managerial Accounting and Decision Making Swaminathan Sridharan, Kellogg School of Management NanduNagarajan,JosephMKatzGraduateSchoolofBusiness Sunil Dutta, Haas School of Business
Operations Management AdityaJain,ISB Ram Bala, ISB
Term 4: August 30 - October 10, 2010
Government, Society & Business Mudit Kapoor, ISB A K Shiva Kumar, UNICEF
Investment Analysis Rajnish Mehra, University of California, Santa Barbara Krishnamurthy Subramanian, ISB Ramabhadran S Thirumalai, ISB Ramana Sonti, ISB
Management of Organisations JonathanPinto,ImperialCollege Niro Sivanathan, London Business School Luis L Martins, McCombs School of Business JamesMSchmidtke,CaliforniaStateUniversity,Fresno
Strategic Analysis of Information Technology Ramnath K. Chellappa, Goizueta Business School Deepa Mani, ISB
PGP core courses: 2010 - 11
![Page 8: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/8.jpg)
14 15
Course Title Faculty and Affiliation Concentration Area(s)
Term 5: October 11 - November 21, 2010
Advanced Corporate Finance Sankar De, ISB FINC
Business to Business Marketing Sudipt Roy, ISB MKTG
BusinessValuationUsingFinancialStatements Ram Ramakrishnan, University of Illinois at Chicago FINC, ENTR
Change Management S Ramnarayan, ISB STLD
Consumer Behaviour Rishtee Batra, ISB MKTG
Corporate Development: Mergers, Acquisitions and Alliances Naga Lakshmi Damaraju, ISB STLD
Corporate Strategy and Organisation Design Kannan Srikanth, ISB STLD
Entrepreneurial Decision Making Arun Pereira, ISB ENTR
Fixed Income Securities Bruce Tuckman, University of Pittsburgh FINC
International Finance Rajesh Chakrabarti, ISB FINC
Introduction to Indian Marketing (One Credit Pass/ Fail course) Sridhar Samu, ISB NA
Leveraging Web 2.0 - Social Media, Online Advertising Ravi Bapna, Carlson School of Management INTMand Web Analytics VaibhavArya,Media.Net(Directi)
Marketing Research SudhirVoleti,ISB MKTG
Negotiation Analysis Amit Nandkeolyar, ISB STLD, ENTR
Options and Futures Ramabhadran S Thirumalai, ISB FINC
Outsourcing and IT Based Businesses Nishtha Langer, ISB INTM
Pricing Manish Gangwar, ISB MKTG, ENTR
SustainableBusinessOperations:ValueCreationand VaidyJayaraman,UniversityofMiami OPMTEnvironmental Considerations
Term6:November22-January2,2011
Advertising Tanuka Ghoshal, ISB MKTG
Brand Management Sridhar Samu, ISB MKTG
Business Intelligence using Data Mining Ravi Bapna, Carlson School of Management INTM Galit Shmueli, Robert H Smith School of Business
Corporate Control, Mergers and Acquisitions Krishnamurthy Subramanian, ISB FINC
Experiential Learning Programme (Credit 1) NA NA
Financial Engineering Sanjiv Ranjan Das, Leavey School of Business FINC Krishna Ramaswamy, The Wharton School
Financial Statement Analysis Gerald Lobo, C. T. Bauer College of Business FINC Shiva Sivaramakrishnan, C. T. Bauer College of Business
International Marketing VenkateshShankar,MaysBusinesSchool MKTG
Investing in Private Equity Amit Bubna, ISB FINC, ENTR, STLD VinayBNair,AdaInvestmentManagement
Logistics and Supply Chain Management Milind G Sohoni, ISB OPMT
Managing Teams Henry Moon, London Business School STLD
Marketing Services Piyush Kumar, Terry College of Business MKTG
Negotiation Analysis AbhijeetVadera,ISB STLD,ENTR
Power and Politics Tanya Menon, Kellogg School of Management STLD
Strategic Performance Management Dhinu Srinivasan, FINC, STLD, OPMT JosephMKatzGraduateSchoolofBusiness
Strategy Implementation Raveendra Chittoor, ISB STLD
ValueInvesting RaviJagannathan,KelloggSchoolofManagement FINC Ramana Sonti, ISB
Term7:January03-February10,2011
Asset Management VinayBNair,AdaInvestmentManagement FINC
Capital Raising Strategies in Corporations Nikunj Kapadia, Isenberg School of Management FINC, ENTR N R Prabhala, Robert H Smith School of Business
Corporate Governance N K Chidambaran, Graduate School of Business, Fordham University FINC N R Prabhala, Robert H Smith School of Business
Customer-Focused Product Planning VSrinivasan,StanfordGraduateSchoolofBusiness MKTG,ENTR
Economics of Strategy Louis A Thomas, The Wharton School STLD
FinancialValuationofTechnologyBusiness Amit Mehra, ISB INTM, FINC Rajiv D Banker, Fox School of Business
Areas of Concentration: FINC: Finance, ENTR: Entrepreneurship, INTM: Information and Technology Management OPMT: Operations Management, MKTG: Marketing, STLD: Strategy and Leadership
Gender, Diversity and Leadership Stacy Blake-Beard, Simmons College STLD Lynda L Moore, Simmons College
Information Economics TarunJain,ISB FINC
Managing Complexity Edward W Rogers, NASA STLD
Managing Strategic Partnerships Saikat Chaudhuri, The Wharton School STLD Mitrabarun Sarkar, Fox School of Business
Marketing Strategy George Day, The Wharton School MKTG, STLD VKumar,J.MackRobinsonCollegeofBusiness
Marketing Strategy and Economic Analyses David Godes, Robert H Smith School of Business MKTG, STLD
PlanninganEntrepreneurialVenture Kavil Ramachandran, ISB ENTR
Pricing and Revenue Optimization Kalyan Talluri, University of Pompeu Fabra OPMT RakeshVVohra,KelloggSchoolofManagement
Property Finance and Investment Richard Green, University of Southern California FINC
Retailing Ram Rao, School of Management, UT Dallas MKTG, OPMT
ServiceBusinessVenturesandFranchising ChandrasekarV,ISB ENTR
Service Operations Management Sumit M Kunnumkal, ISB OPMT
Strategic Challenges for Innovation-based Start ups Anand Nandkumar, ISB STLD, ENTR
Technology Strategy Consulting Nishtha Langer, ISB INTM, STLD Rajiv D Banker, Fox School of Business
Trading Strategies and Systems VasantDhar,SternBusinessSchool INTM
Transaction Analysis and Modeling Ashish Kohli, Richard Ivey School of Business FINC
Transaction Analysis and Modeling (TURBO) Ashish Kohli, Richard Ivey School of Business FINC
Term 8: February 21 - April 3, 2011
Behavioral Finance Sudip Gupta, ISB FINC
Business Law Sumesh Reddy, Dr Reddy’’s Laboratories ENTR, STLD
Consumer Behaviour Geeta Menon, The Wharton School MKTG
Database Marketing P B Seethu Seetharaman, MKTG, INTM JesseH.JonesGraduateSchoolofManagement Anand Bodapati, Anderson School
Experiential Learning Programme (Credit 2) NA NA
Global Operations Management NViswanadham,ISB OPMT
Global Strategic Management Kannan Srikanth, ISB STLD
Indian Financial System Rajesh Chakrabarti, ISB FINC
Marketing Models Anand Bodapati, Anderson School MKTG
Microfinance Shamika Ravi, ISB FINC, ENTR
Mobile Policy and M-Commerce Gireesh Shrimali, ISB INTM, ENTR
Negotiation Analysis Ruchi Sinha, ISB STLD, ENTR
Operations Strategy AdityaJain,ISB OPMT,STLD
Personal Effectiveness for Leadership E S Srinivas, XLRI STLD
Project Management M R Rao, ISB OPMT
Rural Marketing Harish Bijoor, Bijoor Consultants, Inc. MKTG
Security Markets and Trading Ramabhadran S Thirumalai, ISB FINC
Strategic Innovation Management Anand Nandkumar, ISB STLD, ENTR, INTM
Strategy, Leadership and Resource Management in Kavil Ramachandran, ISB ENTR, STLDFamily Business
The Green Business Gireesh Shrimali, ISB INTM, ENTR
Transformational Leadership: Prasad Kaipa, ISB STLDIgniting the Genius Within Self and Others
Course Title Faculty and Affiliation Concentration Area(s)
Term7:January03-February10,2011(Continued)
PGP elective courses 2010 - 11 PGP elective courses 2010 - 11
![Page 9: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/9.jpg)
16 17
8YEARS&ABOVE
![Page 10: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/10.jpg)
18 19
English, Hindi, Telugu, Oriya
B.Sc.,NationalDefenceAcademy,JawaharlalNehruUniversity
10 years 4 months of experience in Defence Services.
Indian Air Force: Squadron Leader (Helicopter Pilot)
• AwardedShauryaChakraforleadershipinTsunami Relief Operations across Andaman and Nicobar Islands
• PlannedandexecutedvarioushelicopteroperationsincludingPresidentialflights, both in international and domestic airspace
• Managedlogistics,budgeting,manpowerutilisationandcareerprogressionof300 personnel in my squadron
• LiaisonwithvariousagenciesofIndiangovernment,andforeigndiplomatswhileon deputation with the United Nations in Sudan
A Vijay Kumar
English, Dutch, French, German
BBS (Accounting and Auditing), Nyenrode Business University, Netherlands
17 years 4 months of experience in Financial Services industry.
Compliciti: Owner
• ImplementedBusinessComplianceStrategyforclients including Dutch and international banks
• TrainedforBusinessCompliance
• Expandedandmaintainedclientnetworks
Netherlands Authority for the Financial Markets: Supervision Officer
• ProjectManagerforimprovementofbusinesssupervision
• Providedadviceoncomplianceissues
Ernst & Young Audit: Senior Staff
• Managedandplannedauditteams
• Performedauditsacrossvariousclients
Bart Korteweg
English, Hindi, Gujarati, Marathi
MS (Computer Science), University of California - San Diego
B.E. (Computer Engineering), Thadomal Shahani Engineering College, University of Mumbai
8 years 8 months of experience in Telecommunications industry.
International Lubricants Pvt. Ltd.: Co-Owner
• Generalmanagementwithregardtochemicalfactoryandpersonnel
Motorola Inc.: Technical Account Manager
• Directedandledtheglobalsoftware,hardware,system,field,testandproduct management teams through the carrier acceptance process
• CustomerrelationshipmanagementandsupportedsalesincreasefromUSD80 million to USD 120 million
Nokia: Software Design Engineer
• Designed,implemented,testedandmaintainedthe2G&3GCDMAProtocolStock
• Instrumentalinthelaunchof20+Nokiaphones
Aaras Pradeep Vasa
English, Hindi, Telugu
MS (Computer Science), University of Minnesota, Twin Cities
B.E. (Electrical Engineering), University College of Engineering, Osmania University
11 years of experience in IT (Services) industry.
Ameriprise Financial Services: Programme Manager
• Directedstrategicandtacticalapproachforcreationandexecutionofadatastorage re-engineering programme (USD 5 million budget)
• AchievedaninfrastructurecostreductionofUSD20millionover3years
V2Tech:FounderandCEO
• Assistingclientswithcreatingtechnologyroadmapsandexecutingthem;Primary clients - public company in pharmacy benefit management, a healthcare startup
Seagate Technology: Senior Systems Engineer
• CreatedroadmaptoconnectR&Dfacilitiesacrossthreecontinentsonasingle platform
Deepa Kodur
English, Hindi
B.E. (Marine Engineering), Marine Engineering Research Institute
9 years 6 months of experience in IT (Services) industry.
Infosys Technologies Ltd.: Project Manager
• Executedlargeprojectsinlogisticsandretaildomain for Fortune 200 clients
• Independentlyhandledaccountswithrevenues>USD4million
• Salesteammembertowinaturnkeyoutsourcingdealfromamultibilliondollarluxury retailer
• Managedlargeteams,developedsecondtierleadershipandprovidedmentoring
• BrandAmbassadorawardfromInfosysforexceptionalperformanceinclient management
Abhishek Bisht
English, Hindi, Telugu, Kannada
B.A. (Marketing), B H S First Grade College, Bangalore University
10 years 11 months of experience in Financial Services and Distribution industry.
Indiabulls Financial Services Ltd.: Regional Manager Collections
• Detectedlargescalefraudandtookappropriatemeasures
ValueaddFinancialServices:Partner
• Sourced2500applicationsamonthforHDFCcreditcardsandINR15millionin personal loans per month for Barclays bank
ICICI Bank Ltd.: Area Manager
• Selectedasco-ordinatorforBangaloreandrepresentedSouthZone
Customer Operational Services Pvt. Ltd.: Assistant Manager Operations
• StoodfirstinacertificationprogrammeforadvancedCallCentreManagement
Meridian Electronics Pvt. Ltd.: Director - Sales and Marketing
• BecameSouthIndia’slargestcompanyforvideogames
BPL Ltd.: Branch Manager - Goa
• BecameBranchManagerwithinoneyearofjoining
Deepak Gopal Rao Vudathala
English, Hindi
B.Tech. (Hons.) (Industrial Engineering), IIT Kharagpur
10 years 6 months of experience in Entertainment industry.
ImagesChain Animations (India) Pvt. Ltd.: Founder
• Foundedananimationstudiowithinvestmentsby HNIs and managed its operations
• Attractedinternationalclientele(Pepsi,ColmanCommunications,VeriteProductions) and generated repeat business
• Creationanddistributionofentertainmentproperties,showcasedpropertiesat various international festivals. Won a nomination at FICCI FRAMES in the short-film category
• Createdadvertisements(Nestle,Reckitt)andTVseries(storytime)forbroadcast
Alphadog Procurement Management, Inc.: Software Consultant
Wipro Technologies: Senior Systems Engineer
Adarsh Kumar Jain
English, Hindi, Punjabi, French
B.E. (Mechanical Engineering), Delhi College of Engineering, University of Delhi
10 years 2 months of experience in Diversified Service industry.
Impeccable Communications Pvt. Ltd.: Director
• Commissioned345telecomtowers,laid225kmof optical fiber cable creating assets worth INR 1 billion
• Completeddevelopmentof37,000sftofmanufacturingfacility
Amadeus SAS: Product Development Analyst
• CompletedanalysisanddefinitionofEuropeanleisuretravelmarket
• Partofthecoreteamcreatedtofindsynergiesandintegrateanothertravel reservation company in Germany
Tech Mahindra: Software Engineering
• DevelopedHumanResourceManagementSystemforTechMahindra
• Ledateamof15softwareengineers
Gaurav Sheoran
English, Hindi, Kannada, Tulu
B.E. (Electronics and Communication), Manipal Institute of Technology, Mangalore University
11 years 7 months of experience in IT (Products) industry.
Oracle India Pvt. Ltd.: Group Manager, Development
• Globalproductdevelopmenthead;OracleeBusiness suite SOA integrations, business intelligence and balanced scorecard
• Extensiveexperienceinideation,strategicdirection,productdevelopmentand management
• Topperformeraward,OracleEBS,2008;amongst2000employees
• TwopatentspendinginERPintegration
Trigyn Technologies Ltd.: Technical Lead
• Strongtechnicalexpertise;developedmiddlewarecomponentsforApollo convergent billing system
Tata Consultancy Services Ltd.: Assistant Systems Engineer
• DesignedanddevelopeddatawarehousingsolutionsforGeneralElectric
Arjun Hegde
English, Hindi, Marathi
CA, ICAI
B.Com., University of Pune
11 years 5 months of experience in Investment Banking industry.
Standard Chartered Bank: Director
• StrategicfinancingtransactionsforRelianceADAG, JSW,DLF,Videocon,GTL,Jaypee,Essaretc.
• Lead-managedIndia’slargestrealestateECBdeal
CreditSuisseSecurities(India)Pvt.Ltd.:VicePresident
• LedfinancingtransactionsforWipro,Suzlon,EmaarMGF,Unitech,ICICIBanketc.
ICICI Bank Ltd.: Assistant General Manager
• AcquisitionfinancingtransactionsforTatagroup,Suzlon,UnitedSpirits, Cholamandalam
• StructuredfinancetransactionsforRelianceIndustries,RPG,CromptonGreavesetc.
KotakMahindraGroup:AssociateVicePresident
• DebtCapitalMarket-Sales
• Treasury,ALM&Hedging
Gaurav Shukla
English, Hindi, Spanish
B.Tech. (Civil), IT-BHU
10 years 7 months of experience in Government Services.
Ministry of Finance, Government of India: Assistant Controller General of Accounts
• GOI-WorldBankprojectsonimprovingpublicfinancial management
• CapitalrestructuringcellforPSUs
• Centralplanschememonitoringsystemtomonitorplanfundtransfers
• DeputedtoGermanyfor8monthsforaprogrammeon‘ManagingGlobal Governance’
Ministry of Urban Development, Government of India: Assistant Controller of Accounts
• DesignandcontroloffundtransfermodalitiesforallCPWDdivisions
• InternalauditinMoUD
InstituteofDevelopmentStudies,Jaipur:ResearchAssistant
• Projectsonpovertyalleviation
Arun Sharma
English, Hindi
MCA, Thapar Institute of Engineering and Technology, Patiala
B.Sc. (Computer Science), Shivaji College, University of Delhi
8 years 9 months of experience in IT (Services) industry.
MphasiS Ltd. (an HP Company): Project Lead (Open systems)
• ManagedakeyUSD108,000migrationprojectforapplicationsupporttakeoverfrom Cognizant
• SupportedCallCenterApplicationsfor18monthsmeeting100%SLAs
• Authoredcost-benefitanalysisforanewproject,increasedteamheadcountand revenue by 17%
Siemens Information Systems Ltd.: Associate Consultant (Telecom)
• Institutedprojectbuildprocess,reducingdeploymenttimebyabout50%
• Managedend-to-enddeliveryforathree-monthlyreleaseforaglobalautomajor; implemented in production with zero defects
Girish Malik
![Page 11: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/11.jpg)
20 21
English, Hindi, Telugu
MS (Technology), BITS Pilani
MS (Finance), Stuart School of Business, Illinois Institute of Technology
8 years 6 months of experience in Consulting industry.
Sol Millennia, Inc.: Founder & President
• FormedanewventuretosegregatetheservicesdeliverybusinessesofUnimind
• Grewrevenuesto~USD2millionbyFY2009
• EstablishedCompanytoprovideBOsupporttoSolMillennia,US
UniMindSoftwareSolutions,Inc.:VicePresident,Partner
• EstablishedConsultingPracticeforsolutionsdeliveryinFinance&SCM
• IncreasedrevenuesfromUSD300,000in2004toUSD6millionin2008
• DevelopedsuiteofITproducts
NaviSite, Inc.: Principal Consultant
• ProvidedSMEinFinanceandSCMSystems
GSS America Infotech: Business Development Associate
• EstablishedGSS-America’sERPPractice
Ibbotson Associates (Now Morningstar): Senior Analyst, Research
Goda Chandrasekhar
English, Hindi
Bachelor of Design in Interior Architecture, Centre for Environmental Planning and Technology, Ahmedabad
8 years 6 months of experience in Hospitality and Interior Design industry.
VatikaHotelsPvt.Ltd.:SeniorManager-ProductStrategy
• Evaluatedandexecuteddesignandserviceproposals, spearheaded collaborations with Starwood Westin’s operations team and aligned theirrecommendationswithVatika’sgoals
• Customisedthesignature‘WestinGuestExperience’fortheIndianmarket
Pradeep Sachdeva Design Associates: Director - Interior Design
• Ledteamtoenterandestablishfirm’spresenceinhoteldesign
• Grewfirmrevenuewithinhoteldesignby300%withseveraltoptier5Starhotelsas clients
Office of Design and Development: Designer
• Accessoryandfurnituredesign
Namrata Mehra
English, Hindi
B.A. (Hons.) (History), Lady Shri Ram College, University of Delhi
10 years 6 months of experience in Textiles and Apparel industry.
Levi Strauss Pvt. Ltd.: Brand Manager - Levis Sykes
• Developedstrategicbranddirectionfor‘Street Sportswear’ line in Levis Sykes - youthwear segment
V.F.ArvindBrandsPvt.Ltd.:Productmanager-HerobyWrangler
• AchievedturnoverofINR150millioninfirst18monthsofoperationwithpenetration of>100counters
Indus Clothing Pvt. Ltd.: Product Manager - Lee Cooper
• Upgradedproductmanagementprocessresultinginincreasedturnoverfrom INR 280 million to INR 550 million in 2 years
Arvind Brands Ltd.: Product Manager - Wrangler
• Executednewproductlaunchfor‘Distress’jeansinrecord45days
Weekender Kids: Assistant Merchandise Manager
• Developedprofitablelineofaccessoriesfromotherproductionfabric-waste
Kavita Singh
English, Hindi
B.E. (Computer Science), IIT Roorkee
11 years of experience in Government Services industry.
Government of India, Indian Police Service: Senior Superintendent of Police, Lucknow, Uttar Pradesh
• RecipientofPresident’sPoliceMedalforGallantry
• Workrationalisation,togetoptimumoutputfromforceof9,600policepersonel reporting to me
• Regularinteractionwithseniorpoliticians,governmentofficialsandseniorcorporates
• Supervisionofcomputerisationofstatepolice
• DevelopedstateoftheartGPS-GISbasedAutomaticVehicleLocationSystem
• HalfwaythroughwebenabledHRMsolutionforstatepolice
Navniet Sekera
English, Hindi, Telugu, Russian
MS(ComputerScience),Fairfax,VA,GeorgeMasonUniversity
B.Tech. (Computer Science and Systems), Gandhi Institute of Technology and Management, Andhra University
14 years 8 months of experience in IT (Services) industry.
VerizonCommunicationsInc.:SeniorProjectManager
• PlannedandexecutedoffshoringofmajorityofSQCfunctionstoIndia
• ImprovedcostofSQCoperationsby30%
• Establishedperformancebenchmarks
VerizonCommunicationsInc.:TechnicalManager
• TransformedexistingreportingsystemtoCXOdash-board
• ArchitectedandLeadconvergenceofBellAtlanticandGTEBillingSystemsasper FCC mandate
Krishna Venkata Naga Rao Durbha
English, Hindi, Swahili, Gujarati
B.E. (Electronics and Communications), Sardar Patel University
8 years of experience in Telecommunications industry.
Indigo Telecom Ltd.: Chief Operating Officer
• Initiatedexpansionofglobalfootprint;helpedsetup Australian subsidiary
• Expandedproductofferingbymorethan300%bysigningupmore3MajorSatellite Network Operators
• HelpedtransformIndigofrombeingastart-uptoamultimilliondollarenterprisewithin 6 years
• Ledplanningandstrategyinitiativesin,policymaking,learning&developmentand operations
New Edge Communications Ltd.: Business Development and Technical Manager
• DesignedandimplementedfirstEmergencyResponseRadioNetworkforNairobi International Airport
Niteshkumar Lalji Dudhia
English, Hindi, Bengali
B.Tech. (Hons.) Mining Engineering, IIT Kharagpur
8 years of experience in Government and Family owned industry.
Government of India - Ministry of Labour: Assistant PF Commissioner
• In-chargeofAdministrationforA.P.Region,comprising 11 offices and 2500 employees
• Achievedrecoverytargetof80%againstaprevious5yearsbestof25%
• Ensuredlegalcompliancebyapproximately1000companiesintheMumbaiRegion
• ReconciledcashaccountsvaluedatUSD6billion,pendingsince1993
Family Business: Manager
• ManagedrefractorybusinessvaluedatINR15million
• ManagedcivilengineeringprojectsvaluedatINR100million
Tata Consultancy Services: Computer Consultant
Manish Kumar
English, Hindi
GNIIT (Advanced Computer Systems), NIIT Delhi
B.Sc. (Biology), Isabella Thoburn College, Lucknow University
8 years 10 months of experience in IT (Services) industry.
MphasiS (an HP Company): Project Manager
• DevelopedtheSchedulercomponentofanAmericanbankinggiant’saward winning post-trade platform that consolidated cash and derivative products into a single portal
Quinnox Consulting Services: Consultant
• Initiatedthecentreforbusinessintelligencesolutions,trainedandmentored resources
• Projectleadandbusinessanalystformanufacturingautomationprojectforan American apparel company
NIIT Technologies: Software Engineer
• GainedexpertiseondifferentReportingandBItoolsworkingwiththelargest automobilecompanyinJapan
Parul Srivastava
English, Hindi
B.Com. (Hons.), Shaheed Bhagat Singh College, University of Delhi
8 years of experience in Manufacturing industry.
Tinna Overseas Ltd.: General Manager (Marketing)
• Territorialresponsibility(25members)-BPNorth, Central-Eastern region - 70% market-base
• Managingandco-ordinatingdemand-supplybetweenrefineryunits,buyersand suppliers
• ConsistentlyachievedtargetsaleINR4-5millionperday,salesgrowthmorethan 50% last 2 years
• Explorednewareasofsales,convincedcompanytoselldirectlytocontractors
Tinna Oils & Chemicals Ltd.: Business Manager - Bio-diesel
• LandacquisitionplantationJatropha-plant
• Tie-upwithuniversitiesjointplantations
Jaitex:Promoter&Proprietor
• Set-uparetaildistributionnetworkinNorthDelhi
Mohit Mittal
English, Hindi
CA, ICAI
B.Com. (Hons.), Hindu College, University of Delhi
8 years 3 months of experience in ITES & Manufacturing industry.
Headstrong Services India Pvt. Ltd.: Manager - Global Revenue
• Processimprovementsaving5man-days
• Handledaccountsreceivablemanagementforthelargestcustomer;improvedDSO metric by 25 days
Timex Watches Ltd.: Treasury Manager
• Treasurysupport,cashflowbudgeting,forecasting
• Transitionedglobalaccountsreceivablecontrollershipandledaccountspayable team
GE Capital International Services: Assistant Manager
• Treasurysupportfor9EuropeanplatformsofGEFleetservices
• LedMatchFundingPolicyComplianceenablingbusinesstohedgeinterestrisk exposure on USD 340 million of net investment
Preeti Pateria
English, Hindi, Marathi, French
Post Graduate Diploma in Management, IMDR, Pune
M.A. (Economics), University of Pune
B.A. (Hons.) (Economics), Ferguson College, University of Pune
8 years of experience in Financial Services industry.
INGVysyaLifeInsurance:DeputyGeneralManager-ProcessManagement
• Headofprojectsandprocessmanagementvertical
• Responsibleforthecontinuousprocessimprovements,whichledtosavingsof INR 20 million
• Designedonlinecustomerportal,whichhashadmorethan2lakhhits
ICICI Prudential Life Insurance Ltd.: Senior Manager - Business Excellence
• ProvidebusinesssolutionsusingSixSigma,automation
• ServiceDeliverySetupforHNIindividuals
• Streamlinedpremiumcollection,costsavingof20%
P&O Nedlloyd: Change Manager - South Asia
• WorkedasachangecatalystdrivingprocessandsystemchangesacrossSouthAsia
Metric Consultancy: Research Trainee
Mukta Karandikar
English, Hindi
PGDBA, Symbiosis Center for Distance Learning
MCA, Indira Gandhi National Open University
BCA, Dynamic College of Professional Studies, Makhanlal ChaturvediNationalUniversityofJournalism
9 years 7 months of experience in IT (Services) industry.
Confidign Solutions Pvt. Ltd.: Co-founder and Manager - Technology Deliveries
• Built,led,managedandmentoredmulti-disciplinaryteamsforinternationaldeliveries for auto majors in work flow process and R&D areas
• Foundedateamtofocusoninnovationintechno-creativesolutions
• ConsultedclientsinoptimisingITspendandportfoliomanagement
• GrewthecompanytorevenuesofEuro1.2million
• Formulatedorganisationalanddeliveryprocessesforoperationalefficiency
DuskValleyTechnologiesPvt.Ltd.:JuniorAssociate-XperienceDesign
• Prototypetheideasofcreativeconsultinggroupusingtechnology
Puneet Gupta
![Page 12: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/12.jpg)
22 23
English, Hindi
Master in Military Sciences, Defence Services Staff College, University of Madras
B.Sc.,NationalDefenceAcademy,JawaharlalNehruUniversity
23 years 3 months of experience in Defence Services.
Indian army: Instructor Directing Staff
• InstructorforJuniorCommanders
• Operationalstrategyplanningandriskassessmentformilitarywarfare
• AssetManagementandco-ordination
• InstructorforoneofthemostprestigiouscoursesofIndianArmy
Indian Army: Commanding Officer
• CommandedanAirDefenceRegimenthaving1000troops
• AwardedGOC-in-Ccommendationcardforexcellenceincommand
Rajiv Bhargava
English, Hindi, Tamil, French
B.E. (Computers), Pune Institute of Computer Technology, University of Pune
11 years of experience in IT (Products and Services) industry.
Miter Consulting: Partner
• FoundedITriskandfraudreductionventure
• FacilitatedUSD6millionrevenueforclientover18months
EMC Corporation Inc.: Business Manager - Banking & Financial Services - India & SAARC
• HeadedFraudProtectionbusiness
• Revenueover-achievementby245%for2007
• BusinessIndia‘YoungSpokespersons2007’
• Contributedhalfof300%revenueincreasefrom2002to2005
• Built30-resellerpan-Indiadistributionnetworkin2002
Ernst & Young Pvt. Ltd.: Associate Consultant
• ContributedtodoublefigurerevenuesasITESriskspecialist
HCL Comnet (HCL Technologies) Ltd.: Account Manager
• USD5millionrevenuefromBFSIvertical
Srikiran Srinivasa Raghavan
English, Hindi
B.Tech. (Mineral Engineering), Indian School of Mines, Dhanbad
8 years 1 month of experience in Energy/Extractive Minerals industry.
Mecontech FZE: Director
• DevelopedexpertiseinphysicaltradinginLMEmetals
• InitiatedbasemetalbusinessworthUSD8million
Kalyani Carpenter Special Steels Ltd.: Assistant Manager
• ResponsibleforcapitalpurchasesworthUSD15million
• Purchaseplanningofrawmaterialssuchasironoreandcoal
Bramco W.L.L.: Materials Manager
• Responsibleforoverallprocurementforamid-sizedsteelandmetalproducer
• Purchasedrawmaterialinlowmarketsthusbeatingtargetsby50%
SteelAuthorityofIndiaLtd.:JuniorManager(Technical)
• Optimisedironoreprocessingtoenhancequality
Rajnish Kumar
English, Hindi, Bengali
B.E. (Hons.) Computer Science, NIT Durgapur
11 years 6 months of experience in IT (Products) industry.
Hewlett Packard, India Software Operations Pvt. Ltd.: Engineering Manager
• Managedengineeringfor14productfamilieswith revenues of USD 23.5 million
• Ledglobalcross-functionalteamsinIndiaandUSAdrivingandimplementing product roadmap decisions
• Builtteams,ensuredbenchmarklevelsofemployeesatisfaction
• Managedcomplexnetworkingandstorageprojects,achievedProjectManagement Professional Certification
• Enabled3criticalOraclereleasesonHPplatformsworkingwithteamsfromHP& Oracle
Wipro Infotech: Software Engineer
• SupportingTelecomclientsforNortelNetworks
Subhadip Majumder
English, Hindi
B.Sc.,NationalDefenceAcademy,JawaharlalNehruUniversity
14 years 3 months of experience in Defence Services.
Indian Navy: Commander, Executive (Pilot)
• OnlyofficertobeselectedfordeputationstotheIndian Army, Air Force, Coast Guard, Customs and Police
• TheyoungestIndianNavalOfficerselectedfortwoCommandtenuresonboardtwo different warships
• ThefirstofficerselectedfromtheNavytoserveasanAides-de-CamptoanArmy Commander-in-Chief
• Awardedmedalsfordistinguishedserviceinremoteareasandforcurbingterrorism
Rishi Raj Singh
English, Hindi, Tamil, Marathi
B.E.(Instrumentation),VivekanandEducationSociety’sInstitute of Technology, University of Mumbai
8 years 1 month of experience in IT (Products and Services) industry.
Computer Associates India Pvt. Ltd.: Team Lead
• Firstamongfivenewteams,toinitiatecriticalsoftware components ownership transfer
• Ledteamtoconcurrentlydeliveronenhancements,integrationsandcustomerissue fixes
Conexant (India) Pvt. Ltd.: Lead Software Engineer
• PromotedasLeadwithinayearfordeliveringoncriticalprojects
Wipro Technologies: Systems Engineer
• BusinessUnitlevelpaperpresentations
• Awarded‘FeatherInMyCap’(twice)and‘BestDeliveryTeam’
TataConsultingEngineers:JuniorEngineer
• SPoCforInstrumentationDepartmentforFluegasDesulphurizationproject
Sujata Ramachandran
English
BS (Hons.) (Finance & Accounting), Depaul University, Chicago
9 years of experience in Financial Services and Hospitality industry.
PricewaterhouseCoopers: Senior Associate
• Auditofalternativeinvestmentmanagementand broker-dealer clients
• WorkedforaglobalhedgefundclientwithUSD12billionAUM
• ClientsincludedtoptenChicagobasedhedgefund,topthreebroker-dealer,and PE funds
• TeamLeadforimplementationofclient’sfirstcostallocationprocessinanticipationof registration as investment advisor
• AssistedPEclientwithsettingupofaSPVcontainingdebtinterestsofamajorbank
Arlington House International Hostel: Front Desk Manager
Hard Rock Cafe: Supervisor & Corporate Trainer
Saba Bhamidipati
English, Hindi
B.E. (Electronics & Communications), Delhi College of Engineering, University of Delhi
10 years 9 months of experience in IT (Products and Services) industry.
Motorola (India) Pvt. Ltd.: Senior Technical Lead
• Conceptualisedfeatures,definedengineering requirements and co-ordinated end-to-end deliveries for multiple projects on CDMA BaseStationControllerproductforoperatorssuchasVerizon,KDDIandChina Unicom
• Co-ordinatedresolutionsforissuesreportedfromfieldandpre-launchtestactivities
• Publishedtechnicalpapers
Wipro Technologies: Technical Lead
• Ledandsetupteams(bothonsiteandoffshore)formultipleprojectsfortelecom clients across Europe, China and US
Sumit Khurana
English, Tamil, French
B.E. (Hons.) (Computer Science), BITS Pilani
8 years 8 months of experience in IT (Products) industry.
Cisco Systems Inc.: Systems Engineer, Sales
• Pre-salestechnicalrolesupportingAT&T,Cisco’s largest service provider account
• TechnicalsalesresponsibilityforAT&T’scoreandenterprisenetworksworth USD 250 million and USD 80 million respectively in annual revenues to Cisco
• LedsalesanddesigneffortsforcriticalnetworksolutionsthatreducedAT&T’soutage times by 99%
• WonSalesAchieverinFY08andAT&TCoreRegion’sSystemsEngineeringAwards in FY08 and FY10
Sangeetha Narasimhan
English, Hindi, Bengali
B.E. (Electrical Engineering), Bengal Engineering College
9 years 8 months of experience in IT (Services) industry.
Wipro Technologies: Project Manager
• Extensiveexperienceinprojectmanagement,IT consulting and customer relations, handling a USD 10
million account
• Ledcrossculturalteams,deliveredbusinesssolutionsforclientsinSecurities, Telecom and Media
• Incorporatedprocessimprovementinitiatives,whichcutdevelopmentcostby7%
• WorkedinmultiplelocationsinIndiaandUSA
Infosys Technologies Ltd.: Software Engineer
• DesignedanddevelopedNumberPortabilityproductsfortelecomserviceproviders
• Achieved90%performanceimprovementonOraclereports
Supriyo Mukhopadhyay
English, Hindi, Tamil, Kannada
B.E.(MechanicalEngineering),RVCollegeofEngineering,Bangalore University
10 years of experience in IT (Services) industry.
Infosys Technologies Ltd.: Senior Project Manager
• Ledateamof100peopleforrevenueofUSD5million
• Extensiveexperienceinprogrammemanagementand client relationship with Fortune 50 financial services and retail clients
• Ranthefirst100%offshoreproductionsupportprojectinInfosys
• InfosysSixSigmablack-beltcertified;executedanoptimisationprojectthatisstill amongst the top 3 in Infosys
• WorkedacrossBangalore,Chennai,London,Phoenix,MinneapolisandNewYork
Srikanth Chandrasekhar
English, Hindi, Kannada
B.E.(Instrumentation&Electronics),R.V.CollegeofEngineering, Bangalore University
8 years 2 months of experience in IT (Products) industry.
IBM India Pvt. Ltd.: Technical Consultant/ Advisory Software Engineer
• Mappedclient’sbusinessrequirementstoproductscapabilitiesenablingsmooth product adoption
• Ledproofofconceptworkshopsforleadingclientcorporationsworldwide
• DesignedandcommercialisedIBM’snewgenerationapplicationlifecycle management product
• EvangelisedIBMsproductsatglobaltechnicalforumsandcustomerconferences
• Received‘RisingStarofTechnology’awardat12thAnnualGlobalWomenofColor Awards Conference in Atlanta
National Instruments Systems India Pvt. Ltd.: Software Developer
• Designed,developedandtestedproprietaryproducts
IvegaCorporation:SoftwareDeveloper/JuniorAssociate
Swathi Brahma
![Page 13: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/13.jpg)
24 25
English, Hindi
B.Tech. (Mechanical Engineering), IIT Bombay
8 years 1 month of experience in IT (Services) industry.
Infosys Technologies Ltd.: Project Manager
• CreatednewlineofbusinessforInfosysresultingin increased account revenue of 20%
• DevelopedcomprehensiveMIStodeliverhigh value-added services to HNIs, resulting in improved client retention and acquisition rates by 70%
• Managedlargesized,crossculturalteamsacrossgeographiesleadingtohigh performance, and increased productivity
• LedchangemanagementprojecttosolidifysupportservicesformultipleBUsfora largest investment bank
MphasiS (India) Pvt. Ltd.: Systems Engineer
Vipin Gupta
English, Telugu
M.E. (Computer Science), Cornell University
B.E. (Computers), Chaitanya Bharathi Institute of Technology, Osmania University
13 years 6 months of experience in IT (Products) industry.
Oracle USA Inc.: Principal Technical Staff
• WorkedonVirtualOperatingsystemsandExadata;onepatentfiledandapproved
• PartofArchitectureGroupforOnDemand
• BusinessdevelopmentresponsibilityforOracleServeronplatforms
• HostingCollaborationssuiteforOracle
• MemberoftheOracleStandardsCommittee
Vivekananda Chowdhary Kolla
English, Hindi
M.Sc. (Technology), Weapon Systems, School of Artillery, University of Pune
B.Sc., National Defence Academy, Khadakwasla, JawaharlalNehruUniversity
11 years of experience in Defence Services.
Indian Army: Major
• ExtensiveexperienceinOperations(Logistics),Strategy&PlanningandGeneral Management
• ManagedLogisticsResourcesfor3,000personnel
• PreparedPolicyStatements&QualitativerequirementsforArmyHeadquarters
• MemberofArtillery’s‘FutureAcquisitions’thinktank
• CarriedoutresearchinarmamentsandtrialsofSwedishandIsraeligunsystems costing INR 160 - 180 million apiece
• AwardedChief-Of-ArmyStaffandArmyCommander’sCommendationCardsfor Professional Excellence and Leadership
Vivek Singh
![Page 14: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/14.jpg)
26 27
6 TO 8 YEARS
![Page 15: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/15.jpg)
28 29
English, Hindi, Marathi
MS(ComputerScience&Engineering),JohnsHopkinsUniversity, Baltimore, USA
BS (Computer Science & Engineering), Thadomal Shahani Engineering College, University of Mumbai
6 years 2 months of experience in IT (Products) industry.
Amazon.com, Inc. (Seattle, USA): Product and Program Manager
• Launchedbrand-newWebStoreproductwithaggressivetimelines
• LaunchednewWebStorecustomersegments(30%increase),andincreasedflagship account sales (14%)
• ReducedWebStoresupportcosts(7%),attrition(15%)
• QuadrupledscopeofAmazon’scross-functionalavailabilityprogramme (USD 19 million savings)
• Pioneeredcompany-wideadoptionofnewsales-dropmetrics(USD1.5million savings)
• Designedandmaintainedcomplex,business-criticalsystems
eOriginal Inc.: Integration Engineer
• Customerandvendorcustomisationsandfunctionaltesting
Abhishek Chitlangia
English, Hindi
BS(MechanicalEngineering),VirginiaTech,Blacksburg,USA
6 years 9 months of experience in Import & Export industry.
Surface Investments Pvt. Ltd. (A Div. of Midex Global Pvt. Ltd.): Controller of Finance
• Reviveda600metrictonoilseedextractionunit,basedinZimbabwe
MidexGlobalPvt.Ltd.:VicePresident,Project
• Designedanddevelopedmotorcontrolstationswithnextgenerationtechnology
RPI Distributors Inc.: Director, Corporate Services
• Procuredover400consumerproductsfromChina
Orient Centres: Director
• Exportedlow-costhigh-volumegoodslikehandtools,jutebags,brassartware, stainless steelware
Samsung (India) Electronics Ltd.: Engineer, R&D
• Workedonrefrigeratordesignanddevelopment
Abhishek Kapilaansha Mohunta
English, Hindi, Marathi, Gujarati
CA, ICAI
B.Com., Brihan Maharashtra College of Commerce, University of Pune
6 years 1 month of experience in Accounting industry.
Capgemini (India) Pvt. Ltd.: Senior Consultant
• Reviewedmonthlyclosureandmonthlyreporting
• Liaisedwithauditors;wassinglepointofcontactforallaudits
PricewaterhouseCoopers: Assistant Manager
• Preparedauditplanandensureditseffectiveimplementation
• Identifiedandresolvedcriticalaccountingissues
• Conductednegotiationsfornewassignments/newclients
• Conductedinternaltrainingonauditandaccountingtopics
• Value-addedtoclientsintheformofimprovementstoprocessesandfunctions
Aditya Patil
English, Hindi
B.A.(Hons.)(Economics),SriVenkateswaraCollege,University of Delhi
6 years 8 months of experience in Investment Management industry.
Benchmark Asset Management Company Pvt. Ltd.: AssistantVicePresident,NorthIndia
• LedcompletebusinessoperationsacrossNorthIndia
• Launched6products,3becamecompany’stopperformersacrossIndia
• EquityLinkedDebenturesandExchangeTradedFundsbecamemarketleaders
ING Investment Management - Optimix Division: Area Manager
• DevelopedthesalesanddistributionchannelforsalesofassetsworthINR1billion
• ClosedthesinglelargestdealfortheNorthernterritory
Standard Chartered Bank: Credit Analyst
• CreditappraisalandassessmentforSMEclients
IDBI BANK: Assistant Manager
• TradeandForexoperationsforcorporateclients
Aditya Sharma
English, Bengali
B.E.(Hons.)ElectronicsandCommunications,NITJaipur
6 years 10 months of experience in Electronics industry.
LSI Research India Pvt. Ltd.: Senior Design Engineer
• LedUSD130millionproductdevelopmentforZTE,a Chinese telecom company
• ManagedUSD150millionchipdesignprojectforstorageandnetworksystems
• Broughtabout30%improvementinturnaroundtimeforaUSD65milliondesign project
ST Microelectronics Pvt. Ltd.: Design Engineer II
• CompletedchipdesignforsettopboxesusedfortelevisionsinFranceandtheUSA
• SuccessfulimplementationofcablecardchipforScientificAtlanta
Centre for Development of Telematics (C-DOT), Delhi: Research Engineer
• Designandverificationfortelecommunicationsystems
Adwitia Chakraborty
English, Hindi, Marwari, Telugu
MS (Electrical and Computer), University of Arizona, Tucson, USA
B.E. (Electrical and Electronics), Chaitanya Bharathi Institute of Technology, Osmania University
6 years of experience in Electronics industry.
NXP Semiconductors: Technical Lead
• Understandingfeasibilityofnewproductideas,theircompetitiveadvantage, feasibility and time-to-market
• Qualitycontrolofalltheperipheralsofallthesettopboxesinthecompany
• Ledateamof4forthequalitycontrolofacomplexmemorycontroller
• InternalconsultantformergingofNXP&Conexant
Intel Corporation: Senior Design Engineer
• Workedonassemblyofa4coreprocessor,featuresspreadacross7teamsat 8 locations
Synopsys (India) Pvt. Ltd.: R&D Engineer
Ajay Jain
English, Hindi, Marathi, Konkani
MS, Loughborough University, UK
B.Com. (Hons.), D G Ruparel College, University of Mumbai
7 years of experience in Financial Services industry.
CommanderAssetManagement(MiddleEast):VicePresident - Business Development & Deputy Money Laundering Reporting Officer
• HeadofinstitutionalsalesandmarketingforCommander’sflagshipIndiafund
• Establishedthedistributionnetworkforthecompany
• ResponsibleforclientrecordmaintenanceandassistedtheComplianceOfficer
KotakMahindra(UK)Ltd.:AVPClientRelations
• BuiltupAUMofnearlyINR600millionacross15-20HNWfamilies
• HelpedtostructureandmarketaShariah-compliantIndiafocusedequityfund
• DevelopedimportantclientrelationshipsinBahrainandSaudiArabiaforKotak’s
offshore funds
Kotak Securities Ltd.: Manager - Client Relations
Akshay Ashok Bhandarkar
English, Hindi
CA, ICAI
B.Com. (Hons.), Shaheed Bhagat Singh College, University of Delhi
7 years 1 month of experience in Trading / Import / Export industry.
Advanced Telemedia Pvt. Ltd.: CEO
• Suppliedimportedaudiovideoproductstoclients(CommonwealthGames,Adlabs, Infosys)
• Marketedanddistributed15productsofglobalOEMsthroughdistributors,system integrators and agents
• KeyAccountmanagement,ClientServicing,Networking&RelationshipBuilding
• GrewthecompanytoINR150millionturnover
CitiFinancial Consumer Finance India Ltd.: Assistant Manager - Credit & Risk
• Responsibleforcreditapprovals,monitoringdelinquenciesandrisk
• Monitoreddelinquencies,approvalratesandturnaroundtimes
• NominatedforYoungManagersLeadershipSeminar
Aman Gupta
English, Hindi, Marathi
MS (Electrical Power Engineering), Rensselaer Polytechnic Institute, Troy, NY
B.E.(ElectricalEngineering),VJTI,UniversityofMumbai
6 years 6 months of experience in Energy industry.
ABB Ltd. (USA): Consulting Engineer
• ConductedFeasibilityandImpactAnalysisofover 5000 MW generation (conventional and renewable)
• LedaninitiativebetweenABB-USAandABB-Indiaconsultinggroups
• ManagedtransmissionplanningprojectsworthmorethanUSD2million
• InvolvedindesigningofthelargestHVDClinkatJinping-EastChina(800KV, 6400 MW)
• Recipientof‘ABBQualitySaluteAward’fortwoconsecutiveyears
• Projectsinvariouscountries:USA,Canada,SaudiArabiaandSyria
Amit Vishnu Kekare
English, Hindi
BS(ElectricalEngineering),NITJamshedpur
6 years 8 months of experience in Energy & Extractive Minerals industry.
Areva T&D (India) Ltd.: Assistant Manager-Projects
• ExceededsalesandcollectiontargetbyINR100&80 millionrespectively;increasinggrossmargin(1.5%)for
HVPNLproject
• WorkedonSaintGobainMexicoproject,MumbaiRailandEssarSteelprojects
Hindustan Zinc Ltd., Udaipur: Engineer
• TeamLead(16workmen)toensurebreakdownfreeoperationof4000tonneper day mill
• Reducedpowerconsumption,savingINR10millionannually
• Workedon154MWcoalbasedthermalpowerplant
• InvolvedinSixSigmaprojects
Amit Kumar
English, Hindi, Punjabi
B.E. (Manufacturing Processes & Automation Engineering), Netaji Subhas Institute of Technology, University of Delhi
6 years 9 months of experience in Automotive industry.
Maruti Suzuki India Ltd.: Deputy Manager - Marketing (North Zone)
• Managingperformanceof13productsin4ROsand5areaofficescovering147 dealers through 41 Brand-Champions
• SavedINR20millionthroughprice-negotiations(Media-buying)
• ConceptualisationandimplementationofBrand-Campaigns
• AsDeputyManager,TerritorySales(NCR),handled10dealers(turnoverINR700 million) and increased market share from 57% to 64% in six months
• AsAssistantManager,SalesPlanning,handledpan-Indiademandforecastingand distribution of vehicles
Amit Raju
English, Hindi
MBA (International Marketing), University School of Management Studies, GGS Indraprastha University
B.Com., Kirori Mal College, University of Delhi
6 years 10 months of experience in Consulting industry.
Accenture Services Pvt. Ltd.: Senior Consultant
• ProvidedconsultinginthefieldofM&A,postmergerintegrationandorganisational effectiveness
• Workedwithseniorleadershiponpre-salessupport
• Programmeandprojectmanagementincludingsupervisionofsixmemberteam across onshore and offshore locations
• LednationalandinternationalCSRprojects
• Wastheyoungestseniorconsultantinthefirm
Evalueserve.com Pvt. Ltd.: Senior Business Analyst
• Financialresearchonequitystructureofseveralcompanies
Anish Jain
![Page 16: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/16.jpg)
30 31
English, Hindi, Bengali
Diploma in Hotel Mangement, Institute of Hotel Management and Catering Technology, National Council of Hotel Management and Catering Technology
7 years 9 months of experience in ITES/BPO industry.
GE Money Servicing: Assistant Manager
• Managed30judgementalunderwriterslendingto Consumer and Commercial Credit customers for Retail Consumer Finance business of GE Money Americas
• Doubledcreditapprovalratesduringrecession,keepingdelinquencyratesstable
• Developedmeasurementsystemsforunderwritingefficiency,whichwastakenback to stakeholders in USA
• TransitionedHighTicketdealstoIndia,increasingLendingauthorityofIndialenders from USD 10,000 to USD 35,000
Arindam Mohanta
English, Hindi, Bengali
PGDM (Marketing), Symbiosis Center for Management and HRD
B.A. (Hons.) (English), Lady Shri Ram College for Women, University of Delhi
6 years 10 months of experience in ITES/BPO industry.
TCS eServe Ltd. (previously Citigroup Global Services Ltd.): Senior Manager
• Ledthreeriskanalyticsteamswithmultipleclientmanagementresponsibilitiesacross various Citigroup entities and people management responsibility of 11
• Managedmultiplecross-functionalcreditanalyticsprojects(5to55+millionbusiness revenues annually) across a range of consumer finance products and domains
• SixSigmaGreenBeltCertified
• Receivedawardsforprocessexcellence
Genpact (India): Business Analyst
• Deliveredmultiplecustomeracquisitionandretentionstrategiesforprivatelabelcredit cards
Arpita Ghosal
English, Hindi, Punjabi
B.E. (Hons.) (Electronics and Electrical Communication), Punjab Engineering College, Punjab University
7 years 6 months of experience in Diversified Services.
Taj Hotels (Under TAS Leadership Program): Development Manager
• Asbusinessdevelopmentmanager,oversawThailand(residentrepresentativefor two years), China and Tamil Nadu regions
• Deliverablesincludedmarketentrystrategy,productpositioning,optimalbusiness structure, financial feasibility and project management for INR 1.5 billion Coimbatore, Chennai projects and USD 90 million mixed use luxury resort in Phuket
Tata Services Ltd.: Manager (Tata Administrative Services - TAS)
• StintsatthreeTataGroupcompaniesinStrategy,MarketingandBusiness Development
Tata Consultancy Services Ltd.: Systems Engineer
• Handleddevelopmentandclientinteractionsforforexandinterbanklending platforms
Aseem Kohli
English
B.Sc. (Hons.) (Management Sciences), London School of Economics and Political Science
6 years 8 months of experience in Energy and Investment Banking industry.
Avatar Oilfield Services: Co-Promoter
• Startedandseededanewoilfieldservicesbusiness serving Indian oil and gas exploration companies
• Establishedtechnicalpartnershipswithleadingglobalgeophysicalcompanies
Barclays Capital: Associate, Commodities
• Oneyeartradingtheglobalcrudeoilswapsandfuturesbook(oneofthreetraders on NYMEX and ICE)
• Twoyearsstructuring,marketingandsellingcommodity-linkedstructuredderivatives
British Army: Second Lieutenant (Troop Commander)
• Led60soldiers,servedasapeacekeeperwithNATOinBosnia
Atma Shivalanka
English, Hindi
CA, ICAI
B.Com. (Hons.), Shaheed Bhagat Singh College, University of Delhi
6 years 9 months of experience in Financial Services industry.
Ernst & Young Pvt. Ltd.: Senior Associate
• PerformedfinancialduediligenceforPrivateEquityFundsandstrategicinvestors
• Workedacrosssectors-realestate,power,education,oil&gas,iron&steeland hospitality
• Workedonfinancialmodels
• TeamLead(4members)forcertainstrategicassignments
BSR & Co (member firm of KPMG): Senior
• Performedstatutory,groupandtaxauditsforlistedandunlistedcompaniesacross sectors
• Ledauditteamsindependently
• Partoftheinternaltrainingtaskforce
Bharat Mehra
English, Hindi, Chinese
B.Tech. (Electronics Engineering), Military College of ElectronicsandMechanicalEngineers,JawaharlalNehruUniversity
6 years 5 months of experience in Defence Services.
Indian Army, Corps of Electronics and Mechanical Engineers (EME): Major - Second in Command
• HeadedastrategicIndianArmyUnit,providing360°engineeringsupporttohigh technology equipment worth INR 5 billion
• AchievedOperationalTargetswhileleading150resourcesinsuboptimaland insurgency environment in Kashmir
• Streamlinedandoptimisedoperationallogisticsfor2000troopsthroughcreative problem solving while simultaneously managing 40 key client units
• Ledacoreteamresponsiblefortechnologyinduction/transition
• Awarded4servicemedalsforleadershipexcellence
Chaitanya Pandey
English, Hindi
Ph.D. (Development Communication), GB Pant University of Agriculture and Technology, Pantnagar
M.Sc.(Agriculture-ExtensionEdu.),JawaharlalNehruKrishiVishwavidyalaya,Jabalpur
B.Sc. (Agriculture), GB Pant University of Agriculture and Technology, Pantnagar
6 years 8 months of experience in Banking industry.
Reserve Bank of India: Assistant General Manager
• DirectorintheBoardoftwoRegionalRuralBanks
• HeadingRRBSection,performedallregulatoryfunctionsfor12RRBs
• LeadDistrictOfficerandmemberofDistrictCoordinationCommitteeoffivedistricts, having total planned credit outlay of INR 16.9 billion
• Extensiveexperienceininspectionofpublic,privateandforeignbanks
• Ledvariousteams(size20-25)inCurrencyManagementfunction
Oriental Bank of Commerce: Agriculture Officer
• Appraisedcreditproposals
• Managedbankbranchoperations
Chandra Prakash Joshi
English, Hindi, Punjabi
B.Sc. (Hons.) (Zoology), SGTB Khalsa College, University of Delhi
6 years 1 month of experience in Education industry.
Sapient Corporation: Senior Associate, Learning & Development
• Ledsoftskillslearningmodulesforretailandmedia consultants
• CustomerInterfaceforallprojects
InfoPro India Pvt. Ltd.: Team Leader - Instructional Design
• CapturedclientrequirementsanddefinedscopeforOracleUniversity
• Createdinstructionallysoundtrainingmaterialtomeetlearningobjectivesoftheclient
• CertificationfromInfoProIDcenterofexcellence
Innodata India (P) Ltd.: Associate
• Createdabstracts,keyphrasesforonlinecontent
• Reviewedclientdeliverablesforqualityandcommunicatedwiththeclientfor deliverable acceptance
Daljeet Kaur
English, Tamil
MS (Computer Science), University of Illinois, Chicago
B.E.(ComputerScience),SriVenkateswaraCollegeofEngineering, University of Madras
6 years of experience in Operations and IT Consulting industry.
Manhattan Associates: Principal
• ProjectManagementandClientEngagementatseniormanagementlevels
• ConsultingservicestoseveralindustryleadingU.S.firmsacrossdifferentverticals
• SupplyChainsolutionsimplementationledtocostsavingsofUSD23.4million, 8% increase in inventory shipped and 70% decrease in missed shipments for grocery retailing chain
• Quickcareerprogression,twopromotionsinfirstthreeyears
United Toll Systems: Software Engineer/ Analyst
• Clientengagement,customersupport,issueresolution
• Handledenterprisereportingmodule
Deepak Natarajan
English, Hindi
MCA, Ch. Charan Singh University, Meerut
B.Sc. (Hons.) (Mathematics), Kirori Mal College, University of Delhi
6 years 9 months of experience in IT (Services) industry.
Tata Consultancy Services Ltd.: IT Analyst
• ManagedandimprovedClaimProcessingITlandscapeofanInsurancegiantinpost acquisition scenario
• Re-engineeredapplicationportfolioofHRapplicationsofapharmacompany resulting in 63% reduction in TCO
• ManagedcustomersupportprocessonHRapplicationforaCPGmajor
• UnitlevelappreciationforoutstandingperformanceatPfizer
• Recommendationforout-of-turn(early)promotion(2005-06)
Divya Singh
English, Hindi
B.Tech. (Aerospace Engineering), IIT Kanpur
7 years 5 months of experience in IT (Services) industry.
Times Internet Ltd.: Chief Manager, Technology
• Helpeddevelopthefutureroadmapforevolutionof EconomicTimes.com
• Ledthetechnicalrolloutofthe2010UnionBudgetcoverageonET.com
Sapient Corporation: Manager, Technology
• Ledprojectteamsof25-40peopleacrossgeographies/cultures
• DeliveredUSD2-5millionenterpriseITprojectsforFortune500clients
• Facilitatedkeyclientmeetingsandworkshops
• ActiveparticipationinhiringandLearning&Developmentactivities;formally mentored several junior associates
Gaurav Ganeriwal
English, Hindi, German
M.Tech. (Control and Instrumentation), IIT Delhi
B.E. (Instrumentation and Control), Shri Shantilal Shah Engineering College, Bhavnagar University
7 years 3 months of experience in Automotive industry.
Robert Bosch Engineering and Business Solutions Ltd.: System Project Manager - Active Safety
• DomainexpertinActiveSafetyproductdevelopmentandprojectmanagement
• Ledsoftwaredevelopmentteamsforemergingmarketprojectswithdevelopment cost in the range of millions of Euros
• EstablishedandledtheoffshoredeliveryteamforBoschengineeringcentres(40 engineers, 4 geographies) as Technical Lead (Offshore)
• FormulatedengineeringinitiativesformarketingAnti-lockBrakingSystemsinIndia
Lurgi India Ltd.: Instrumentation Design Engineer (Petrochemicals)
Kartikeya Joshi
![Page 17: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/17.jpg)
32 33
English,Japanese
B.A.(Philosophy),Japan,UniversityofTokyo
7 years of experience in Religion.
Komyoji Temple: Manager
• RevitalisedthetemplebylaunchingYoungBuddhist Association
• Enhancedthequalityofservicesbyoperational improvements
• Marketedandincreasedawarenessofthetemplethroughwritingsandspeeches
Keisuke Matsumoto
English, Hindi
B.Tech.(ChemicalEngineering),HBTI,ChhatrapatiSahuJiMaharaj Kanpur University
7 years 8 months of experience in Diversified Services.
Anindus Consultants Pvt. Ltd.: Technical Manager
• PatentConsultantandIndianPatentAgentfor software, hardware and automotive industry
• Managerofateamof15patentconsultants,responsibleforrecruitment,trainingand mentorship
TIFAC, Department of Science and Technology: WOS-C Scholarship Trainee
• ReceivedIntellectualPropertyRightslawsandprocesstraining,among30selected countrywide
Hindustan Unilever Ltd.: Research Associate
• ResearchAssociateinDetergentsDivision
• Partofrunner-upteamforbestresearchprojectteamin2002
• Oneamong12SafetywardensinHULR&Ddivision
Konpal Rae
English, Hindi, Marathi, Tamil
Post Graduate Diploma in Hospitality Management, Les Roches, Switzerland
B.Com., SIES College of Commerce & Economics, University of Mumbai
7 years 11 months of experience in ITES & BPO industry.
Hutchison 3 Globalservices Pvt. Ltd.: Process Leader
• LedtheCustomerRetentionsTeamof80for‘3’,aleadingtelecomserviceprovider in UK with customer base of 3.5 million
Convergys (India) Services Pvt. Ltd.: Team Manager
• LedcustomerservicesteamforOptus,aleadingtelecomserviceproviderinAustralia
Firstsource Solutions Ltd. (Formerly, ICICI Onesource): Team Leader
• LedacustomerservicesteamforLloydsTSBBankintheUKfortheirInsurance division
Intelenet Global Services Pvt. Ltd.: Team Leader
• ManagedateamthatprovidedcustomersupporttoHSBC’screditcardcustomersin USA
Lakshminarayan Iyer
English, French
M.Com. (Marketing), University of New South Wales
B.A. (Business Information Management), University of Westminster
7 years of experience in IT (Products) industry.
Dell: Account Executive
• Accountableforgeneratingnewbusinessfrom Fortune 500 organisations
• SecuredoverAUD30millionofserver,storageandsoftwarelicensingcontractswith organisationslikeTalent2,VerizonandSungardin2009
• Manageddesignatedinternalsalessupportstaff
• Awarded‘TopGun’DellSalesAward
Novell: Partner Account Manager
• Providedtraining,presentationsandassistedwithbusinessplanstochannelpartners and distributors
Optima Technology Solutions: Account Manager
• AdvisedandsuppliedtheEducationandGovernmentmarketswithOptimaPCand Networking hardware
Luxsho Logan
English, Hindi, Punjabi
MBBS, Netaji Subhash Chandra Bose Medical College, RaniDurgavatiVishwavidyalaya
6 years 1 month of experience in Defence Services and Healthcare industry.
Indian Navy: Medical Officer
• ManagedEmergencyRoomsandFamilyWelfare Centres at 3 Naval stations
• Trainingofficerforateamof40medicalassistants
• Organisedseminarson‘CommunicationneedsinaHospital’
• Awarded‘WomanoftheYear2008’byRotaryClub,Gujaratfororganising3blood donation camps
• UpgradedthemedicaldepartmentatDaman-addedafunctionalLab(for12,000 personnel) and ensured a well stocked pharmacy
GovernmentMedicalCollege,Chandigarh:JuniorResident
Manjot Kaur
English, Hindi, Telugu, Kannada
MS (Computer Science and Engineering), University of Washington, Seattle
BS (Computer Science), University of Texas - Austin
6 years 6 months of experience in IT (Products) industry.
Tummala Electronics Pvt. Ltd.: CTO
• Establishedwebpresenceforthecompanydealingintelecomequipment
• LedR&Ddivisioninestablishingembeddedsystemsdesignteam
• Providedtelecomequipmenttorailways’operations
Microsoft Corporation: Senior Program Manager
• Responsibleforscopingfeaturesandarchitecturaldesignsofreportingandbusiness intelligence subsystems in Microsoft Dynamics AX 2009
• Managedplanning,execution,anddeliveryoffeaturesacrossteamsinUS,Denmark and India
• Filed5patentsinbusinessintelligencespace
Microsoft Corporation: Software Design Engineer
Manoj Nuthakki
English, Hindi, Gujarati, Marathi
Doctor of Medicine, Topiwala National Medical College, University of Mumbai
MBBS, RA Education Society, University of Mumbai
6 years 2 months of experience in Healthcare industry.
United Nations Children’s Fund (UNICEF)/Mumbai Districts AIDSControlSociety(MDACS):Consultant,PediatricHIV
• Ledateamof100healthcareworkersprovidingmedicalandholisticsupportto HIVpatients
• StrategisedHIVcareprogrammetoincreasethefollowupandtestingrateby3%
• Managementofsupplychain,finance,logisticsandoperationsforHIVprogramme
• ManagedbudgetofoverINR20million
Municipal Corporation of Greater Mumbai (MCGM): Resident Medical Officer
• Implementationofnationalhealthprogrammesinurbanandruralareas
• Teamleaderformedicalreliefanddisastermanagement
Maulek Desai
English, Hindi
EMBA(GeneralManagement),SPJainInstituteofManagement & Research
B.E. (Hons.) (Electrical Engineering), NIT Bhopal
6 years 9 months of experience in Engineering industry.
Larsen & Toubro Ltd.: Manager (Strategic Initiatives)
• Formulated5yearStrategicPlanforSBUsinPowerT&Dspace
• SpearheadedimplementationofStrategicInitiativesbyidentificationofleadership bandwidth, efficient resource allocation and re-alignment of organisational structure
• Planning,co-ordinationandmonitoringofturnkeyelectricalinfrastructureprojects. Clients Included: PGCIL, KPTCL, BESCOM, TNEB etc
• BusinessdevelopmentandpreparationofbiddocumentsforpowerT&Dprojects
• IdentifiedasTop-TalentunderManagementLeadershipProgramme
Mayank Rajvaidya
English, Hindi
BS (Mechanical Engineering), California State Polytechnic University, Pomona
6 years 2 months of experience in Manufacturing industry.
Bevel Gears India Pvt. Ltd.: Executive - Engineering
• Integralroleinshapingcompanystrategyandgrowth map for next 5 years specifically in areas of technical expertise and capital equipment acquisition
• Bevelgearspecialistequipment-joballocation
• Liaisedwithtargetinternationalcustomersincludingsalescallsandcustomervisits
• WorkedwithclientsinUSA,Germany,Italy,Thailand,Japan,UK,Australia,New Zealand to assess their technical requirements and allocate company resources
Mico Bosch: Technical Graduate Trainee
• Completedrecord51pilotordersin6months
Mushtaq Jamal
English, Hindi
B.A. (Hons.) (Economics), Ramjas College, University of Delhi
6 years 7 months of experience in Marketing & Advertising industry.
FireflyeVentures(anHTMediaCompany):SeniorBrandManager
• ManagedbrandmarketingandcommunicationwithbudgetofUSD2.5millionfor Shine.com India’s fourth largest jobsite
• Improvedprocessesandcommunication,therebyreducingcandidatedrop-outs by 10%
Pratham (India’s largest NGO working in the education sector): Consultant
• Providedplanningsupportforeducationalprogrammescovering20,000primary schools and 1.6 million students
Equus Red Cell (A WPP Group Company): Group Account Director
• HelpeddevelopVLCC’smarketingstrategyresultinginrecordgrowthof22% in 2006-07
• Grewagencyrevenuesby20%byadding5newbusinesses
Nadeesh Ramachandran
English, Hindi
B.E. (Computer Science), Sinhgad College of Engineering, University of Pune
6 years 9 months of experience in IT (Services) industry.
Persistent Systems Ltd.: Project manager
• ‘EmployeeoftheQuarter’AwardforbuildingWells Fargo bank into a USD 5 million customer
• Handledteamof60onvariousenterpriseaccounts
• ‘EmployeeoftheBusinessUnit’AwardforCoca-Colaaccountmanagement
• EstablishedTechnologyCompetencyGroupandwonaccounts-USD750,000
• Managedfinancialandlegalaspectsoftheprojects-projectestimates,cost monitoring, statement of work, service agreements, invoicing
Namita Pant
English, Hindi, Tamil, Kannada, French
B.E. (Hons.) (Electrical and Electronics), BITS Pilani
6 years 9 months of experience in Electronics industry.
Cisco Systems Inc.: Software Engineer
• Designed,developed,testedanddeployed telecommunication IP networking systems
• Identifiedandevaluatednewstrategicallianceopportunitiesforsmartconnected networking solutions
• Completedaone-yearGlobalLeadershipProgramme
• Filedtwopatentsforinnovationsinqualityofserviceforinternetbackbone
Tata Elxsi Ltd.: Design and Development Engineer
• DevelopedsupportformultimediaonSmartPhoneoperatingsystem
• Createdasoftwarelifecycleinfrastructurethatwasusedacrossprojectsinthe company
Narendra Kumar
![Page 18: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/18.jpg)
34 35
English, Hindi, Marathi, Telugu
B.E. (Electronics and Telecommunications), Maharashtra Institute of Technology, University of Pune
6 years 4 months of experience in IT (Services) industry.
Infosys Technologies Ltd.: Technology Lead
• Businessintelligenceleadwithexperienceintheretail and logistics sectors
• Regularinteractionwithclientsonbusinessandtechnicalissues
• ExecutedmultipleprojectsatclientlocationsintheUSA
• Mentoredteamontechnicalandfunctionalcompetenciesandprovidedfeedbackto manage performance
• Involvedinestimation,staffingandpre-salesactivitiesinordertoplanforrequired budget and resources
Neelakash Murty
English, Hindi
PG Diploma in Advertising and Marketing, Xavier Institute of Communications, Mumbai University
B.A.(Psychology),JaiHindCollegeandBasantsinghInstituteofScienceandJTLalwaniCollegeofCommerce,University of Mumbai
6 years of experience in Consumer Products industry.
Mount Everest Mineral Water Ltd.: Brand Manager
• RepositioningofHimalayanwater,developmentandexecutionofacross-the-board mass media and on-ground activation programmes
• Focusmarketsselection,consumersegmentation,tradechannelsdevelopment for 200% increase in retail penetration, market research modules for brand, pricing decisions
Lowe Lintas (India) Pvt. Ltd.: Senior Brand Services Manager
• Brandconceptualisation,communicationstrategyfornewTataF&Bproducts
• Advertisingcampaignmanagement;insightminingfornewbusinesspitches
Tata Tea Life: Marketing Deputation
• Executionoflaunchsalesandmarketinginitiatives
Pritish Nandy Communications Ltd.: Assistant to Executive Producer
• Productionco-ordination,in-filmbranding
Neha Mansukhani
English, Hindi, Marathi
B.E. (Electronics and Telecommunications), Army Institute of Technology, University of Pune
6 years 4 months of experience in Telecommunications industry.
Idea Cellular Ltd.: Manager
• CircleLaunchTeamresponsibleforvalueadded services in terms of product development and pricing plans for East hub
Reliance Communications Ltd.: Manager
• Responsiblefor3GMobileTVproductdevelopment
• Rolledoutpan-IndiaMobileTVservicesacrossCDMAandGSMnetworks
Reliance Next Link Pvt. Ltd.: Manager
• ResponsiblefordeployingsecurityautomationsolutionsfortheRelianceGroup
• LedtheSmartCardrolloutfortheentireRelianceADAGroup(23+companies; 60000+employees)
Neil Ashok Taskar
English, Hindi
Project Management Professional, PMI
B.E. (Computer Science), Ramrao Adik Institute of Technology, University of Mumbai
7 years 8 months of experience in IT (Products) industry.
NeubergerBermanLLC.:AssistantVicePresident
• BusinessAnalystinPortfolioManagementverticalofanassetmanagementcompany
• MigratedoperationstoBroadridgeFinancialSolutionsfollowingLehman’s bankruptcy filing
• Executedafundsdisbursementsystemimprovingefficiencyby35%
• Co-ordinatedmigrationofPMS(USD2million)tonewertechnologies
eYork Consulting Inc.: Senior Software Consultant
• DesignedandimplementedaPointofSalessystem(retailclient)optimisingcustomer handling time by 32%
Infosys Technologies Ltd.: Software Engineer (Logistics)
• Teamlead(10developers)forDHL-Airborneintegration
• APACAwardforExcellence
Nidhi Trehan
English, Hindi, Marathi, Gujarati
CA, ICAI
B.Com., R A Podar College of Commerce and Economics, University of Mumbai
6 years of experience in Consulting industry.
Ernst & Young Pvt. Ltd.: Senior Consultant
• Ledprocessimprovementandbusinessdesign projects in retail, consumer products and manufacturing industries
• AssistedIndia’slargestretailerinsettingupaSSCforitsfinanceprocesses
• DesignedbusinessprocessesforanIndianconglomerateforayinginretailoperations
• Suggestedcostreductionmeasuresandpluggedrevenueleakagesatseveralclients
• ConsistentlyledprojectsworthINR10millionandwonadditionalprojectsfrom 80% of my clients
Nihar Thanawala
English, Hindi
M.A. (Economics), Delhi School of Economics, University of Delhi
B.A. (Hons.) (Economics), Miranda House, University of Delhi
6 years 5 months of experience in Financial Services industry.
GE Money Servicing: Assistant Manager
• LedConsumerFinanceRetailAnalyticsteamtocreateanalyticalsolutionsfor optimising portfolio profitability
• Developedanend-to-endretailbankingcrosssellstrategythatgenerated USD 1 million in net income
Deloitte Support Services Pvt. Ltd.: Analyst
• GeneratedcompetitivelandscapereportsfortheFinancialAdvisoryServicesmarket
American Express India Pvt. Ltd.: Business Analyst
• Achieveda10%improvementincustomeracquisitionthroughfinancialand statistical models
• Optimisedcreditcardoffersfora10%incrementalROI
Little Flower School: Administrator
• Managedadministrationoftheschool
Nirajana Mishra
English, Hindi, Tamil, Kannada
Masters In Public Affairs, Public Finance and Policy Analysis, Indiana University, Bloomington
M.A. (Economics), University of Mumbai
B.A. (Hons.) (Economics), St. Xavier’s College, University of Mumbai
6 years 11 months of experience in Consulting industry.
International City/County Management Association: Senior Associate
• Leadconsultantforgovernmentperformancemeasurementsystems,inclient governments
• Developedadvancedreporting/analysisframeworkforclients:broughtinadditional USD 50,000 in revenues
• Leadmonitoring/evaluationspecialistforICMAdevelopmentprojectsinEthiopia, Afghanistan and India
• WorkedwithUSVicePresident’sOfficeinmeasurementoftheRecoveryAct
Public Affairs Centre: Research Analyst
• Conductedresearch/analysisforKarnatakaandOrissaintheareaoflocal governance
Institute of Public Administration and Budgeting: Analyst
• Createdrevenueforecasts/summariesfordistrictsinKarnataka
Nischinth Keshav
English, Hindi
B.E. (Polymer Science and Chemical Technology), Delhi College of Engineering, University of Delhi
6 years 3 months of experience in IT (Services) industry.
Headstrong Services India Pvt. Ltd.: Consultant
• WorkedonprojectsinBFSIdomainforUSbank majors, including investment banks
• ‘CauseforApplause’awardforcontributiontoa3-yearcontract(riskmanagement domain - USD 875,000)
• Workedacrossgeographies-US,UK,GermanyandAfrica
• CertificateofAppreciationfromClaytonHoldingsfordeliveryofmortgagesolutions
Infosys Technologies Ltd.: Software Engineer
• TeamoftheyearawardforDHLpricingproject
• Modulelead(logisticsdomain)within2years
Nishant Gogia
English, Hindi, Portuguese
ME (Computer Engineering), University of Maryland
BE (Electrical Engineering and Computer Science), University of Maryland
6 years 9 months of experience in IT (Services) industry.
Universal Service Administration Company: Systems Manager
• SavedUSD4millionincostforcompanybyin-sourcingfinancialapplication
• CreatedOperationsDivisionlinkingInformationTechnologywithBusiness Development
HSNJLLC.:FounderandCEO
• Managedoperational,financialandHRrelatedprojectsinandaround Washington DC
• ClientsincludedVerizon,FreddieMacandFannieMae
Freddie Mac: Senior Business Analyst
• Reducedtimetopreparefinancialstatementsfrom66to48days
• Receivedthehighestratingamong530employeesinApplicationDevelopment Centre
Nitesh Batra
English, Hindi, Kannada
B.E. (Computer Science and Engineering), National InstituteofEngineering,VisvesvarayaTechnologicalUniversity
6 years 9 months of experience in IT (Products) industry.
Intel Technology India: Technical Marketing Program Lead
• LednewtechnicalmarketingteamacrossIndia,TaiwanandJapanforlow-cost segment products
• EnabledBlu-rayDiscsupportonIntelplatformsatlaunchbyinfluencingvendorsand PC makers
• Definedplatformsoftwarefeaturesandcustomerengagementplansforthree products
• EvangelisedInteltechnologiesandproductsatindustryevents
• Resolvedhigh-impactproblems,enablingcustomers’launchestomarketontime
SLK Software Pvt. Ltd.: Associate Engineer - Software
• SoftwaredevelopmentforAmericanAgricultureResearchCompany
Nithin B Ramachandra
English, Hindi
BS (Computer Engineering), Purdue University
6 years 8 months of experience in IT (Services) industry.
Capgemini US LLC.: Manager
• Experienceindiversesectorsincludingrailways, utilities, media & entertainment, and automobiles
• SpearheadednewbusinessdevelopmentataUSD30billionrailwaysclientselling4 consulting projects worth USD 4 million
• Managed10consultants,scalingasolutionfrom35,000to7millioncustomersfora utility client in 2.5 years
• Awardedforperformance,oneoftheyoungestemployeespromotedtoManagerin North American practice at Capgemini
Nitin Harish Jethanandani
English, Hindi
B.Tech. (Chemical), NIT Tiruchirapalli
7 years 8 months of experience in IT (Services) industry.
Infosys Technologies Ltd.: Project Manager (BFSI domain)
• WorkedonsolutionsdeliveryinRiskandCompliance areas for banks
• Managedthedeliveryofthebiggestfixed-bidprojectforInfosys-BankofAmerica account
• Ledandmentoredteamsspreadacrossgeographies-US,Mexico,LatinAmerica, China and India
• ReceivedSPIRITawardfromChairman,BankofAmerica
• SPOTawardfromInfosysformanagingchallengingprojectsituations
• Workedwithpre-salesteamforproposals
Nitin Raj
![Page 19: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/19.jpg)
36 37
English, Hindi, Gujarati, Nepali, Telugu
B.Tech. (Mechanical Engineering), NIT Warangal
6 years 7 months of experience in FMCG and Oil & Gas industry.
ITC Ltd.: Assistant Manager - Technical
• FactoryManagerofITC’sfoodprocessingunitat Bangalore
• TurnedaroundalossmakingBiscuitManufacturingunit
• ImplementedSixSigmatoolsresultingin3%totalcostreduction
• CertifiedSixSigmaBlackBelt
Hindustan Petroleum Corporation Ltd.: Project Engineer
• ResponsibleforFullProjectCyclesofseveralsuccessfulsub-projects(>500million) for an oil refinery
• Recognisedforaccomplishingcomplex,high-risktaskswithinaPSUset-up
• PMPcertified
Nitin Umanath Dubey
English, Hindi
Graduate Diploma in Apparel Marketing and Merchandising Management, NIFT, Hyderabad
B.A. (Hons.) (Economics), University of Delhi
7 years 9 months of experience in Retail & Wholesale industry.
ITC Ltd.: Assistant Manager
• Developedprivatelabelarchitectureforhypermarkets
• Developedapparelproductqualityprotocol
• Reducedinventoryandimprovedretailmargins
Wal-Mart Inc.: Merchandiser
• Increasedsourcingbusinessby100%forWal-MartMexicoin15months
• DiversifiedASDA(UK)sourcingandstrengthenedvendormatrix
• Managedoneofthelargestaccounts,worthUSD40millionatWal-MartGlobal Procurement India
Taffles Exports Pvt. Ltd.: Merchandiser
• DevelopedMumbaiofficeandstreamlinedoperations
Shahi Export House: Management Trainee
• WorkedwithmajorUSbuyersandsourcingagencies
Parthsarthi
English, Hindi, Nepali, Maithili
B.Tech. (Mechanical Engineering), NIT Warangal
6 years 6 months of experience in Automobile industry.
Bajaj Auto Ltd.: Assistant Manager
• DesignedoptimisedHVACsystem
• Designednovellowcostheatinganddemisting/ defrosting system
Maruti Suzuki India Ltd.: Deputy Manager
• ImplementedchangesinHVACunitofRitztomakeitcompatibleforIndia
• Initiated28costreductionproposalsandachievedcostreductionofINR30million
• Atservicedivision,established17workshopsin12months
Subros Ltd.: Senior Engineer
• VA-VEofHVACassemblytosaveINR219perkit
• Solvedcriticalproblembyre-designingcompressormountingbracket
Prasoon Pallav
English, Hindi
B.A. (ASPM), Delhi College of Arts & Commerce, University of Delhi
7 years 8 months of experience in Financial Services and Hospitality industry.
HSBC Data Processing India Pvt. Ltd.: Manager Operations
• Ledteamsdeliveringcustomer-servicetoUK&USinMortgage-serviceandCredit- card processes
• ManagedMortgage-processmigrationsfromHSBCUK&US
• RecognisedbyHSBCasaHigh-Potentialmanager
HSBC Data Processing India Pvt. Ltd.: Assistant Manager Learning & Development
• Conceptualisedanddeliveredcustomisedworkshopsasperoperational requirements
• LaunchedanonlinelearninginitiativefortheNorth-Americanprocesses
ITC Ltd.: Assistant Manager Food & Beverage
• Memberofpre-openingteamfortwoluxuryproperties
• Devisedsixsuccessfulfood-promotions
• Managedthemanpower-schedulingforF&Boperations
Rajat Sud
English, Hindi, Tamil, Malayalam
MBA (Marketing), Bharathiar University, Tamil Nadu
Bachelor of Corporate Secretaryship, PSG College of Arts & Science, Bharathiar University
7 years 11 months of experience in Commercial Banking and FMCG industry.
Citibank NA: Senior CitiGold Relationship Manager
• WonCountryBusinessManager’scoveted‘Bravo’awardforincreasingassetsunder management by 15 times for a particular customer account and for customer retention
• Handled30%ofBranchAssetsunderManagement
ICICI Bank Ltd.: Regional Marketing Manager, Small Enterprises Group
• Spearheadedmulti-productbusinessgenerationforSMEGroupinTamilNaduand Kerala
ITC Ltd.: Area Executive - Foods
• Territorygrewby122%inconfectionaryand300%inbiscuitsYoY
Hindustan Coca-Cola Beverages Pvt. Ltd.: Excel Trainee - Sales & Distribution
• HighestgrowthachievedintheTirupurmarketYoY-oneofthehighestinTamil Nadu
PepsiCo (India) Pvt. Ltd.: Sales Trainee
Ramachandran A V
English, Hindi, French
B.Tech. (Mechanical Engineering), IIT Delhi
6 years 9 months of experience in Consulting industry.
GRAIL Research: Project Manager
• Managedresearchconsultingprojectsfortelecomand hi-tech clients
• Salessupportforproposaldevelopment
• Developedtrainingprogrammes
• Winner,OutstandingClientServiceAward
UnitedLex:AssociateVicePresident
• PursuedsalesopportunitiesforLPOservices
• DesignedIPProduct/Services
• Developedaclientservicingandanalyticsdashboard
• Won3clientrelationships
Evalueserve: Senior Manager
• Ledagroupof40+MBAsengineers
• Businessdevelopmentanddeliveryplanning
• KeynotespeakerinIPconferences
• Winner-BestPerformer,BestTeam
Rohan Dayal
English, Hindi, Telugu, Kannada
MS (Computer Science), Main Campus, Western Michigan University
B.E. (Computer Science), Main Campus, Bangalore University
7 years 8 months of experience in IT (Services) industry.
GCE / Prime Solutions Inc.: Business Analyst
• Led5memberERPsystemteamliaisingfieldunits,operationsandIT
• End-to-endprocessimprovementinVendorManagementSystem;reduced procurement delays by 30% and payment penalties by 25%
• LedQAautomation,improvingdeliverytimeby20%
• BaggedmaintenancecontractofUSD500,000withUSCoastGuard
Digital Harbor Inc.: QA / Technical Support Specialist
• InstrumentalinQualitycontroltowardsproductsfirstcommercialversion
• LedTechSupportteam,retainingcriticalfundingfromUSDoD
Satyam Computer Services Ltd.: Software Engineer
HCL Perot Systems Ltd.: Software Engineer
Roopa Datla
English, Hindi, Punjabi
B.E. (Civil Engineering), Thapar Institute of Engineering and Technology, Patiala
6 years 5 months of experience in Power Sector
Lanco Infratech Ltd.: Manager
• Executedtwopowerprojectsof1200MWeach
• Achieved25%reductioninengineeringtimeforAnpara C project
• ResolvedissueswithDongfangElectricCorporation(Chinesesupplier)
• SavedINR310millioninprojectcosts
NTPC Ltd.: Senior Engineer
• ImplementedconstructionpackagesworthmorethanUSD100million
• TenderedandawardedpowerprojectpackagesworthmorethanUSD232million
• ObtainedGovernmentbodyclearancesforprojects
Sanjeev Sharma
English, Hindi, Marathi, Malayalam
B.E. (Electronics), D Y Patil College of Engineering & Technology, Shivaji University
7 years 3 months of experience in Marketing & Advertising industry.
Ogilvy & Mather Pvt. Ltd.: Group Account Manager
• ManagedkeyclientssuchasUnilever,Cadbury,Bank of India and IPL
• Partofteamsthatre-launchedbrandslikeCadburyPerk,Cadbury5Star,Closeup, Bank of India and Rajasthan Royals
• PartofO&M’s‘YoungTigers’programme,aninitiativethatidentifiespotentialfuture leaders within the Agency
• FinalistinAdvertisingClubofMumbai’s‘YoungAchiever2008’,anawardthat recognises talented young marketers
Millennium Broadcast Pvt. Ltd.: Assistant Station Engineer
Santosh Narayanan Kutty
English, Hindi, Kannada, Tamil, French
B.E. (Electrical & Electronics), College of Engineering, Guindy, Anna University
6 years 9 months of experience in Education and Automotive industry.
Knowledge Bricks Management and Education Services Pvt. Ltd.: Director
• Propelled80%ofourstudentstoachieveGMATscoreintop2%
• Achieved500%growthratewithin10monthsofoperation
Noesis Education and Management Services (Management Training Institute): Director
• RevenuesofUSD1millionwithin3yearsofoperation
• Grewfromonecitytoeightand500Studentsto3000,withinfirst18months
TVSMotorCompanyPvt.Ltd.:Member-R&D(ProjectLead,TVSPatrolProject)
• DevelopedIndia’sfirstPolicePatrolvehicle
• DesignedIndia’sfirsthybrid2-wheeler;awarded‘ConceptBikeoftheYear,2008’by Overdrive
Santosh Narasimhan Panambur
English, Hindi
MS (Electrical and Computer Engineering), The Ohio State University, Columbus
B.Tech. (Electrical Engineering), IIT Delhi
6 years 5 months of experience in IT (Products) industry.
The Mathworks: Senior Software Engineer
• Executedandmanagedfullsoftwaredevelopmentlife-cycleforcoreMatlab/Image Processing Toolbox projects
• Plannedandexecutednew/incrementalfeaturestosupportscientificandimagefile formats
Pixia Corp: Engineer
• Design,anddevelopmentworkaffiliatedwiththeproprietarytechnologyforlarge image storage
• Ledtheend-to-endWebMapServer(WMS)productdevelopmentanddelivery
British Telecom (R&D): Research Intern
• Conceptualisedanddevelopedaprototypeforamulti-modaldatasharingplatform (Internet/ WAP/ Telephone/ IM/ SMS)
Sun Microsystems (India) Pvt. Ltd.: Engineer
• SoftwareDevelopmentandQualityAssurance
Saurabh Sood
English, Hindi
B.E. (Electrical Engineering), NIT Allahabad
7 years 9 months of experience in IT (Services) industry.
Infosys Technologies Ltd.: Technology Lead
• Ledthetechnicalteamanchoringthetakeover and integration of the USD 38 million acquisition of
McCamish Systems by Infosys
• Enabledtop-managementreportingbyconsultingformulti-milliondollarenterprise initiatives for a top US Insurance (Health) major
• Anchoredpre-salesandprojectmanagementactivitiesworthUSD10million (Healthcare vertical)
• Ledcriticalpilotprojectsonthebusinesspipeline
• Received‘InfosysExcellenceAward’fordeliveryexcellence
Sheetal Singh
![Page 20: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/20.jpg)
38 39
Siddhartha Chatterji
English, Hindi, Punjabi
B.E. (Manufacturing & Automation), Netaji Subhas Institute of Technology, University of Delhi
7 years 8 months of experience in IT (Products) industry.
Stryker Global Technology Center: Project Lead
• Conceptualisedanddesignedawebapplicationfor anewmedicaldevice;led10memberteamforUSD4millionproject,awarded ‘Innovation Award’
• Extensiveexperienceinmanagingmultipleprojects,compliancerequirementsand co-ordination with marketing and surgeon panels
Compro Technologies Pvt. Ltd.: Associate Project Manager
• ManagedaUSD2millionLearningManagementSystemdevelopmentinitiativefor Thomson Learning
Conexant (India) Pvt. Ltd.: Technical Lead
• LedmultipleWi-FiApplicationdevelopmentinitiativesforDellandHuawei
Compro Technologies Pvt. Ltd.: Module Lead
• Designedanddevelopede-learningsuitemodules
Simerjeet Singh
English, Hindi, Telugu, Tamil
MS (Civil Engineering), North Carolina State University
B.Tech. (Civil Engineering), IIT Madras
6 years 5 months of experience in Telecommunications industry.
AT&T Mobility: Senior Technical Architect
• Leddelivery,oversightandsupportinretailsales application,serving3500AT&TStores,achannelworthUSD3+billionofrevenues each year
• Responsiblefordesignandarchitecturaloversight
• Ledinitiativesonmobileplatformapplication
• CIOAwardforiPhoneactivationprocessinnovation
MDI Inc.: Senior Analyst
• Workedonallaspectsfromproductionsupport,applicationdevelopmenttodesign
Sivakumar Venkata Pabolu
English, Hindi, Punjabi
B.Tech. (Computer Science), NIT Warangal
6 years 8 months of experience in IT (Services) industry.
Trilogy E-Business Software (India) Pvt. Ltd.: Project Delivery Manager
• Managedend-to-endconsultingprojectdeliveryfor Fortune 100 Insurance Company (USD 4 million annual engagement)
• Developed‘MarketResponseModel’forautomotivegiant,savingUSD4millionby inventory mix planning
• AwardfromVPSalesforbestproductinterfaceenhancementsthathelpedwina multi million deal
• AwardedapatentinUS-Improvingtheeffectivenessofdemandsensingand prediction
MindTree Consulting Ltd.: Programmer Analyst
• DevelopedpensionplannerforGovernmentofHollandforretirementplanning
Sourabh Kukreja
English, Hindi, Kannada, Tamil
AICWA, ICWAI
B.Com.,RamakrishnaMissionVivekanandaCollege,University of Madras
7 years of experience in the Financial Research KPO industry.
Irevna Ltd., UK: Senior Research Analyst
• Performedbusinessanalystandprojectmanagerroleinatopinvestmentbankin London
Irevna - A Division of CRISIL: Senior Research Analyst
• Workedonanalysisofcorporategovernancedisclosuresofcompaniesinthe Americas, Europe and Asia
• Workedonfinancialresearchprojects
• Involvedinprojectmanagement
Hewlett-Packard Global eBusiness Operations Pvt. Ltd.: Senior Process Associate
• Process expert
• Involvedintraining,projectmanagementandclientinteraction
Srinivas Goutham Ramkumar
English, Hindi
B.Com., M E S College of Arts, Science and Commerce, Bangalore University
7 years 6 months of experience in ITES & BPO industry.
Convergys (India) Services Pvt.Ltd.: Manager - Command Center
• Supplyplanning,operationsmanagementandclientrelationsformultipleclients
• Selection,training,development,performancemanagementof60directreports
Dell International Services: Senior Operations Analyst
• LeadingworkforceoptimisationfunctionforUScustomertechsupport
• Capacityplanning,forecastingresourcerequirementforbusinessgrowth
Genpact: Process Developer
• InvolvedwithMIS,automationofreports,anddashboards
Sudarshan Dujari
English, Hindi, Telugu, Oriya
CFA, Cleared Level II, CFA Institute, USA
B.E. (Computer Science), Orissa Engineering College, Utkal University
7 years 1 month of experience in IT (Services) industry.
Infosys Technologies Ltd.: Technology Lead
• Programmemanagedthedevelopmentoftechnologysolutionsforriskmanagement at the Private Wealth Management department of Goldman Sachs
• BuiltandimplementedathoroughportfolioallocationmodelforHNIsusing proprietary Goldman Sachs models
• Clientandoffshoreco-ordinatorforaUSD50millionrevenueprogramme
• EarnedBestTeamPlayerAwardin2007
• WonMostValuablePlayer(MVP)nominationsin2004and2005
Sudhir Aray
English, Hindi
MS (Microelectronics), Nanyang Technological University
B.E. (Electronics), Shah and Anchor Kutchi Engineering College, University of Mumbai
6 years 9 months of experience in Electronics industry.
Nanyang Technological University: Research Associate
• Ledteamresearchingprintedelectronics,providedexpertiseincircuitdesign
• Productdevelopment/operationsleaderforNanyangTechnologicalUniversity- incubated company (energy storage)
• Teachingpolytechnic,undergraduateandgraduatestudentsonvariousprojects
Chartered Semiconductors Manufacturing Ltd.: Senior Process Integration Engineer
• Ledcross-functionalteamstoachieveorganisationalgoals
• Resolvedcustomerissuecausedbydesignproblems,enabledUSD20million revenue
Labline Instruments: General Manager / Partner
• Increasedrevenuesby75%in3years,andconvertedbusinessfromlossesinto profitability of 20%
Suraj Kamath
English, Hindi, Marathi
B.Sc. (Computers), International College for Girls, University of Rajasthan
6 years 1 month of experience in Financial Services industry.
Kotak Mahindra Bank Ltd.: Manager
• Faceofthecompanytobuildanddeepenrelationships with existing customers
• Handledapproximately250customers,eachwithrelationshipvaluebetweenINR 150,000 and INR 2.5 million
• Tappedthein-housecustomersofdifferentbankingverticalslikeassets,tradeand wealth management customers
• Metrevenueandbranchtargetsbyaggressiveacquisitionofnewcustomers
• Wasrecognisedforcontributionashighestrevenueearnerfortheentireregion
Surbhi Sachin Sawant
English, Hindi, Bengali, Marathi
MS (Computer Science), Wadham College, University of Oxford
B.Tech. (Information Technology), SNDT Women’s University, Bombay
6 years 2 months of experience in IT (Products) industry.
AOL India Pvt. Ltd.: Product Manager - Strategy & BD
• Presentedbusinesscasesforstrategicacquisitionsandpartnershipsforvideo,radio, SHOUTcast and Winamp products
• Completed100smalland4largedeals(BBC,SonyBMG,HMV,NDTV)
Procter & Gamble, UK: Product Manager - SAP Implementation - EMEA
• LedtheUSD8millionupgradeoftheEMEAwideSAPfinancialaccountingsystems
Oracle India Pvt. Ltd.: Member Technical Staff
• DevelopedSLAcompliancesmonitoringsoftwareforOracleEnterpriseManager
Tata Consultancy Services: Assistant Systems Engineer
• DevelopedtradingalgorithmsforthestocktradingportaloftheBombayStock Exchange
Tanushree Jana
English, Hindi, Punjabi, French
Master of Social Sciences, National University of Singapore, Singapore
BachelorofJournalism,LadyShriRamCollegeforWomen, University of Delhi
6 years 6 months of experience in Telecommunications and Research & Consulting industry.
Nokia India: Manager, Consumer and Customer Insights
• Awarded‘GlobalLeadershipAward’forMarketingExcellence
• AwardedforsettingupfirstofitskindRetailAuditProgramme
The Nielsen Company: Manager, Client Solutions Customised Research
• Won‘NielsenArtAward’forexceedingrevenuetargetby35%in2007
• BidandsetupAirtelRelationshipCentreAuditProgramme
IMRB International: Research Executive
• ManagedPizzaHut’sMysteryShoppingProgrammeandBrandTrack
Euromonitor International: Research Analyst
• IndependentlyformulatedtwoIndiaspecificreports-Travel&Tourism’05and Consumer Food Services’05
Tara Anand
English, Kannada, Tamil
M.E. (Industrial Engineering), Texas A&M University
B.E. (Production), PSG College of Technology, Coimbatore, Bharathiar University
6 years 9 months of experience in Financial Services industry.
Capital One Financial Services: Senior Business Analyst
• Developedanoptimalfeewaiverpolicy(creditcards)leadingtoa10%decreasein retention and 15% reduction in calls
• Redesignedinternetmediaefficiencyframework,increasingspendefficiencyby15% (USD2millionannualNPV)
• Delivered10%gaininleadconversionratethroughcreativeandfunctional improvements on the website
• Reducedmarginaloperationscost(creditcardaccounts)leadingtoaUSD20million gain through incremental customer acquisitions
Venkatesh Channaraj
English, Hindi, Bengali
M.A. (Economics), Delhi School of Economics, University of Delhi
B.A. (Economics), St. Stephen’s College, University of Delhi
7 years 11 months of experience in Financial Services industry.
Standard Chartered Bank: Risk Manager, Unsecured Lending
• PortfoliomanagementforSingaporeandMalaysia
• MemberofBaselIIteam
• Quantitativeriskappetiteassessment
American Express India Pvt. Ltd.: Assistant Manager
• Acquisitionstrategyforconsumer/smallbusinessprospects
• USpatentedinventor
• PlatinumRingofRewardforPerformance
Tata Energy Research Institute: Research Associate
• Energysystemmodeling
• MemberofIndiandelegationtoIAEAconference
![Page 21: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/21.jpg)
40 41
English, Tamil
B.E. (Electronics & Communications), College of Engineering, Anna University
6 years 6 months of experience in IT (Services) industry.
Tata Consultancy Services Ltd.: Information Technology Analyst
• ProjectManager-responsiblefordelivery,strategyandcommunicationfora35 member team. Saved USD 14 million with performance and process tuning initiatives
• ReviewerandpromoterforProcessInnovationfora140memberrelationship
• ITconsultantforIntegrationofamajoracquisitionbyBB&T
• MostValuablePlayerforBB&T-TCSrelationship
• AppreciationandrecognitionfromclientsandTCSmanagementconsistently
Yoganand Sundararajan
![Page 22: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/22.jpg)
42 43
4 TO 6 YEARS
![Page 23: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/23.jpg)
44 45
English,Hindi,Marathi,Japanese
B.E. (Electronics and Telecommunication), Sinhgad College of Engineering, University of Pune
4 years 3 months of experience in Electronics and IT (Services) industry.
KPIT Cummins Infosystems Ltd.: Senior Embedded Software Engineer
• ‘Cheers’awardforleadingafirmwareprojectatTokyoforatopJapanese semiconductor company
• ExpandedthescopeoftheprojectforamajorJapaneseclient
• ‘Wow’awardforoutstandingworkin2007
• Published3technicalreports(nowintellectualpropertyoftheclient)
Cognizant Technology Solutions: Programmer Analyst
• WorkedinBFSIdomainoncorporateinvestmentbankingprojectsforaUSbank
Abhijeet Anant Joshi
English, Hindi
M.Sc. (Economics), London School of Economics
M.A. (Economics), Delhi School of Economics, University of Delhi
B.A. (Hons.) (Economics), Ramjas College, University of Delhi
5 years 6 months of experience in Financial Services industry.
American Express: Manager, Decision Sciences and Risk Management
• PortfolioRiskManagementAdvisoryforpartnerbanksinEurope
• ExperienceinleadingandtrainingstaffinRussia,Romania,Greece,Latvia,UKand Hungary
• PatentawardholderfordevelopingportfolioacquisitionstrategiesfortheUSmarket
• Backgroundinportfoliomanagementstrategiesforconsumercreditproductswithan emphasis on quantitative modelling techniques
Abhinav Kala
English, Hindi, Bengali
B.E.(TelecomEngineering),RVCollegeofEngineering,VisvesvarayaTechnologicalUniversity
4 years 9 months of experience in IT (Products) industry.
National Instruments Corporation: Project Manager
• Manageddevelopmentofcommunications/RF products;(Teamsize-10to15engineers)
• Releasedsixproductsin2yearsontimeandwithinbudget
• Singlepointforpre-salessupportforIndia,ASEAN,Russia,Arabia,andAustralia
• Evangelisedcommunications/RFproducts
• Awarded‘ProofofConceptMachine’forbuildingPoCsresultinginUSD5million revenue
• AsApplicationsEngineer,received‘OutstandingPerformance’award
Abhishek Nag
English, Hindi, Gujarati
CFA Charterholder, CFA Institute, USA
CA, ICAI
B.Com., Sydenham College of Commerce & Economics, University of Mumbai
4 years 1 month of experience in Financial Services industry.
Deloitte Corporate Finance Services India Pvt. Ltd.: Deputy Manager - Transaction Services
• Perfomedfinancialduediligenceonacquisitioncompanies
• Identifiedsignificantdealissuespertainingtogrossmarginsandrevenuesaffecting valuation
• AssistedanIndianITcompanyinaUSD500millionacquisitionofBPOarmofaUS bank
• Managedteamsonmid-sizedtransactionsuptoUSD100million
• Developedjuniorstaffthroughon-the-jobtraining;mentoredtwosubordinates
Abhishek Satishkumar Rathi
English, Hindi
B.Tech. (Information Technology), NIT Allahabad
4 years 10 months of experience in IT (Products) industry.
Decho Technology India Pvt. Ltd.: Software Test Lead
• Madeauthorisationserverscalablefrom10,000to 1 million users
• Ledquickresponseteamandhelpedinimprovingcustomersatisfactionmetricsby over 30%
• HeadedMozymobileteam,releasedfirsteverversionofAndroidapplicationforthe product
Microsoft India R&D Pvt. Ltd.: Software Design Engineer in Test
• ReceivedanawardforcontributionsmadetowardsreleaseofVisualStudio2005
• LedsustainedengineeringforeVC++,aproductfordevelopingmobilephonebased applications
Achal Gupta
English, Hindi, Kannada, Tamil
B.E. (Electrical & Electronics), National Institute of Engineering,Mysore,VisvesvarayaTechnologicalUniversity
4 years 8 months of experience in Engineering industry.
Techmek Engineers Pvt. Ltd., Bangalore: Regional Head (Chennai)
• Managedfamilybusinessengagedinexecutionofwatersupplyandsanitary installation works
• StartedoperationsinChennaiandachievedINR45millionturnoverin3years
• OversawoperationsoftheBangaloreunit(120members)
Aditya Atreya
English, Hindi, Kashmiri
MS (Computer Engineering), L C Smith College of Engineering, Syracuse University
B.E. (Electronics & Telecommunications), Modern Education Society’s College of Engineering, University of Pune
4 years 9 months of experience in Manufacturing and IT (Products) industry.
Unitherm Engineers Ltd.: Business Development Manager
• AspartoftheCorporateManagementTeam,ledthestrategicplanningandbusiness development activities of the four companies within our Business Group
• Facilitatedgrowthinsalesby105%and165%fortwocompaniesoverthreequarters
Microsoft Corporation: Product Manager
• ManagedateamofProductManagerstoexecutepricing/licensingpoliciesfor product launches across the globe
• ConsultedwithBusinessGroupswithinMicrosofton117products/services launched
Aditya Bakshi
English, Hindi, Gujarati
MS (Computer Science), State University of New York, Stony Brook
B.E. (Computers), Thadomal Shahani Engineering College, University of Mumbai
4 years 2 months of experience in Investment Banking industry.
Goldman Sachs, New York: Analyst Developer
• DevelopedsoftwarecriticaltoGoldmanSachsproprietarytradingdeskformanaging risk and P&L in real-time
• Workedactivelywithtradersandportfoliomanagerstohelpthemmanageequity, credit, and interest rate exposures
• Implementedefficienttradeprocessingforimprovedpositionandriskmanagement
• Rated‘exceedingexpectations’foreachofthe4years,puttingmeinthetopbracket of my peer group
Aditya Shailesh Shah
English, Hindi, Marathi
B.E. (Electronics), Kavi Kulguru Institute of Technology & Science, Nagpur University
4 years 3 months of experience in Energy industry.
Kalki Communication Technologies: Assistant Manager
• BusinessDevelopmentleadforIndianUtilitiesand Public Sector companies
• AsBusinessDevelopmentlead,generatedsalesworthINR40millionforenterprise level energy software
• DevelopedsalesteamforINR500billioninitiativebyIndiangovernmentinpower sector
Areva T&D (India) Ltd.: Engineer - Software
• CommisioningEnergyManagementSystemforGeneralElectricCompanyofLibya, across the country
• TrainingcustomersinsoftwaretoolsatParisheadoffice
Aditya Sohony
English, Hindi
B.E. (Computer Technology), Yeshwantrao Chavan College of Engineering, Nagpur University
4 years 9 months of experience in IT (Products) industry.
Rhythm & Hues Studios India Ltd.: Lead Pipeline Support
• LedsoftwaredevelopmentteamsinIndiaandMalaysia
• Handledtechnologyrecruitmentandoutreachactivities.Invitedtospeakatanumber of Open Source and technology events across India
• Conductedsessionstopromoteawarenessoftechnologyinvisualeffectsamongst students and faculty members of various institutes
• DesignedseveralbusinesscriticalITsolutionsandsystems
• ExtensiveexperiencewithOpenSourcesoftware
Aditya Wasudeo
English, Hindi, French
B.E. (Hons.), Electronics and Instrumentation, BITS Pilani
5 years 9 months of experience in High Technology industry.
Texas Instruments (India) Pvt. Ltd.: Lead Engineer
• Youngestinthebusinessunittoleadateamand deliver an industry-leading wireless IP for European
mobile giants
• Mentoredagroupofengineersandbuiltamulti-functionalteamfordesigning customer critical components of a USD 100 million product
• Awardedcertificatesofexcellenceforbeatingcustomerstandardsofquality
• Createdanautomatedsystemenablinga10%powerefficiencyincreasein multimedia components of wireless devices
Aishwarya Singh
English, Hindi
B.A. (Economics), Kirori Mal College, University of Delhi
4 years 11 months of experience in Consulting industry.
McKinsey Knowledge Centre: Senior Research Analyst
• WorkedinMcKinseyclientteamsforPEand conglomerate clients on strategic due diligence
projects
• Ledanalystteamsonclientprojectsacrossdomains
• Managedanalystdevelopmentprogrammesfortheteam
• Workedwithtwostart-upteamsfocussedoncorporatefinanceandPEresearch
Akash Maheshwari
![Page 24: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/24.jpg)
46 47
English, Hindi, Tamil, Kannada, Urdu, French
B.E.(ElectricalandElectronics),SriVenkateswaraCollegeof Engineering, Anna University, Chennai
4 years 9 months of experience in Communications industry.
Sasken Communications Technologies Ltd.: Assistant Manager
• InternalandCorporateCommunications-GlobalStrategyandExecution
• Workedonemployeehistoryandcareerplanningsystem-‘TheGenePool’
• Changedmanagementcommunications-internalERPtransitionfromPeopleSoftto SAP
• Setupreal-timeorganisation‘Mood’meterandglobalrecognition‘VirtualMarbles’ tool
• ProfiledbyNASSCOM-CSRchamp-‘MakeaDifference’
• ProfiledbyEconomicTimes-‘GivingRaptheNativeTouch’
Al Ameen Sherfuddeen
English, Hindi, Telugu
MS (Electrical Engineering), University of Cincinnati
B.E. (Electronics), Walchand Institute of Technology, Shivaji University
5 years 2 months of experience in Electronics industry.
Emag Technologies, Inc.: Senior Research Engineer
• Designed,fabricatedandtestedMEMSandRadioFrequencycomponentsonsilicon and PCB
• PartofteamthatdevelopedcompactradarsystemforBoeinginunder6months
• ResponsibleforVendordevelopmentprogramme
Oerlikon USA: Applications Engineer
• Developedandoptimisedplasma-basedetchinganddepositionprocessesfor semiconductor materials
• UsedDesignofExperimentstoreducecustomers’costsby25%
Siloam Biosciences: Fabrication Engineer
• AwardedPatentforbloodseparationdeviceforlabonachip
Alok Jain
English, Hindi
B.A. (Hons.) (Economics), Hansraj College, University of Delhi
4 years 7 months of experience in Consulting industry.
S. R. Batliboi & Co. (member firm of Ernst & Young): Consultant
• Providedconsultingadvicetovariousmultinational clients on their global organisation structure from a tax efficiency and transfer pricing perspective
• Defendedclients’taxpracticesinfrontoftheIndianRevenueAuthorities;amount involved INR 2 billion
• ManagedthelargestGlobalTransferPricingprojectinIndiaspanningover 15 countries
AIESEC,India:VicePresident-Finance
• ResponsibleforplanningandallocatingannualbudgetofoverINR50million
• Ledteamsof14localoffices
• Institutedconsolidatedexternalauditpracticeforall14offices
Aman Raza Khan
English, Hindi
B.E. (Computer Science), Delhi College of Engineering, University of Delhi
4 years 9 months of experience in High Technology industry.
Mentor Graphics: Lead Member Technical Staff
• LedIndianteamtosupportnewHardwareDescription Language in ModelSim, a USD 150 million product
• Responsibilitiesincludeddefiningroadmaps,softwaredevelopmentandclient communication
• Developedanautomatedframeworkwhichimprovedteam’sproductivityby1.5x
UTStarcom India Telecom Pvt. Ltd.: Hardware Design Engineer
• Single-handedlymanageddevice-driverdevelopmentforHardwareTeam
Axiom Softech: Co-founder
• InnovatedResidentialWelfareAssociationManagementSystemandcreated advertising opportunities for local businesses by integrating SMS
• Developedfinancialandproductstrategiesforventure
Amit Dhingra
English, Hindi, Tamil
CFA, Cleared Level III, CFA Institute, USA
CA, ICAI
B.Com., University of Madras
4 years 2 months of experience in Financial Services industry.
Deloitte & Touche (M.E.): Audit Senior
• Ledteamsforduediligenceandbusinessplanreviewsacrosssectorsonbehalfof strategic clients
• AuditandanalysisoffinancialstatementsunderIFRS&USGAAP
• Co-editorofthemonthlynewsletter
• MemberofInjaz-amentorshipprogrammeforyoungArabentrepreneurs
Ernst & Young: Engagement Auditor
• Performedstatutoryandotherauditsandadvisedclientsoninternalcontrolissues
Anand Krishnakumar
English, Tamil
B.E. (Electrical and Electronics), PSG College of Technology, Bharathiar University
4 years 9 months of experience in IT (Products) industry.
Robert Bosch Engineering and Business Solutions Ltd.: Senior Software Engineer
• Createddesigncompetencyintheteamforelectroniccontrolofautomobiles resulting in revenue growth
• Improvedtheoperationalefficiencyoftheteam,indevelopmentofelectronic controls, by 80%
• YoungesttraineratElectronicEngineControlsBusinessUnit(600associates)
• Awarded‘OutstandingPerformer’twice,awardedtotop4%
Infosys Technologies Ltd.: Software Engineer
• Topperofthetrainingbatch
Anand Ramani
English, Hindi, Marathi
Master of Management Studies, MET Institute of Mangement, University of Mumbai
B.Com., R A Podar College of Commerce and Economics, University of Mumbai
5 years 4 months of experience in Marketing & Advertising industry.
Asian Paints (India) Ltd.: Media Manager
• ReducedConsumerActivationprojectcostsby30%byintroducingcompetitive bidding among vendors
• Conceptualiseda6-cityradiocampaignwithaimofcreatingbuzzamongconsumers
Mindshare: Activation Planner
• Manageda5-cityproducteffectivenessdemonstrationexerciseforDomex,across multiple consumer touch points
FCB Ulka Advertising Pvt. Ltd.: Senior Media Executive
• ImprovedcostefficienciesofTVplansby20%foratelecomclient
• TrainednewrecruitsinservicinganFMCGclientattheBangaloreoffice
Anil Ananth Prabhu
English, Kannada, Tamil
B.E. (Chemical Engineering), B M S College of Engineering Bangalore,VisvesvarayaTechnologicalUniversity
4 years 6 months of experience in IT (Services) industry.
Infosys Technologies Ltd.: Senior Systems Engineer
• Providedend-to-endcustomersupportforapplications in Insurance and Commodity trading
• Spearheadedthecreationofknowledgerepositoriesandextensivetrainingmodules for customer applications
• Performedclientliaison,managementreportingandapplicationcustomisation
• Conferredwith‘OutstandingPerformance’award
Anisha Krishnan
English, Hindi, Spanish
MS (Computer Science), Centre for Advanced Computer Studies, University of Louisiana - Lafayette
B.E. (Mechanical Engineering), Regional Engineering College, Silchar
5 years 9 months of experience in Investment Banking industry.
Morgan Stanley: Associate, Equity Derivatives Division
• Ledateamtoprovideriskmanagementcapabilityforequityderivativestrading teams globally
• Interfacedwithglobalbusinessunitsanddevelopedprojectroadmapsbycollating diverse requirements
• Developedanimpactmonitoringapplicationforfirm’smarketpositionsunderhigh volatility
Fidelity National Information Services: Developer Analyst II
• Ledateamtoprovideinternetbankingsolutiontobank’scustomersglobally
• Developedandmaintainedanti-moneylaunderingapplicationincollaborationwith the auditors
Anjani Bansal
English, Hindi, Gujarati
CFA, Cleared Level III, CFA Institute, USA
CA, ICAI India
B.Com., H R College of Commerce & Economics, University of Mumbai
5 years 2 months of experience in Investment Banking industry.
PrimeSecuritiesLtd.:VP-CorporateFinance
• IndependentlyoriginatedandexecutedtransactionsintheCorporateFinance domain
• WorkedacrossverticalssuchasPE,M&A,ECM,andDebtSyndication
• RaisedINR330billiondebtforaCDRcompany
• JointlyclosedoutaPEtransactionraisingUSD225millionforaclientintheTextile Space
B.V.Patel&Co.Taxconsultants:Associate
• Auditingofcompaniesintheprivateandlistedspace
• RepresentedclientsinappellatemattersbeforeITOs
Ankit Bharat Patel
English, Hindi, Punjabi, Gujarati
CFA, Cleared Level II, CFA Institute, USA
BS (High Hons.) (Biotechnology), Cook College, New Brunswick, Rutgers University
4 years 6 months of experience in Healthcare industry.
AIM Human Health Services: Manager
• Managedworkingcapital,payables/receivables,reduceddaysinreceivable
• Preparedquarterlyandannualfinancialstatementsanalysis
• Ledmaximumawarded3-yearCARF(CouncilonAccreditationofRehabFacilities) Accreditation, electronic medical record implementation reducing costs 10%, Medicaid non-billable hours 85%
eClinicalworks, LLC.: Implementation Consultant
• ImplementedEMRatphysicians’officesandhospitalsacrosstheU.S.,improving revenue management, efficiency, streamlining processes
Adecco Employment Services: Research Assistant
• Scientificexperimentsandtrendanalysesfortoothpasteproductdevelopmentat Colgate-Palmolive
Ankit Gupta
English, Hindi
Dual Degree - B.Tech. and M.Tech. (Electrical Engineering, Signal Processing), IIT Bombay
4 years 7 months of experience in IT (Products) industry.
Adobe Systems India Pvt. Ltd.: Computer Scientist
• Revampedadefunctteamintoproductteamthatis expected to save USD 10 million annually
• Developedproprietarymediacontainerformatstandard
• Createdactiveclientengagementprocesstosecureandanalyseregularclient feedback
• Transformteamculturefromadhoc,internalgoalsdriventocustomerbased management
• Conferredwith‘SPOT’awardforexceptionalinitiatives
Nvidia Graphics Pvt. Ltd.: Software Engineer
• Developednewcross-functionalalgorithmimprovingvideoperformanceon multimedia products by 10%
Ankit Kumar Mehra
![Page 25: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/25.jpg)
48 49
English, Hindi
BBS, Shaheed Sukhdev College of Business Studies, University of Delhi
4 years 10 months of experience in Investment Banking industry.
Indcap Advisors Pvt. Ltd.: Senior Associate
• Assistedindealorigination,dealexecutionand negotiations
• Preparedpitchbooks,informationmemorandaandfinancialmodels
Evalueserve.com Pvt. Ltd.: Senior Business Analyst
• Financialmodelingandvaluationusingrelativevaluation,DCFandSOTP
• Preparedresearchnotesforsellsideclients(Telecom&Media)
• ManagedapilotprojectandwonUSD250,000contract
• Received‘Quality&Productivity’award
P.N.VijayFinancialServicesPvt.Ltd.:AssistantManager
• Assistedinportfoliomonitoring
• Identifiednewstocksandmonitoredexistingstocks
Ankur Gulati
English, Hindi
B.E.(Mechanical),SriVenkateswaraCollegeofEngineering, Anna University
4 years 9 months of experience in Manufacturing industry.
Gypcrete Building India Ltd.: Director (Operations)
• CommercialisedanAustralianGreenBuilding Technology in India
• Businessdevelopmenteffortscontributing30%ofthefirm’srevenues
• Ledacross-functionalteamof35tosetupaUSD6millionplant
• WorkedwithgypsumindustryleaderstodevelopproductsfortheSpecialPlasters market
• Developednewlowcostwallingproductstotargetaffordablehousingmarket
Caterpillar Power India Pvt. Ltd.: Manufacturing Specialist
• 6Sigmaprojectlead
• DeploymentofCaterpillarProductionSystemacrossfunctions
Ankur Gupta
English, Hindi, Malayalam, Tamil
B.E. (Electrical and Electronics), Amrita School of Engineering, Coimbatore, Anna University
4 years 7 months of experience in IT (Services) industry.
Mercedes Benz R&D India (MBRDI): Senior Analyst
• InformationSecurityConsultingforallinternalDaimler units across the globe
• SetupandmanagedbusinessforApplicationSecurityandEthicalHacking
• ResponsibleforIndiadivisionroll-outofApplicationSecurityinSoftwareDevelopment Life-Cycle of Daimler
Wipro Technologies: Associate Consultant
• ApplicationsecurityconsultingandteamleadforaBFSImajor
• BusinessDevelopmentactivitiesthroughpre-sales
• ProgressedfromProjectEngineertoSpecialistfurthertoAssociateConsultantin 3.5 years (faster than peers)
Anoop Gopikumar
English, Hindi
B.Com. (Hons.), Hansraj College, University of Delhi
4 years 9 months of experience in Management Research industry.
A T Kearney: Team Leader
• Managedateamwhichcateredtoinformation requirements for communication and hi-tech projects,
conducting market analysis and competitive intelligence
• Identifiedpotentialopportunitiesinknowledgeprocessoutsourcing,eventually shared with the top management for strategic decision-making
Copal Partners: Senior Associate
• Ledateamof12analysts,managingprojectsforclientsininvestmentbankingand equity research
• Won3pilotsaddingUSD1.5milliontorevenue
• Salvagedprojectswhichwereexperiencingqualityissues
Anshul Sachdev
English, Hindi
B.Tech. (Electronics & Communication), NIT Hamirpur
5 years 6 months of experience in IT (Services) industry.
Infosys Technologies Ltd.: Technology Lead
• LedtheteamintheimplementationofDrilling& Measurement project for Schlumberger
• AwardedwithexcellenceawardforQ2-2009
Merrill Lynch (India) Technology Services: Associate Consultant
• Instrumentalinautomatingtheworkflowofloanservicingdepartment
• MigratedoldlegacySuperRapidFundingsolutiontonewdistributableweb framework
• Awardedwiththe‘OutstandingIndividualAchievementAward’forQ1-2008
Polaris Software Labs: Technology Engineer
• DevelopedLiquidityMonitoringSystem,aweb-basedsolution
Anurag Sambyal
English, Hindi
B.E. (Hons.) (Chemical), Department of Chemical Engineering & Technology, Panjab University
4 years 9 months of experience in Energy industry.
Baker Hughes Singapore Pte (Baker Atlas): Field Engineer
• Planningandexecutionofwellsitewirelineoperations; responsibleforcrewandequipment(valueUSD>2
million)
• LeadEngineer&‘On-location’focalpointforclients(Shell,Petronas,Reliance,Cairn, NAMCOR & ONGC)
• Workedacrossgeographiesinremotelocations-Malaysia,AfricaandIndia
• CoreValueawardforcontributiontocriticalfieldoperations
• Optimisedrigtimeutilisationtoexpediteoperations(received‘Lettersof Appreciation’ from client)
Anveshan Chaudhary
English, Hindi, Kannada, Telugu
MS (Electrical Engineering), Louisiana Tech University, USA
B.E. (Electronics and Communications), S D M College of Engineering,VisvesvarayaTechnologicalUniversity
4 years 5 months of experience in Telecommunications industry.
QualComm Inc.: Engineer
• Developedanenhancementforvideostreamingapplication
• Broughtdownbugcountleveltozeroinapplicationsforclients
Advanced Micro Devices (AMD): Software Engineer Level 2
• GotpatentsapprovedforChannelZappinginMobileTVTechnology
• Createdanintegratedhardwareandsoftwareplatformformobilehandsets
Wipro Technologies: Project Engineer
• CreatedaCentreofExcellenceforDigitalSignalProcessing-Commgroupand developed Intellectual Property for Wimax Technology
Polycom: Consultant - Software Engineer
• DevelopedUserInterfacefunctionalitiesforteleconferencingproducts
Apoorva Kakkeri
English, Hindi, French, Italian
CFA, Level I, CFA Institute, USA
B.E. (Information Technology), BIT Mesra
4 years 9 months of experience in IT (Products) industry.
Oracle India Pvt. Ltd.: Project Lead (ERP Development)
• Ledateamofsixanddevelopedthetwomost extensively used features of Oracle Financials applications for Fusion ERP
• FusionfeaturesdemonstratedtopotentialcustomersatOracleOpenWorld2008
• LedReceivablesdevelopmentteaminsupportingsixgoldcustomerswiththeir Oracle Release 12 ERP implementations
• AwardedCertificateofExcellencebyGroupVicePresident
• Developedprocessesforreverseengineering;logisticsforpatentfilingunderreview
Arnab Kumar
English, Hindi, Elementary Chinese
B.E. (Electronics & Communications), Manipal Institute of Technology, Manipal Academy of Higher Education
4 years 7 months of experience in Construction and Semiconductor industry.
Sangeeta Exzim Pvt. Ltd.: Director
• Startedmyentrepreneurialventureinconstruction industry
• Tappednewmarketsforsoil-stabilisingpolymertoexceedthesalestargetby50%
• NegotiatedanorderworthUSD200,000fromReliance-ADAG
• ConvincedtheMinistryofSurfaceTransporttoexpediteourproductsapproval process
STMicroelectronics Pvt. Ltd.: Design Engineer - I (FTM/ R&D)
• Innovatedawaytodesignschematics,saving33%design-time
• Co-ordinatedbetweenteamstoreducethebug-resolutiontimeby10%
• Streamlinedthegroupsprojectmanagementpractices
Arpit Goyal
English, Hindi
BBS, Shaheed Sukhdev College of Business Studies, University of Delhi
4 years 9 months of experience in Real Estate industry.
JonesLangLasallePropertyConsultants(India)Pvt.Ltd.:Assistant Manager (Markets & Corporate Solutions)
• Managedglobalandregionalaccounts(Accenture,BankAM,SunMicrosystems)of the firm
• StrategisedpanIndiarealestateportfoliosofcompanies(Microsoft)
• Workedwithrealestatedevelopers(DIAL)toraisefundsfortherealestateprojects
• WorkedwithrealestatePEfundsoninvestments
• Hadwonafewaccounts(STMicroelectronics,Capital)
Capital IQ Inc.: Research Analyst
• Trackingandevaluatingalltheprivateequitytransactionsconcludedglobally
Arun Kawatra
English, Hindi, Tamil, Malay
MS (Manufacturing Systems), Nanyang Technological University
M.E. (Mechanical Engineering), National University of Singapore
B.E. (Mechanical Engineering), National University of Singapore
4 years 8 months of experience in Electronics industry.
Siltronics Samsung Wafer Pte Ltd.: Senior Engineer
• PartofthepioneeringteamtoestablishthenewUSD1billionwafermanufacturing facility
• Implementedandmanagedthemostcomplexandbottleneckprocessofthehigh volume wafer production plant
Micron Semiconductor Asia Pte Ltd.: Process Engineer
• Responsibleforprocesscontrolof3processesnamelyPCBAsingulation,BGAX-ray and PCBA rework
Ashiqul Hameed Rawther
English, Hindi
B.Tech. (Computer Science), MMM Engineering College, Uttar Pradesh Technical University
5 years 6 months of experience in IT (Services) industry.
NASSCOM Foundation: Project Officer
• Conceived,designedandimplementedConnectIT programme
• E-governanceprojectforGOM
apnaIT (incubated by Deshpande Foundation): Social Entrepreneur (CEO)
• Ledateamof22,providingsolutionstononprofits,schoolsandcolleges
• PartneredwithGoogleCSRtoinfluencemorethan80nonprofitorganisations adopt IT
• TaughtITskillsto60socialentrepreneurs
• LedanRTImovement;authoredabookonRTI
Tata Consultancy Services Ltd.: Quality Assurance Lead (Enterprise storage)
• Ledqualityassuranceteam
• SuggestionsoninternalrestructuringimplementedbyCTO
Ashutosh Pratap Singh
![Page 26: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/26.jpg)
50 51
English, Hindi
B.A. (Economics), St. Xavier’s College, University of Mumbai
5 years 2 months of experience in Financial Services industry.
Yrals: Business Head/ Partner
• Partneredastartupandinitiatedstrategiesthat generated revenue worth INR 3 million in a short span
Mecklai Financial and Commercial Services: Senior Analyst
• AssistedcompaniesinmanagingtheirtreasuryoperationsworthoverUSD400 million
• Advisedcompaniesonforexderivativesandcomplextradingstrategies
• HelpedclientsmanagetheirECBandFCCBportfolio
Citibank NA: Executive
• ManagedequityinvestmentsforHNIclients
Man Financials: Analyst
• TradedinForexandcommoditiesforIndianandAsianclients
MatrixClothing:JuniorExecutive
• CreatedresearchreportsonentryintoEuropeanmarkets
Ashutosh Singh
English, Hindi, Kannada, Telugu
B.E. (Information Science), National Institute of Engineering,Mysore,VisvesvarayaTechnologicalUniversity
4 years 9 months of experience in Non-Profit & NGO industry.
Divyadeepa Trust: Director Strategy and Fund Raising
• Builtandmanagedacoreteamof6
• Conceptualisedsustainablemodelforvolunteering,developedpartnershipswith various colleges. Also Involved in media campaigns
• EventManagerforMysooruUnplugged(http://mysooruunplugged.info)
• FoundedTeesForChange(http://teesforchange.info),asocialventuretosustain non-profits
• RaisedINR10million
JuniperNetworksFoundationFund:SocialEntrepreneur
• Ledateamof3toimplementCSRprojects
• ManagedUSD600,000funding
Ashwin Gopala Krishna Shetty
English, Hindi
CA, ICAI
B.Com. (Hons.), St. Xavier’s College, University of Calcutta
4 years 4 months of experience in Financial Services industry.
Kotak Securities Ltd.: Financial Analyst
• WorkedasanEquityResearchAnalyst(diversified mid-caps) covering more than ten companies across sectors
• Presentedinvestmentanalysistoleadingglobalinstitutionalinvestors
• Responsibleforindependentlyauthoringresearchreportsinjust1.5years,against industry average of 3-4 years
Morgan Stanley Advantage Services Pvt. Ltd.: Associate
• WorkedaspartoftheBasicMaterialGroup(InvestmentBankingDivision)
• Supportedglobalteamsinmakingpitchbooks,valuationmodelsandindustry analysis
Augustya Keshav Somani
English, Hindi, Bhojpuri
B.Tech. (Petroleum Engineering), ISM Dhanbad
4 years 9 months of experience in Energy industry.
Cairn India Ltd.: Senior Petroleum Engineer
• IncreasedthepotentialofKGgasfieldsatelliteby15%, got an out-of-turn promotion for the same
• Deliveredthefirstphaseofdigitaloilfieldprojectin Rajasthan
• Implementedaprocessincreasingtheproductionofanoilfieldby15%
• Preparedproductionforecastsforbusinessplan
Reliance Industries Ltd. (Petroleum Business): Reservoir Engineer
• MonitoredJVactivitiesforBlock-9assetinYemen
• PartofdelegationvisitingYemenforbusinessdevelopment
Avinash Kumar
English, Hindi, Bengali
B.E. (Electronics & Communications), CMR Institute of Technology,VisvesvarayaTechnologicalUniversity
4 years 5 months of experience in IT (Services) industry.
Infosys Technologies Ltd.: Technical Analyst
• Involvedinpre-salestobagaUSD150,000project
• Leada10memberteamacross3continentsforaglobalapplication
• BusinessIntegrationprojectforKraftbymigratingtheirnativeapplicationsintoSAP ERP
• AsKManchor,developedaknowledgeportal
• CertificateofAppreciationbyKraftCIOforimplementationin68countries
• WinnerofBestProjectAwardandconsistenthighfeedbackratingsfromclients
Avishek Chandra
English, Hindi, Telugu
B.Tech. (Electronics and Communications), Indur Institute ofEngineeringandTechnology,JNTUHyderabad
4 years 2 months of experience in IT (Products) industry.
Honeywell Technology Solutions Pvt. Ltd.: Senior Engineer
• ExtensiveexperienceinIntellectualProperty Management
• EstablishedanewbusinessdomainforAircraftCabinManagementSystemsinIndia
• OnsiteCo-ordinatoratPhoenix,USAforAircraftDiagnosticsandMaintenance Systems portfolio for the world’s largest aircraft manufacturer
• Ledteamsresponsibleforimprovingrealtimesystemperformancemeasurement accuracy in aircarft
• Won‘PartnerAward’and‘IndividualExcellenceAward’forperformanceexcellence
Bharath Bhushan Aitha
English, Tamil
CWA, ICWAI
B.Com.,SrimathiDNBhattVaishnavCollegeforWomen,University of Madras
4 years 3 months of experience in FMCG and IT (Services) industry.
ITC Ltd.: Assistant Manager - Finance
• ResourcemanagementandvendormanagementforsupplychainworthINR400 million
• Productcosting,contributionmanagementandcorememberof‘Planningand Budgeting’ team
• IndependentvendorauditorforbusinessworthINR250million
• Assistedailingmicroenterprisesturnaround,resultinginemploymentgenerationfor rural women
Tata Consultancy Services Ltd.: Trainee - Process Associate
• Co-ordinatorformonthlymanagementpresentationofbusinessverticals
• Responsibleforteam’squalityassurance
• Laiddowndocumentmanagementsystems
Bhargavi V
English, Spanish, Italian, French
M.E. (Computer Science), Universidad of Zaragoza, Spain
B.E. (Computer Science), Universidad of Zaragoza, Spain
4 years 3 months of experience in Aerospace industry.
Indra Sistemas Madrid (Spain): International Consultant - Air Traffic Management (ATM)
• CompilationandinterpretationofCompetitiveIntelligenceDatafortheATMmarket
• Highinvolvementinpricingproceduresofprojects
• ParticipationinthedesignofthemarketingcampaignandmerchandiseforATM products worldwide
Embassy of Spain Tel Aviv (Israel): Associate
• Workedfor1yearintheEconomicandCommercialOfficethroughanICEX scholarship (Spanish Government Foreign Trade Agency)
Carlos Albert
English, Hindi
BMS, H R College of Commerce & Economics, University of Mumbai
4 years 1 month of experience in Investment Banking and Private Equity industry.
AavishkaarVentureManagementServices:ProjectAssociate
• Createdthepitchforinvestorsforsecondmicrofinancefund
• Evaluatedthesocialandenvironmentalperformanceofthemicroequityfund
• Completedaninvestmentinastartupmicrofinanceinstitution
JPMorganChase:Analyst
• Createdamodelforaccountinganalysisintheconsumerandretailspace
• Publishedthreecreditratiohandbooks,ahighyieldcreditreportandservices handbook
• Thesectorteamwasranked#1by‘InstitutionalInvestor,EMEA2008’
Chandini Hundalani
English, Hindi, Tamil
MS (Mechanical Engineering), University of California, Santa Barbara
B.Tech. (Mechanical Engineering), IIT Madras
4 years 5 months of experience in Electronics industry.
GE India Technology Centre Pvt. Ltd.: Research Engineer
• Experienceininitiatingandleadingshort-termandlong-termresearchprogrammes
• Ledamulti-disciplinaryresearchteamtowardsdevelopingnextgeneration locomotive engine control systems - a USD 300,000 research programme
• Twopatentsfiledintheareaofmagneticrefrigeration-newcompressorfree technology
• Wonthebestrookieawardforoverallperformance
• Writtenforleadingscientificandindustryjournals
Chandrasekhar Samiappan
English, Hindi, Bengali, Punjabi
The International Economy and Business, Harvard University
PGPM (Finance & Marketing), Goa Insititute of Management
B.Com., Sydenham College of Commerce & Economics, University of Mumbai
5 years 5 months of experience in Corporate Banking industry.
Unitus Capital Pvt. Ltd.: Consultant
• StrategyandCapitalRaiseConsultingtomaximisesocialimpactacrossAsia
• ConductedscopestudyonmicrofinanceinChinaandadvisedoptimalentrystrategy
INGVysyaBankLtd.:AssistantVicePresident
• ConducteddetailedcreditanalysisforRiskapprovalsandensuredsmoothexecution
• ImplementedING’slargesttransaction(2008)withinchallengingdeadlines
• LedateamtobagandexecuteAsia-Pacific’s‘DealoftheMonth’
• Chosenforfast-trackgrowthandpromotedtoING’syoungestAVP
Charulata Singal
English, Hindi
B.Tech. (Chemical Engineering), IIT Bombay
4 years 11 months of experience in Consumer Products industry.
Cadbury India Ltd.: Manager - Process
• Schedulingandensuringtimelycompletionof‘Cadbury Silk’ and ‘Perk Glucose’ launch activities
• Designedandcommissionedmanufacturingprocessesfornewproducts
• Evaluatedoftechnologyoptionsthroughexperimentationandvendorinteraction
• Increasedcrumbproductioncapacityby40%throughinnovation
Asian Paints (India) Ltd.: Manager Production
• Ledateamofover50peopleinresin(paintintermediate)productionunit
• Highestproductionofresintomeetmarketdemand
• ImplementedLeanmanufacturingprocesses
Chinmay Joshi
![Page 27: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/27.jpg)
52 53
English, Hindi
BBA, Birla Institute of Technology, Noida Campus
4 years 6 months of experience in Marketing & Advertising industry.
Genesis Colors Pvt. Ltd.: Manager - Marketing & Corporate Communications
• Formulatedandimplementedmarketingplansfor7 brandsincludingCanali,JimmyChooandPaulSmith
• Managedsalesandbrandpromotionactivities
• OversawCRM,creativedesigningandbrandcollateralteams
• Partofthecoreluxurymarketingmanagementteam
Perfect Relations Pvt. Ltd.: Associate Image Manager
• Handledmediacommunicationof8accounts
• Createdmarcomplans
• Businessdevelopmentfornewclients
• PartofteamselectednationallytomanageInternationalFilmFestivalofIndia-2006
Chirag Rakshit
English
BS (Biological Engineering), Cornell University
4 years of experience in Engineering industry.
MWH Americas, Inc.: Professional Environmental Engineer
• WroteaHydroelectricFeasibilityStudyforUSA’s largest supplier of treated water for 16 different sites and recommended 4 sites to be designed based on
client’s 15 year break-even limit
• DesignedtwoRecycledWaterPreliminaryDesignReports,saving25%ofcostsand serving 2,000 households
• Spokeatthe2009BreckenridgeConferenceonthetopicofdeliveringsolarenergy into a conventional project
Christopher Devon Garnic
English, Hindi, Marathi
CA, ICAI
B.Com., M L Dahanukar College of Commerce, University of Mumbai
5 years 2 months of experience in Consulting industry.
Mindspring Advisors Pvt. Ltd.: Consultant
• M&AAdvisoryforSMEclientsacrosssectors
Ernst & Young India Pvt. Ltd.: Senior Associate
• TransactionAdvisoryservicesacrosssectors;dealsuptoUSD600million
• TeamLeadfor2duediligence(FacilityManagementServices&RoadProjects)for ICICIVentures
PricewaterhouseCoopers: Senior Associate
• M&AAdvisoryservicestoleadingglobal/Indianclientsincludingstrategicbuyers and private equity
• Workedoncrossborderdeals(reviewofaEuropeanchemicalcompanyfor acquisition by Indian company)
Deepa Prakash Kelkar
English, Hindi, Punjabi
B.E. (Computer Science), Thapar University
5 years 8 months of experience in IT (Products) industry.
Aricent: Senior Software Engineer
• Ledateamof5forintegration,testinganddeployment of Aricent Proprietary Test Tools
• DesignedandDevelopedsoftwaresolutionsforvoiceappliancesandVSATterminal devices
• HandledQualityAssuranceofsoftwaresolutions
• ReceivedBestCustomerSatisfactionRatingatHughesNetworkSystems
Siemens Information Systems Ltd.: Senior Systems Engineer
• Designedanddevelopedvalueaddedservicesformobileoperators
• Implementedandtestedsoftwaresolutions
• Receivedmeritrewardforsuccessfulimplementationofaflagshipproject
Deepti Gupta
English, Hindi, Bengali, Russian
B.Tech. (Electronics and Communication), Guru Tegh Bahadur Institute of Technology, Guru Gobind Singh Indraprastha University, Delhi
5 years 9 months of experience in IT (Services) industry.
Column Technologies: Business Analyst - Business Development
• HandlednorthIndiaregionforsales,technicalconsultingandnewbusiness development
• Closeddealson2accountsworthUSD200,000
• Representedthecompanyatindustryforumsandmarketingevents
• Representedcompanyasspeakeringlobal‘UserWorld’meetinSydney,Australia February 2009
Wipro Technologies: Technical Trainer - Remedy
• Certifiedtrainerin5modules,conductingtrainingacross8countries
Hewitt Associates: Senior Support Engineer
• WorkedincoreProductDevelopmentteam
Deepti Sen
English, Hindi, Gujarati
B.E. (Electronics & Communications), Dharmsinh Desai Institute of Technology, Dharmsinh Desai University
4 years 9 months of experience in Telecommunications industry.
Agilent Technologies: Application Engineer
• Conductedpapersontechnologyandsolutionsat strategic marketing seminars to leverage sales
• Consultancyforbestpracticesandsolutionsfortestingwirelessdevices
• Collectedmarketintelligencefromcustomersandprovidedfeedbacktotheproduct R&D team
Nokia India: Transmission Planning Engineer
• Improvedtransmissionnetworkavailabilityby12.5%in2months
• SpecialAwardforrelief-workduringSuratfloodsin2006
Fascel Ltd. (Hutch): Graduate Engineer Trainee
• DevelopedSiteFolderApplicationformonitoringBSSNetworkElements
Dhaval Shah
English, Hindi, Bengali, Italian
BBA, Bocconi University
4 years 6 months of experience in Sports industry.
IOS Sports & Entertainment: Manager, Business Development
• Led negotiations for a stake sale to PE companies
Katha: Manager, Funding & Business Development
• Managed payroll giving programmes with Unilever and IBM
• Managed the Teach India campaign
D. E. Shaw & Co.: Associate, Resource Development
• Headed a project to analyse PE firms in the Middle East
IOS Sports & Entertainment: Manager, Marketing & Business Development
• Forged a strategic partnership with OSIAN’s for acquiring and managing a football club
• Negotiated a strategic partnership with Adidas
• Marketed the Women’s Boxing World Cup 2006
Dipra Mukhopadhyay
English, Hindi, Sindhi
B.Com. (Hons.), Shaheed Bhagat Singh College, University of Delhi
4 years 6 months of experience in Consulting industry.
Hewitt Associates: Associate
• ResponsibleforexecutionofHRconsultingprojects in space of Manpower Planning, Total Rewards and
Compensation Benchmarking
• BusinessdevelopmentinMiddle-EastforHRconsultingservices
• ResponsiblefordesignandimplementationofExpressionofInterest(EoI)based staffing system
• Consistentaboveaverageperformanceratinginallevaluations
• AttainedthelevelofaJuniorConsultantwithinoneyearofservice
Divya Gianchandani
English, Hindi
B.Tech. (Civil), IIT Roorkee
4 years 9 months of experience in KPO industry.
Evalueserve.com Pvt. Ltd.: Manager
• RegisteredPatentAgentwithIndianPatentOffice
• Ledateamof20professionals,byprovidingtechnical and legal guidance in Intellectual Property
• Managedtrainingplanandorganisedtrainingsessionsforteammembersandnew recruits
• Received‘BestEmployee’certificateinIP(2006)fromtheglobalCOO
• Won‘BestTeam’awardinIP(2008)
• WonFirstprizeinacompany-wideonlineIP-LegalQuiz(2009)
Eaishvarya Sharma
English, Hindi
B.A. (Hons.) (Economics), Delhi College of Arts & Commerce, University of Delhi
5 years 3 months of experience in Marketing & Advertising industry.
Draft FCB Ulka Advertising Pvt. Ltd.: Senior Account Executive
• HandledWhirlpoolaccount-corporateandrefrigerator;ranDiwalicampaigns (4 years) and DC refrigerator campaigns (2 years)
• Conceptualisedandexecutedaleadgenerationcampaignforaspecifictarget segment(marriedwomen>25years)
Membrane Creative Pvt. Ltd.: Partner Director
• AcquiredthecontractfromTulipsoftware(INR0.3million)
• FirstyearturnoverINR1.5million
DentsuMarcomPvt.Ltd.:JuniorAccountExecutive
• HandledthelaunchcampaignofHondaUnicorn(worthINR120million)
• Competitivemotorcyclemarketanalysis
Gaurabh Gulshan
English, Hindi
Master of Public Health, School of Public Health, Boston University
MBBS, R N T Medical College, University of Rajasthan
4 years of experience in Pharmaceuticals and Healthcare industry.
Torrent Pharmaceuticals Ltd.: Manager-1
• DesignedandconductedclinicaltrialsforPhase1andPhase2ofdrugdiscovery
• Assessedmarketpotentialandtherapeuticpositioningofnewmolecules
Boston University, School of Public Health: Research Assistant
• AppliedhealthoutcomesresearchfundamentalsinQualityofcarestudy
• DesignedQuestionnairesforQualityofcarestudyforepilepsypatients
• ConductedresearchstudiesonHIVpatientsandPublicHealthintheUSA
All India Institute of Medical Sciences: Physician
• ManagedOPDsandwardsforMedicine,PaediatricsandGynaecology
Gaurav Chaturvedi
English, Hindi
CA, ICAI
B.Com. (Hons.), Shri Ram College of Commerce, University of Delhi
4 years of experience in Accounting industry.
BSR & Co (member firm of KPMG): Assistant Manager
• Diversedomains(power,telecom,advertising,luxury brand retailing, FMCG, software)
• DealingwithIFRS,USGAAP,UKGAAP,SOX
• SecondedtoKPMGLLP,UK;workedintheirFinancialServicesdivision(Towergate Insurance, HBoS, Prudential Group)
• Diverseclients(manufacturing,service,privateequity,trading,banks,insurance)
• Ledauditteams(4to15members);workedonprocessanalysisandriskassessments
• IPOworkasperSEBIguidelines
Gaurav Nayyar
![Page 28: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/28.jpg)
54 55
English, Hindi, Punjabi
Master of Technological Design, (Mechanical Engineering) National University of Singapore
B.E. (Mechanical Engineering), Osmania University, Hyderabad
5 years 5 months of experience in Engineering industry.
Hewlett-Packard (Singapore) Pvt. Ltd.: Specialist Manufacturing Development Engineer
• AsProgramLead,managedakeynewproductintroductionproject
• KeycontributortoHP’soverallmanufacturingstrategyforlarge-formatprinter manufacturing in Asia
• Leddesignactivitiesforvariousmanufacturingsystems
Mikrotools Pvt. Ltd.: Product Engineer
• ManagedProductDevelopmentformicro-machiningtools
• Createdcompany’sfirstproductlineup
• Achieved10%manufacturingcost-reduction
• ContributedtoUSD100,000sales
Gurpreet Singh Bedi
English, Hindi, Punjabi
B.Tech. (Hons.) (Electrical), Guru Nanak Dev Engineering College, Punjab Technical University
4 years 8 months of experience in Energy industry.
NTPC Ltd.: Senior Engineer
• ResponsibleforElectricaldivision(40members)ofthe power plant (USD 1.5 billion)
• Supply-chainrestructuring,planningofsparesandservicesworthINR20million
• Techno-commercialprojectappraisalandmanagementformultimillionrenovation projects
• Processowner-ERP,CDM,QMS;Riskevaluationandprioritisation
• LedprocessimprovementandenergyefficiencyprojectsEnergyManagement System reduced APC by 0.5%
• PowerMinisterAward-BestTraineeoutof570
Harpreet Kaur
English, Hindi, Marathi, Bengali
B.E.(ComputerScience),BharatiVidyapeeth’sCollegeofEngineering, University of Pune
5 years 6 months of experience in IT (Products and Services) industry.
Sumtotal Systems India Pvt. Ltd.: Senior Software Design Engineer
• Ledateamof5toconceptualise,developandlaunchanewtalentmanagementtool targeting SMEs
• LedR&DSustenanceEngineeringGroupforcustomerissuemanagement
• Won2customerawardsforexcellenceinachievingcustomerdelight
Infosys Technologies Ltd.: Programmer Analyst
• Delivered3marketingprojectsworthUSD1.2millionasanOnsiteConsultantfor USA’s largest shoe-retailer
• Partofpre-salesteamforEuropeanretailers
• PresidentofDot-NetCoEatHyderabad
Harshika Sarbajna
English, Hindi, Gujarati, Urdu
CFA, Cleared Level I, CFA Institute, USA
B.Tech. (Engineering Physics), IIT Delhi
4 years 10 months of experience in Manufacturing and Service industry.
GE India Technology Centre Pvt. Ltd.: Research Intellectual Property Professional
• Identifiedopportunities(USD10million)anddevelopedprogrammesfor commercialisation of GE’s technology portfolios
• AwardedthricebyGELeadershipfor‘Excellence’and‘Expertise’
• ProcessimprovementeffortsthroughSixSigmaandLeanmethodologies
Pangea3 LLC.: Assistant Manager, Intellectual Property
• Added10+clients,recruitedandmentored15+Specialists,improvedproject profitabilityby~30%.
• Managedprofitabilitymetrics,resourceplanningandperformanceevaluationforthe IPdivision(70+employees)
XL Dynamics (India) Pvt. Ltd.: Associate Business Analyst (Mortgage products)
• SelectedfortheManagementDevelopmentProgramme
Hozefa Abbas
English, Hindi, Punjabi, Tamil, Gujarati
PGDM, Kirloskar Institute of Advanced Management Studies
BBA (Hons.), Madras School of Management Sciences, University of Lincoln
5 years 11 months of experience in Consulting, Education and IT industries.
Triumphant Institute of Management Education: Senior Manager
• Identifybusinessopportunitiesanddevelopbusinessplans
• Conceivedandimplementedthebranding/marketingplansfortheSchool’sventure
• Developeda‘pay-for-performance’modelforthePublicRelationsAgency
• Overhauledcoursewareandmethodologiesforthecourse
• Designedprogrammes/modulesforcustomisedtraining
Equitor Management Consulting Pvt. Ltd.: Associate
• Planningandexecutionofclientengagementsfrombriefingtodelivery
• AccountsworkedonincludeTitanandDORMAGmbH
Jaideep Singh Chowdhary
English, Hindi, Punjabi, Konkani
B.Tech. (Information Technology), NIT Allahabad
4 years 9 months of experience in IT (Services) industry.
Cognizant Technology Solutions: Associate
• Ledandimplementedbusinessstrategyandpre-sales at Cognizant and client organisations
• StrategisedanddesignedaUSD10milliondatawarehouseforaleadingfinancialfirm
• Ledateamof40memberstoimplementaUSD4millionreportingsystem
• Received‘AssociateoftheYear’&‘DWDON’awardforsuccessfuldeliveryofa flagship project
• WorkedinmultiplegeographiesinIndia,SingaporeandtheUSA
Jasdeep Singh Soni
English, Hindi, Tamil
B.E. (Hons.) (Electrical and Electronics), BITS Pilani
4 years 6 months of experience in Consulting and IT (Services) industry.
Frost & Sullivan (India) Pvt. Ltd.: Research Analyst
• Analysedsemiconductorindustrydynamicsand produced research reports
• Consultedforglobalsemiconductormanufacturersandaidedtheirstrategicdecision making process
• Authoredmarketinsightsonthesemiconductorindustryforleadingpublications
• Activelyinvolvedinproposalwritingandmeetingclientsfornewbusiness development
Wipro Technologies: Project Engineer
• SignificantlycontributedtothemaintenanceandtestingofSystemManagement application running on large enterprise servers
Jayalakshmi Janakiraman
English, Hindi, Telugu, Oriya, Marathi
B.Com., Brihan Maharashtra College of Commerce, University of Pune
4 years of experience in Marketing & Advertising industry.
Pinstorm Technologies: Assistant Manager
• Workedondigitaladvertisingstrategyforlargeglobal clients selecting channels and advertising
• BuiltandtrackeddigitaladvertisingforICICIBankandShell
Bluegrass Studios: Consultant
• SetupcustomeracquisitionandretentionteamforBluegrass’digitalmedia marketing business
Conscience Compass: Head, Business Operations
• CreatedCSRmatrixforcorporatestomeasuretheirCSRandcarbonfootprints
Google India Pvt. Ltd.: Account Associate
• WorkedasAccountAssociateforGoogleAdWordscustomersinEurope
• Twopromotionswithinayear
Jinu Peyeti
English, Tamil, French
B.E. (Mechanical Engineering), MIET Engineering College, Bharathidasan University
5 years 9 months of experience in IT (Services) industry.
Infosys Technologies Ltd. (Airbus UK): Engineering Lead
• Pre-salessupport,businessdevelopmentinEuropean Aerospace Industry, handling Airbus UK and vendors
• HandledclientinterfacingandproposalpreparationforUSD2.8millionmulti-year Airbus aerospace outsourcing project
• EngineeringLeadandNumericalSimulationModelIntegratoratAirbusUK
• AircraftModelacceptanceanddeliveriescoordinatorforAirbus’GlobalDesignTeam with Aerospace vendors
• Implementedprocessesthatreduceddesigncycletimeby20%
Kaja Ahmed Nawaz Mohamed Yusoof
English, Hindi
B.Tech. (Hons.) (Computer Science), MMM Engineering College, Uttar Pradesh Technical University
5 years 9 months of experience in IT (Services) industry.
Infosys Technologies Ltd.: Consultant (Finacle)
• Ledpre-salesactivitiesofFinacleforbankslike Cooperative Financial Services (CFS), National Australia Group Europe in UK and KotakMahindra,INGVysyainIndia
• InstrumentalinwinningthestrategiccontractinEuropeworthUSD100million
• Pioneeredtheintroductionofnewfeatureswithintheproductforcorporatebanksin the UK
• AwardedInfosysCertificateofExcellenceforcontributiontotheorganisation
Kanika Pandey
English, Hindi
M.Sc., (Mathematics), IIT Delhi
B.Sc.,Mathematics(Hons.),SriVenkateswaraCollege,University of Delhi
4 years 9 months of experience in IT (Services) industry.
Inforte India Pvt. Ltd.: Lead Consultant
• Designedanddevelopedon-premiseandon-demandCRMsolutions(Siebel& SalesForce.com)
• StartedtheOracleLifeSciencespractiseatIndiaoffice
• Conductedtrainingsbothtechnicalandnon-technicalforemployees&clients
• WastheModuleleadforthefirstcloudcomputingimplementationatInforte (SalesForce.com CRM)
• WasawardedStarPerformerinMarch‘07
• AnalysisandselectionofCRMvendorsforclients
Kapila Monga
English, Hindi, Telugu
B.A. (Hons.) (Economics), SRCC, University of Delhi
4 years 7 months of experience in Consulting industry.
Intellectual Capital Advisory Services: Associate Consultant
• Studiedtheimpactoffoodinflationandmonetary policy on microfinance institutions in Pakistan. Provided
recommendations to the State Bank of Pakistan on possible interventions
Erudite Educational Centre: Marketing Manager
• Initiated,developedandmaintainedstrongbusinessrelationswithprospectiveclients in Singapore for a new educational content outsourcing initiative
KPMG India: Analyst
• StudiedHRprocessesofaGovernmentoilcompany.Presentedvarious recommendations which were adopted by its Board
Karan Sabharwal
![Page 29: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/29.jpg)
56 57
English, Hindi, Kannada
CFA, Cleared Level III, CFA Institute, USA
CA, ICAI
B.Com., BHS First Grade College, Bangalore University
4 years 10 months of experience in Financial Services industry.
Ishwar and Co (Brokerage firm): Senior Manager
• Advisingclients/proprietarydeskontactical/fundamentalinvestmentideas
• Expandedfirmsclientbaseby7%;increasedtradingvolumesby10%
Goldman Sachs (India) Securities Pvt. Ltd.: Associate, Equity Research
• MemberoftoprankedAsian/IndianEnergyresearchteam
• Publishedover100researchreportsonIndianenergystocks
• CreatedaregionaloilservicesindexforclientsseekingtoinvestinAsianOilServices sector
• Chosentoattendthefirst‘GSStockPickingCollege’inNYinJan08
Karthik Bhat
English, Hindi, Tamil
B.E.(Electronics),VidyalankarInstituteofTechnology,University of Mumbai
4 years 3 months of experience in Engineering industry.
Larsen & Toubro Infotech Ltd.: Alliance Executive
• Responsibleforoneofthetopthreekeyaccounts- Cisco;jointlywonmulti-croreprojects
• Prequalifiedprospects&generated11keyleads(vizLG,Dolby)
• Createdmarketingcollateralsfortheworldwidesalesteam
• LedamobilehandsettestingprojectfromFlorida,USA(teamsize-6)
• Bestteamperformanceaward,2007fordesignanddevelopmentofacoremobile phone application
• TrackedmobiledevicemarkettrendstodriveR&Dinitiatives
Karthik Lakshminarayanan
English, Hindi, Bengali, Urdu
CFA, Level II, CFA Institute, USA
B.Tech. (Electrical Engineering), IIT Kanpur
4 years 7 months of experience in Financial Services industry.
Protiviti Member Firm (Bahrain) SPC: Assistant Manager
• ManagedriskconsultingprojectsatIslamicBanksin Middle East
Edelweiss Capital Ltd.: Manager
• DevelopedCreditRiskModelforcorporateproposals
• DevelopedCollateralManagementFrameworkforcorporateclientsforlending against securities
Deutsche Bank (Global Markets Center): Senior Analyst
• Setupwaterfall/ratingsanalysismodelsforCDOs
• AssetManagementModels(Buy/Sell/Holdenablermodel)
• WorkedinLondonfor9months
Goldman Sachs Services Pvt. Ltd.: Analyst
• LedPrivateWealthManagementandEndofDayteams
• WorkedinUSfor6months
Kaushik Dasgupta
English
B.A. (Communication), University of Washington
4 years 6 months of experience in Financial Services industry.
Expeditors International of Washington, Inc.: Insurance Department Representative
• Managedover100cargoinsuranceaccountsinten countries
Option One Mortgage Corporation (I) Pvt. Ltd.: Mortgage Underwriter
• AuthorisedresidentialmortgageloansuptoUSD750,000
• Analysedcreditreports,titles,appraisals,andincomedocuments
• ChairedCultureCommittee
• TravelledtoIndiatwicetotrainandmentornewunderwriters
Alpine Mortgage Service, Inc.: Loan Processor/ Personal Assistant
• Submittedloanstolendersandtrackedloanprocess
• Updated/standardisedmarketingdatabaseformortgageofficer(800+clients)
Kimberly Anderson Warriah
English, Hindi, Sindhi
B.E. (Hons.) (Computers), MCET, University of Rajasthan
4 years 6 months of experience in IT (Products) industry.
Oracle India Pvt. Ltd.: Senior Application Engineer
• DevelopedtechnicalarchitectureforOracleFusion Patching Infrastructure
• Reviewedpeercode,providedprojectcompletionestimatesandmentoredjuniors
• Designed/implementedenhancementsforFusionandMiddlewarepatching architecture
• ContributedtoQAautomationprocessreducingtestcycleby2days
Larsen & Toubro Infotech Ltd.: Software Engineer
• ConceptualisedserversideframeworkforDigitalHomeportal
• DevelopedtheWebinterfaceandUPNPlibrariesfortheportal
• Significantlycontributedtofinishtheproject15daysaheadofdeadline
Komal Gurnani
English, Hindi, Telugu, Oriya
CA, ICAI
B.Com., Osmania University
5 years 10 months of experience in IT (Products) industry.
World Health Organization-Regional Office for Africa: Budget & Finance Officer
• LeadforbudgetandfinanceareasinGlobalManagementSystem(OracleERP)
• Responsibleforbudgetingandbuildingcapacityfor48countryoffices
• Memberofteamtoreview2-yearpositionbudgetsfor48countryoffices
• Traveledto12countriesinEMEA
Satyam Computer Services Ltd.: Associate Consultant
• LeadconsultantforOracleProjectssuiteandimplementedthesameinWHO Project, Geneva
• ProjectLeadforPRMimplementationatTemenos,Geneva/Chennai
• AwardedSTARperformer
Kota Ravi Chandra
English, Hindi
Bachelor of Nautical Sciences, Training Ship Chanakya College, University of Mumbai
5 years 3 months of experience in Shipping industry.
Seaarland Shipping Management: Second Officer
• Multinationalleadershipandmanagementexperiencein 40 countries across six continents
• Clearedsurveys,auditsandinspectionsconductedbystatutorybodies
• In-chargeofvoyageplanning,logisticsandcargohandling,chartsoutfit,life-saving, fire-fighting, radio and navigational equipment
• Improvedtrainingandsafeworkingprocedureonboard,whichwasreplicatedonall ships of the company
• Teamleaderforco-ordinatingactivitiesduringemergencies
Kumar Sunny Raja
English, Hindi, Telugu
B.Tech.(ComputerScience),VelloreInstituteofTechnology,Vellore
4 years 10 months of experience in Real Estate and IT (Services) industry.
Krisals Infra Pvt. Ltd.: Co founder
• ExpandedourstartupventuretoanINR30million business
• Managecashflowandco-ordinateplanning,procurementandengineeringdivisions
• Identifypotentiallocationsforrealestatedevelopment
Progress Communications Pvt. Ltd.: Wholetime Director
• Progressleadershipandstrategicguidance
• PlayedpivotalroleinexpansionfromINR100milliontoINR170million
• Madeourcompany#1inadvertisingagrobasedproductsinAndhraPradesh
Cognizant Technology Solutions: Programmer Analyst
• WorkedinintegrationtestingservicesforAT&T
Lakshmi Srikanth Koduri
English, Hindi
B.Tech.(ElectricalEngineering),NITJaipur
4 years 6 months of experience in IT (Services)industry.
Tata Consultancy Services Ltd.: Assistant System Engineer
• AnalysedandworkedonCisco’sGlobalSales Platform
• PresentedbusinesssolutionstoimproveCisco’scustomerservice
• WorkedonCisco’sPartnerRelationshipManagementapplications
• Clientappreciationforoutstandingperformanceandlastingcontribution
• LedmanyprojectstosuccessfulcompletionasaLeadQualityAnalyst
Lekha Ojha
English, Hindi, Tamil
B.E. (Hons.) (Electrical & Electronics Engineering), Nanyang Technological University
5 years 6 months of experience in Aerospace and IT Services industry.
Tata Consultancy Services Ltd.: IT Analyst
• Handledend-to-endpre-salesactivitiesforprimarily auto sector projects
• MarketingTCS’capabilitiesandsolutionstoprospectivecustomers
• SecuredprojectswithcombinedrevenuesofmorethanUSD12million
• Alphaproductreleaseforanend-to-endautomotivesolutiondeliveryforNissanthat registered 86% satisfaction index from dealers worldwide
Nanyang Technological University (collab. with Defence of Singapore): Research and Development Engineer
• DevelopmentofSingapore’sfirstsatellite
• PublishedTechnicalPaperonSystemsDesignforAsianSpaceConference
Madhusudanan Narayanan
English, Hindi, Tamil, Marathi, French
MS (Computer Engineering), University of Cincinnati, Ohio
B.E. (Hons.), Electronics and Communication Engineering, Sri Ramasamy Memorial Engineering College, University of Madras
4 years 3 months of experience in Electronics industry.
QualComm Inc.: Senior Engineer
• Helpedarchitectanddesignnextgenerationcellphonechipscomingintothemarket 3-5 years in the future
• Introduced,developedanddeployedhardwaredevelopmentprocessesthatsaved several man months of redesign time
• Enableddesignteamstoadoptemergingindustrystandards.WonQualcomm outstanding achievement award for the same
• Enabledsoftwaredevelopmentpriortohardwareavailabilitytoreducechipdelivery time to market
Mahesh Sridharan
English, Hindi, Gujarati
BMS, Narsee Monjee College of Commerce and Economics, Mumbai University
4 years 8 months of experience in Retail industry.
Athena Optics Inc.: Founder and CEO
• GrewclientbaseandmarketshareinUSA,marketing of house brands like Oxford, Hilton and Senator range
of eyewear
• Brandssoldin200retailoutlets
• BusinessearnedUSD200,000inFY09,FY09salesgrowthwas50%
• Developedahighlyprofitablevintageline,comprisingover10%ofsales
Google Inc, USA: SQA Tester
• Automationsoftwaresaved20manhoursoftestingperrelease
Conti-Optics/Hilton Eyewear Ltd., UK: Intern
• Identifiedkeymarketingopportunities
Manas Sharad Lodhavia
![Page 30: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/30.jpg)
58 59
English, Hindi
Master of International Business, Delhi School of Economics, University of Delhi
B.Com. (Hons.), Goswami Ganesh Dutta S D College, Panjab University
4 years 11 months of experience in Insurance industry.
ICICI Prudential Life Insurance Ltd.: Associate Regional Manager
• LedNorthandEastregion,drivinglifeinsurancesalesinICICIBankAssetssegment
• Partnerrelationship-managementatzonalleveltojointlyachievecross-selltargets
• Initiatednewbusinessavenuesthroughnewtie-ups/corporateprogrammes
• MemberofICICIEmployee-Talent-Poolbasedonleadershipskillsandconsistent performance
• AwardforSpecialContributioninsettingupCreditAssureproductvertical
• AwardforHighestInsurancePremiumValueContributionacrossallzones2008-09
Manasvi Vedhera
English, Hindi
B.Tech. (Metallurgy), IIT Madras
5 years 10 months of experience in IT (Services) industry.
Infosys Technologies Ltd.: Technical Lead
• Strongknowledgeoftheprivateandinvestment banking domains
• BuiltManagementInformationSystemsforafortune50financialmajor
• Wonaccoladesfromseniorclientmanagersforleadingdevelopmentofanefficient information architecture that made processes 20% faster
• Overthreeyearsexperienceofworkingatclientlocationbuildingrelationshipswith clients to foster partnerships
• Awardedfordeliveringamissioncriticalprojectontime
Mandeep
English, Hindi
MS (Mechanical Engineering), Texas A&M University
B.Tech. (Mechanical Engineering), IIT Kanpur
4 years 2 months of experience in Electronics industry.
AirTight Networks: Lead, Applications Engineering
• Responsibleforpre-salesofAirTight’sWirelessSecurity Product in multiple countries (directly or through resellers)
• Ledteamof5forworldwideproductdeploymentandpost-salesservices
• Collaboratedwithchannelpartnerstodevelopsalesfunnel
• HelpedAirTightsalestosignresellers
Pathway Technologies: Project Research Engineer
• DevelopedcontrollertoregulateunderhoodtemperatureinSUVsadding5%to mileage
• Providedresearchinputandwroteproposalsforsecuringnewprojectsand customers
Manik Chandra
English, Hindi
B.A.(Economics),MCMDAVCollege,Chandigarh,PunjabUniversity
4 years 6 months of experience in Food & Beverage and Media industry.
PepsiCo International: Assistant Manager, Sales Development
• Executedthirdpartymerchandising,contributingto13%sharegaininretail
• Acquiredmultiplexesandrestaurants,increasingmarketshareinthischannelby5%
• Implementedmarketingcalendarsforinstitutionalcustomersdelivering60%sales growth YoY
The Times of India: Senior Officer, Response Development
• DoubledtheshareofadvertisingrevenuesofTimesofChandigarhin1.5years
• ConceptualisedandlaunchedETAutoManiaresultinginamarketshareof80%in the auto advertising category
Manika Sahni
English, Hindi
M.A. (Economics), Delhi School of Economics, University of Delhi
B.A. (Economics), Kirori Mal College, University of Delhi
4 years 9 months of experience in Consulting industry.
Inductis Pvt. Ltd. (Consulting Division): Project Manager
• AnalyticsandmanagementconsultingtoFortune500firmsinfinancial,insurance and utility domains
• Workedacrossgeographies-US,SoutheastAsiaandIndia
• RiskAnalyticsforSME(SoutheastAsia)operationsforabankingmajor
• Createdmarketingstrategyfortheworld’sleadingInformationbureau,generating USD 50 million
• Devisedcostavoidanceplanforaninsurancemajor,savingUSD15million
• 1strankinKnowledgeDataDiscovery,DirectMarketingChallenge
Mansi Khanna
English, Hindi, Gujarati
M.Sc.andB.Sc.(InformationTechnology),J.P.DawerInstituteofInformationScience&Tech,VeerNarmadSouth Gujarat University
4 years 11 months of experience in Financial Services industry.
Goldman Sachs Services Pvt. Ltd.: Associate
• Establishednewteam(8members)fordevelopmentandqualityassuranceprojects
• Manageddevelopmentteamtoimplementbusinessneedsforinvoiceprocessing, accrual calculation
• Managedqualityteamforimplementingend-to-endqualitychecks
• Chosenasmentorforthenewrecruitsandfor10KWomenatISB
• ReportedtoGlobalHead(controllers)inNewYork
Meha Raman Grover
English
B.A. (Economics), State University of New York, University of Stony Brook
5 years 7 months of experience in Food & Beverage industry.
Pernod Ricard India Pvt. Ltd.: Key Accounts Manager
• TrackedsalesandrevenuesacrossallDutyFree operators in India
• InchargeofallpromotionactivitiesandinstorebrandingacrossWestIndia
• Builtallinternalforecastsacrossallbrandsinallmarkets
• Builtbusinessplansforallmajorclients
Diageo India Pvt. Ltd.: Assistant Brand Manager
• AssistedinlaunchofSmirnoffBlackinIndia
• DevelopedindustryreportonINR500Segment
DiageoVenezuela:FinancialAnalyst
• Financialplanningandreporting-evaluatingpromotions
• Trackingcompanyoverheads
Mihir Deepak Bhojwani
English, Hindi, Sanskrit
Dual Degree - B.Tech. and M.Tech. (Electrical Engineering), IIT Mumbai
4 years 9 months of experience in Healthcare industry.
Soni Hospitals Pvt. Ltd.: Executive Director
• Achieved30%revenuegrowthYoYinFY09,08,07
• Accreditedorganisationwith60agencies.Grewcredit-salesby62timesover24 months
• ReducedAverageLengthofStayforpatientsfrom5.0daysto4.0days;increased occupancy from 80 to 120 patients per day
Nvidia Graphics Pvt. Ltd.: Hardware Design Engineer
• DesignedandimplementedPCIE-AdvancedErrorReporting(AER)developmentin MCP 65 chip
• HelpedboostMCP65chipsalesinserversegment
Mohit Soni
English, Hindi, Gujarati, Arabic
B.E. (Electrical), Sardar Patel College of Engineering, University of Mumbai
4 years 9 months of experience in Engineering industry.
Siemens Ltd., India: Senior Executive - Projects and proposal management / Deputy Project Manager
• Co-ledprojectexecutionteam(20members)onPowerGridproject(INR120million)
• TeamLeadofaFocusGrouphand-pickedbymanagementtointroducePMU technology in India
• DeputedtoSiemensAG,Germany(3years)toleadaninternationalteamonaT&D project (Euro 160 million) in Libya
• AwardofExcellence&SpecialMeritAward
• Head(Sales&BusinessDevelopment-EnergyAutomationsSolutions)forWestern India
Monil Rameshchandra Ruparel
English, Hindi
Bachelor of Nautical Sciences, Training Ship Chanakya, University of Mumbai
4 years 3 months of experience in Shipping industry.
Seaarland Shipping Management: Second Officer
• Ledmultinationalteamswhilemanagingshipboardand cargo operations
• Officer-in-chargeofnavigation,lifesaving,andhospitalequipments
• Handledship’sdeliveryfromshipyard;costofshipwasUSD85million
• Improvedship’sinventorymanagementsystem,cutinventorycostsby15%
• Chalkedoutandexecutedsafetydrills/trainings
• Handledcargooperationat40portsacross5continents
Mitsui OSK Lines: Deck Cadet
• Completeddrydockmaintenanceofacontainership
Mrityunjay Singh
English, Hindi
B.Tech. (Mechanical Engineering), IT-BHU
5 years 9 months of experience in Energy industry.
Bharat Petroleum Corporation Ltd.: Assistant Manager - Retail Sales
• Increasedfuel/non-fuelrevenuesfromINR1.8billionto INR 5.1 billion in five years
• Achievedsecondhighestpremium-fuelconversionalloverIndia
• Triplednon-fuelrevenueswithinayear(2008-09)
• ConductedPersonalityDevelopmentProgrammesforover1000salesmenand workshops for over 70 officers, including seniors
• ‘LettersofAppreciation’fromGM-NorthIndiaandGovernmentofUttarPradesh
• Co-ordinatedmarketinginitiativefor‘PureforSure’across213cities
Nalin Kumar Sharma
English, Hindi
B.E. (Computer Science), Thapar Institute of Engineering and Technology
4 years 5 months of experience in IT (Services) industry.
Sapient Corporation: SAP Senior Consultant L1
• LeadforSAPPortalandSAPHRteam
• DevelopedteamthatwonbidforaUSD4millionSAPPortalprojectfromUS pharma client
• ResponsibleforhandlingRequestforProposals,EstimationandResourceplanning for Sap Portal and SAP HR projects
• Consistentlygot‘AboveExpectation’rating
IBM India Pvt. Ltd.: Associate system engineer
• PartofcoreteamresponsibleforsettingupSAPPortalpractice
• YoungestresourceincompanytogetSAPPortalcertification
Namit Bhandari
![Page 31: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/31.jpg)
60 61
English, Telugu
B.Tech. (Mechanical Engineering), K L College of Engineering,Vijayawada,NagarjunaUniversity
4 years 9 months of experience in IT (Services) industry.
Infosys Technologies Ltd.: Technology Analyst
• ArchitectediProwe-webaccessibilityassessmentand remediation product
• Filed2patentsinthedomainsofwebaccessibilityandusability
• ReceivedInfosysExcellenceAwardsasateamof5forInnovationInitiatives
Infotech Enterprises Ltd.: Assistant Design Engineer
• Computermodeling,designanddraftingofaeronauticalenginecomponents
• Ledpilotprojectsinvolvingtechnicalwritingandreverseengineering
• ResponsibleforteamlevelqualitymaintenanceintheroleofACEpilot
Navin Kasa
English, Hindi
B.E. (Computer Science), Army Institute of Technology, University of Pune
4 years 7 months of experience in IT (Services) industry.
Amdocs: Senior Subject Matter Expert
• Developedasystemtestingtoolthatreducedtesting time by 10%
• Monitoredtheend-to-endtestingofsystemsinthetelecomdomain
• Workedonsystemtesting,gainedexperienceonallcyclesofbillingintelecom
Infosys Technologies Ltd.: Software Engineer
• Workedinthedesign,developmentandtestingoftheenrolmentapplicationfora health insurance client
• Prepareddesignspecificationdocuments,unittestplansandreleasedocuments
• Involvedinconfigurationmanagementactivities
Neha Wadhawan
English, Hindi
B.E. (Electronics and Communications), BIT Ranchi
4 years 6 months of experience in High Technology industry.
Wipro Technologies: Senior Project Engineer - Team Lead
• Responsibleformigratingfromaclosedtoopensource design environment for a major US Semi Conductor
vendor
• HandleddesignanddevelopmentofcustomcellsforaJapaneseelectronicsmajor
• AwardedBestPaperforpaperpresentedatBusinessUnitLevelTechnicaleventin 2009
Niharika Kishore
English, Hindi, Bengali, Punjabi
PGDBM (Finance and Marketing), Fore School of Management, New Delhi
B.Com. (Hons.), St. Xavier’s College, University of Calcutta
5 years 9 months of experience in Commercial Banking industry.
CitibankNA:AssistantVicePresident-SalesHead
• LedtheLiabilitiesteamof10CitiGoldWealthManagers
• Recruitedteammembers,mentoredandsetannualtargets
• WontheShootingStarawardin2008asthebestCitigoldBusinessRelationship Manager
• Won3awardsin2009asSalesHead
ICICI Bank Ltd.: Relationship Manager - Auto Finance
• MaintainingandstrengtheningrelationshipswithDealershipsandDSAs
• Led‘LoanonPhone’campaignforEast
• FeaturedinICICI’stalentpoolforfasttrackcareergrowth
Nikhil Mehta
English, Hindi
B.Tech. (Electronics & Communication), Amity School of Engineering, Guru Gobind Singh Indraprastha University
4 years 9 months of experience in IT (Services) industry.
Honeywell Technology Solutions Pvt. Ltd.: Senior Engineer
• HandledpostsalesfunctionsforclientsinAerospace domain;gatherednewrequirementsandperiodicfeedbackfromclients
• Awardedindividualandteamexcellenceawardsforhandlingonshore-offshore support activities
• TransitionedsupportofcrucialITapplicationfromanexternalvendortocompany
Accenture Services Ltd.: Software Engineer (Healthcare Domain)
• Workedontwoprojectsinhealthinsurancedomain(forUSandIrelandclients)
• ReceivedJSEAchiever,TeamAchieverandBestPerformerinTrainingAwards
Nikhil Verma
English, Hindi, Bengali
CA, ICAI
M.Com., University of Calcutta
B.Com., Prafulla Chandra College, University of Calcutta
5 years 5 months of experience in Consulting and Automotive industry.
PricewaterhouseCoopers: Assistant Manager
• Processimprovementconsulting
• SAPRiskManagementreviewsinManufacturing,FMCG,Energy,Electronics,IT, Banking industries
• LedSAPservicesdeliveryanddataanalyticsinIndia,Ledinternationalteamson Forensic analytics
Tata Motors Ltd.: Senior officer
• MISreporting,pricing,budgeting,productintroductionanalysis,businessanalyst, SOX implementation
• AchievedcostreductionofINR31million;Ledfinanceandproductionintegration
Tata Services Ltd.: Group CA Trainee
• Costing,CAPEXanalysis,auditcompliance
• EVAandSAP-BIWimplementation,developedcostanalysismodels
Niloy Sadhu
English, Hindi, Tamil
B.Tech. (Computer Science), NIT Trichy
4 years 9 months of experience in IT (Products) industry.
Microsoft R&D Pvt. Ltd.: Software Development Engineer in Test II
• Ledateamof10testerstoachieve100%test automation
• RecognisedasGoldStarofOfficeBusinessPlatformGroup,arecognitiongivento top 5% of employees
VerizonDataServicesPvt.Ltd.:SoftwareEngineer
• Ledteamtoachievemigrationof100,000salesorderswith99.95%accuracy
• Recipientof‘SpotAward’forachievingCMMilevel5compliance
• Among10%incompanytobeawardedforexceptionalperformance
Nithin Srinivasan
English, Hindi, Tamil
M.Sc. (Economics), Madras School of Economics, Anna University
B.Com., Stella Maris College (Autonomous), University of Madras
5 years 10 months of experience in Commercial Banking industry.
LatentViewAnalyticsPvt.Ltd.:Manager
• Ledsolutiondeliveryandclientengagement
• Businessdevelopmentandsalesactivities
• Researchnewanalyticdevelopments
Scope International Pvt. Ltd.: Manager - Portfolio Analytics
• Establishedoff-shoreanalyticteamasasinglestopshopforallanalyticactivities
• IdentifiednewrevenueopportunitiesandCRMstrategy
Citibank NA: Assistant Manager
• Predictivemodeldevelopmentandimplementation
• Establishedtheoff-shoreengagementmodel
• Analyticssupportfornewproductintroductionandbusinessstrategy
GECIS-Analytics: Marketing Analyst
• Developedcustomeracquisitionmodels
• Portfolioprofitabilityanalysis-RFM,LTVModels
Padmasini Renga Bashyam
English, Hindi
B.Tech. (Information Technology), NIT Allahabad
5 years 8 months of experience in IT (Products) industry.
Tata Consultancy Services Ltd.: IT Analyst
• Co-ordinated3projectsforBaseStationsolutions generating revenue of USD 2 million
• LedteamsacrossUSA,UK,KoreaandIndiafordesignandtestingWimaxBase Station Test Simulator
• DemonstratedWimaxTestSimulatorproducttovendors,resultingin3buy-ins
• AsLearningandDevelopmentco-ordinatorfortheaccount,trainedandmentored 70 people
Aricent Technologies: Software Engineer
• Designed3GAccessPointSolutionsforclientsinEurope
Pallavi Gupta
English, Hindi, Marathi
MS (Electrical Engineering), Texas A&M University
B.E. (Electrical Engineering), Govt. College of Engineering, University of Pune
5 years 8 months of experience in Consulting industry.
Deloitte Consulting LLP Boston: Consultant
• Setupprojectplansandgovernancestructures,andfacilitateddecisionmakingfor enterprise transformation projects at large health plans, hospital systems and diagnostic testing companies
• LedinterdisciplinaryclientandvendorteamsinPoland,Australia,andtheUSto setup and interface medical devices at a large diagnostic testing company
Tata Technologies Ltd.: Graduate Trainee Engineer
• Ledtherequirementsanalysis,design,anddevelopmentofanequipment maintenance system for a large auto-manufacturer
Parikshit Deshpande
English, Hindi
B.Tech. (Mechanical Engineering), IIT Mumbai
4 years 9 months of experience in Investment Banking industry.
Barclays Capital, New York: Analyst
• USD123millionIPOandUSD65millionfollow-onfor LogMeIn, a remote connectivity software provider
• USD550millioninHighYieldfinancingforIronMountain(datastoragecompany)in the US
• USD1.8billionmergerofAsiaInfoHoldingswithLinkageTechnologies(ITservices domain)
Lehman Brothers Ltd., India: Analyst
• Coreteammember,initiatingLehman’soff-shoreanalyticsteam
• Recipientof‘LehmanInnovatorsAnnualAward’
BA Continuum Solutions (Bank of America), India: Analyst
• Analysisofcapitalisationstructure,HighYieldissuances,bankloanfacilitiesand comparable companies
Parshav Mathur
English, Hindi
B.Tech. (Information and Communication Technology), Dhirubhai Ambani Institute of Information and Communication Technology, Gujarat
4 years 9 months of experience in IT (Products) industry.
Amdocs: Senior Subject Matter Expert
• Leddesign,developmentandprocessestransformationsfortelecomprojects- USD 75 million each
• WorkedondeliveryofcustomerexperiencesolutionsacrossCRM,orderingand billing products
• Reduceddefectsinthesolutionby50%,leadingtocostreductionsofUSD750,000
• LedimplementationforintegrationofAmdocsproductsforAstro,aMalaysian satellite service provider
Tech Mahindra: Technical Associate
• Developedandsupportedsolutionsforamission-criticalbillinggatewayofBritish Telecom
Parth Awasthi
![Page 32: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/32.jpg)
62 63
English, Hindi, Tamil
B.Com., Loyola College (Autonomous), University of Madras
5 years 2 months of experience in Private Equity & Hedge Fund industry.
VentureIntelligence:Head-Operations
• Ledtheresearchteamfocusedonprivateequity/ venture capital research
• Memberofbusinessdevelopmentteam,thatincreasedfirm’srevenuesby 400% over 3 years
• Designed,andsoldnewresearchofferings
• Extensiveinteractionwithstartups,investors,andintermediariesinthePE/VC ecosystem
D. E. Shaw & Co.: Associate
• Builtcompetitiveintelligencebytrackingrivalhedgefundsacrossinvestmentstrategies
• Devisedinnovativewaysforgathering,classifyingandanalysinginformationabout competitors
Pawan Kumar
English, Hindi, Marathi
MBA, Sinhgad Technical Education Society’s Institute of Management, University of Pune
B.E. (Mechanical), All India Shri Shivaji Memorial Society College of Engineering, University of Pune
5 years 9 months of experience in Manufacturing industry.
Tata Steel Processing and Distribution Ltd.: Senior Branch Manager - Sales (West)
• Functionalresponsibilityfortoplineandbottomline;consistentlyachievedtargets; increased share of business with key customers from 35% to 47%
• ‘StarManager’Awardforlastthreeconsecutiveyears
• Reducedinventorylevelsduringrecessionfrom60daysto30days
• Representedtheleadershipteamat‘BuildingonExcellence’TSDPL’sBusiness Conference at Guangzhou, China
• Playedkeyroleinbaggingnationallevel‘BestSteeliumDistributor’Award
Piyush Deepak Nahar
English, Hindi
B.E. (Electrical Engineering), SPCE, University of Mumbai
5 years of experience in IT (Products) industry.
Hewlett-Packard India Sales Pvt. Ltd.: Storage Sales Specialist
• SalesspecialistforstoragesolutionstoclientslikeL&T, Bajaj Auto, RBI and Crest
• Achieved162%ofUSD4millionannualsalestarget
• Re-acquiredlongstandingcompetitiveaccounts
Larsen & Toubro Infotech Ltd.: Business Development Executive - Europe
• PitchedtheoffshoremodeladvantagetoEuropeanclientslikeBMW,Volvoetc.
• Securedincreasedrevenuefromexistingclients
Larsen & Toubro Ltd.: Account Executive
• Accountmanagementfortelecomclients,achieved133%ofINR30milliontarget
• SuccessfulbidtopartnerBSNLwithL&T
Prachee Dubey
English, Hindi, Malayalam
BBS, College of Business Studies, University of Delhi
4 years 10 months of experience in Consulting industry.
A.T.Kearney:TeamLead(RetailVertical)
• Ledtheretailresearchpracticefortheglobalservice centre
• Ledresearchonglobalflagshipstudy‘GlobalRetailDevelopmentIndex2010’and ‘India Luxury Market 2007’
• Providedvalueaddedresearchtoconsultantsgloballyforclientengagementsand proposals
• CreatedandcapturedintellectualcapitalfortheConsumerIndustriesandRetail practice
Pramod Menon
English, Hindi, Kannada
CFP, FPSB, Mumbai
CFA, ICFAI, Hyderabad
CWA, ICWAI
B.Com., MGM College, Mangalore University
5 years 11 months of experience in Financial Services industry.
AEGON Religare Life Insurance Co. Ltd.: Regional Manager - Training
• Conductedfinancialplanningsessionsforhighnet-worthclientsandrendered investment advice
• Managedthesouthregiontrainingteam
• ProcuredINR10millionofbusinesseveninrecessionarymarketof2008
ICICI Prudential Life Insurance Ltd.: Area Manager - Content Development
• Developedtrainingmodulesforentirecompanyonfinancialmarkets,financial planning and taxation
• Designedtoolsandtechniquestoovercomecustomerobjectionsandfacilitatesales
• Updatedthesalesteamsregularlyonmarketevents
Prasanna Tantri Laxminarayana
English, Hindi, Tamil
MS (Information Networking), Carnegie Mellon University
B.Tech.(InformationTechnology),SVCE,UniversityofMadras
5 years 5 months of experience in IT (Products) and Automobile industry.
Indee.tv: Co-founder and Chief Technology Officer
• Createdcontentdistributionplatformforindependentfilms
• Createdandsoldcontentsubmissionandmanagementplatformforafilmfestival
General Motors Technical Centre - (India): Senior Researcher
• Conceptualised,managedandimplementedseveralresearchprojectsforin-vehicle communication and safety
• Authored4internationalresearchpapers,filed3patents(2granted)and3internal tool inventions
• Servedassinglepointinterfacewithsuppliers,internalpurchaseandITtosupport prototype development
Prasanna Vignesh V Ganesan
English, Hindi
MSE (Telecom & Networking), University of Pennsylvania
B.E. (Electronics & Telecommunications), Smt Indira Gandhi Engineering College, University of Mumbai
5 years 8 months of experience in Consulting industry.
KPMG: Assistant Manager
• IdentifiedopportunityworthUSD22millionfora software publisher on lost revenue due to IPR violations
• BestPerformerAwardforIPcomplianceandinfrastructureoptimisationproject
• Processconsultingforgameshows
• PeopleInitiativeideaselectedforKPMGIdeaInitiative
Wipro Infotech Ltd.: Consultant
• Saved15%byoptimisinginfrastructureforaclient
• ManagedgovernanceforaNYSElistedIndianBPO
• Certificateofappreciationfromclient
Mahindra Special Services Group: Consultant (Information Risk Management)
• Conceptualisedbusinessimpactwargames
Prashant Singh Sankhla
English, Hindi, Tamil
B.E.(MechanicalEngineering),SriVenkateswaraCollegeof Engineering, Anna University
4 years 9 months of experience in Manufacturing and Service industry.
Eaton Corporation: Senior Business Development Executive
• Developedacquisitionstrategyandpipelinefortwoproducts(salesUSD3billion)in APAC
• WorkedonidentifyingUSD20millioncross-sellingopportunitiesinrenewableenergy
• MemberofglobaltaskforcetocapitaliseonstimulusopportunitiesinUSAandChina
Frost & Sullivan Pvt. Ltd.: Senior Research Analyst
• Advisedclientsinautomotive,energyandautomationverticalsonmarketentryand product strategy
• Handledpre-salesandsolutionsfortwoFortune50accounts
• Trainednewrecruitsonengagingclients
Prashanth Venkatesh
English, Hindi, French
B.E. (Electronics & Communications), Manipal Institute of Technology
5 years 10 months of experience in IT (Products) industry.
Motorola (India) Pvt. Ltd.: Senior Software Specialist
• Ledmarketrequirementanalysis,designedtest architecture and scenarios for Mobility Services Platform
• Workedontestprojectplanningfor250,000deviceoperationsforWalmart
• Designedprocessforend-to-endco-ordinationbetweeninternationalengineering and marketing groups
• LedWomens’BusinessCouncilIndiachapter
Alcatel-Lucent India Ltd.: Software Engineer
• Designedtestarchitecture,usecasestoensureproductscalabilityforSprint
VelankaniSoftwarePvt.Ltd.:MemberofTechnicalStaff
• Designedandmanagedtest-bedsetupforOccamNetworks
• WonexcellentcontributorawardfromOccam
Prerna Jain
English, Hindi
B.A. (Economics), University of Texas - Austin
4 years 3 months of experience in Consulting industry.
Hewitt Associates (India) Pvt. Ltd.: Associate
• Performancemeasurementandemployeeengagement projects
• WonaWorldBankprojectforIT/ITESdevelopmentinanAfricannation
• HewittAmbassadorAward(2008)
• WorkedonHRProcessconsolidationprojectforaGermanautomajorinChina
• Workedon‘EmployeeListening’projectcovering7000+employeesforalargeretail conglomerate in the Middle East
• HelpedstrategiseoutsourcingdecisionsforalargeelectronicscompanyinUS
Pritika Idnani
English, Hindi
B.Tech. (Chemical Engineering), IIT Mumbai
5 years 6 months of experience in Consulting & FMCG industry.
Accenture India Pvt. Ltd.: Consultant
• Globalmanufacturingstrategyandcapacityplanning for a big oil field services player
• StrategicsourcingofautoancillariesfromIndiaandChinaforaglobalfreightand logistics leader
• Inventoryoptimisationandsupplychainplanningprocessesoutsourcingfora healthcare hi-tech major
Procter&Gamble,Japan,K.K:Scientist
• Ledthetechnicalandfinancialfeasibilityanalysisfornewproductlaunch
• Marketandconsumerresearchtoidentifytargetsegmentsformulti-tierbrand proposition
Puneet Jain
English, Hindi, Punjabi
M.Com., Lala Lajpatrai College of Commerce & Economics, University of Mumbai
BMS, Narsee Monjee College of Commerce & Economics, University of Mumbai
4 years 8 months of experience in Financial Services industry.
Bloomberg L.P.: Sales Specialist
• SalesandproductdevelopmentandTrainingforfinancialinstitutions/corporates across Middle East and South Asia
• ResponsibleformanagingannualrevenuesofUSD7million-largestindividual responsibility in MESA
• Teamachievedthehighestnetsalesgrowth(globally)of4%in2009-10
• Awarded‘Sales-MostInnovative’2009
• Increasedbusinessataleadingpublicsectorbankby300%
• Bestperformergloballyinanalyticsdepartment-2006
Puneet Makkad
![Page 33: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/33.jpg)
64 65
English, Hindi
B.Tech. (Ocean Engineering & Naval Architecture), IIT Chennai
5 years 9 months of experience in Consulting industry.
Aqua Management Consulting Group: Consultant
• Saved12%indistributioncostthroughre-designof distribution network for a consumer goods company
• Implemented10%reductioninprocurementcostofMROitemsforasteelcompany
• Effected8%reductioninlogisticsspendforanautoancillarycompany
IBM Global Business Services (GBS): Business Transformation Consultant - Supply Chain Strategy
• Achieved5%reductioninoperatingcostofanaircargocompanythroughre-design of business processes
• Formulatedoperatingprocessesforastartupexpressdeliverycompany
i2 Technologies (India) Pvt. Ltd.: Consultant (Supply Chain Management)
Infosys Technologies Ltd.: Software Engineer (Transportation & Services)
Rachit Rungta
English, Hindi
B.Tech. (Textile Technology), IIT Delhi
4 years 7 months of experience in Private Equity industry.
FIRE Capital Fund Pvt. Ltd.: Investment Associate
• Workedon4privateequitytransactionsintheReal Estate sector
• Evaluatedover50dealsspanningresidential,commercialandindustrialrealestate
Strategic Decisions Group: Business Analyst (Associate Consultant)
• HelpedanIndianinfrastructuremajortoincreasetheprofitabilityofitsairport
• Strategicduediligenceofafinancialservicescompanyforaleadingprivateequity fund
ICF Consulting, India: Analyst
• HelpedaglobalenergygianttoassessthedemandforNaturalgasintheIndian power sector
Raghav Bahl
English, Hindi, Tulu, Kannada, Tamil, Telugu, German, BasicJapanese
M.Sc., (Hons.) (Chemistry), BITS Pilani
B.E., (Hons.) (Mechanical Engineering), BITS Pilani
4 years 9 months of experience in Process Consulting - Automotive industry.
Mercedes Benz Research & Development India: Senior Lead Engineer
• StarTeamAward2009winnerforexcellenceincustomersatisfactionratings
• ConsultedDaimlerforimprovingMercedesBenzvehicletestingprocesses
Altair Engineering (India) Pvt. Ltd.: Technical Analyst
• AltairIndiaBestEmployeeawardin2007
• ConsultedHonda,Japanandreducedthevehiclesimulationtimeby75%
• PublishedadesigncasestudyinanEngineeringTextbook
Raghavendra D
English, Hindi, Malayalam, Tamil
B.Sc.(MechanicalEngineering),RIT,Jamshedpur
5 years 6 months of experience in Manufacturing industry.
Ashok Leyland Ltd.: Deputy Manager
• CoreteammemberforValueEngineeringandField Failure Engineering Designs which led to annual
savings of INR 270 million
• Singlepointcontactforengineeringdesignmodificationinsourcing
• DevelopedMachining,ForgingandCastingcomponents
• Meetingwithsuppliersforlowercost,betterqualityandtimelydelivery
• FormedqualitycirclewinningameritawardatNationalLevelPresentation
• TeammemberforimplementationofProductLifeCyclemanagement
Rahul Justin
English, Hindi, Tamil
B.E. (Electrical & Electronics), Sri Ramasamy Memorial Engineering College, University of Madras
5 years 6 months of experience in IT Products industry.
VerizonDataServicesPvt.Ltd.:ModuleLead
• Systemarchitecturesdesign,ResourceManagement
• Ledtheintegration,testing,deploymentandsupportforcross-functionalteams
• ‘OntheSpot’Awardfor3consecutiveyears
• DevelopedandlaunchedthefirstwirelessproductfromVerizonIndia
Siemens Ltd.: Graduate Trainee Engineer
• Customerservicedirectlyorthroughvendors;VendorManagement
• Customerinteractionandfeedbackanalysis
Rahul Rajappa
English, Hindi
B.A. (Economics), Delhi College of Arts & Commerce, University of Delhi
5 years 3 months of experience in Financial Services industry.
iVenturesCapitalPvt.Ltd.:VicePresident-Sales&Distribution/Trader
• ManagedportfolioofINR120millionDirectEquity,INR50millionNIFTYOPTIONS, INR 80 million MF
• RaisedcapitalforNSEmembership
• Diversifiedintobroking,builtnewdistributionchannelsandexpandedbranch network resulting in 4 fold increase in profits
Deutsche Bank: Relationship Manager - Private Banking
• AcquiredandManagedINR200millionforHNIsandcorporates
• Outperformedtargetsfor8outof8quarters
DSP Merrill Lynch: Management Trainee
• Managed150distributors,3nonbankandHDFCBankrelationships
• Increasedupcountrybusinessby20%
Rajat Sehrawat
English, Hindi, Bengali
B.Tech. (Mining Engineering), ISM Dhanbad
5 years 9 months of experience in Extractive Minerals industry.
Orica Mining Services - Indian Explosives Ltd.: Business Development Manager
• ManagedproductportfolioworthUSD60million
• LaunchedaRevolutionaryExcavationTechnology(EBS)inIndia,increasing bottomline by 5% in 2007
• AsRegionalManager,achievedgrowthof15%incustomerbaseand22%inannual revenue for an SBU worth USD 8 million
• Globalappreciationaward‘DeliverthePromise’forstrengtheningthenascent consulting division in India.
• CertifiedCommercialNegotiatorforOrica
Rajesh Daruka
English, Hindi
B.Tech.(ElectricalEngineering),NITJaipur
5 years 7 months of experience in IT (Services) industry.
Infosys Technologies Ltd.: Technology Lead
• Managedclientrelationshipsandprojectdevelopment for a USD 15 million investment bank client
• Automatedstockloanandstockborrowclaimsprocessing.Savingof30person- hours per week
• FirstconsultanttobeappointedasDomainExpertbytheinvestmentbankingclient
• Re-engineeredassetservicingtechnologydrivenprocesses.Businessrevenuegain: USD 320,000
• HandledclientinmultiplegeographiesacrossIndia,JapanandtheUK
Rajiv Baheti
English, Hindi, Punjabi
B.Tech. (Hons.) (Electronics and Communication), Giani Zail Singh College of Engineering & Technology, Punjab Technical University
5 years 6 months of experience in Consulting industry.
Nokia Siemens Networks Pvt. Ltd.: Senior R&D Engineer
• FeatureManagerforUSD1.5billion3GprojectforVerizonandFranceTelecom
• LedfirsteverproductdemoforPTTTelecom
Wipro Technologies: Module Lead
• ModuleleadinUSD12million3GItaltelproject
Penta Consulting, UK: NGN Engineer
• Handledmigrationof100,000subscriberstonewtechnology
Huawei TeleCommunications (India) Co. Pvt. Ltd.: Switch and NGN Engineer
• HandledUSD70millionproject
Green Commandos (founded in 2008, Bangalore and Mumbai): Founder
• Broughtcountry’stopprofessionalsinGoverningCouncil
• Currentfocusareas:Brandbuilding,marketing,fund-raising,wxpansioninother cities, strategising for existing chapters
Ravi Agnihotri
English, Hindi
Bachelor of Financial & Investment Analysis, College of Business Studies, University of Delhi
4 years 2 months of experience in Education industry.
MindValleyLLC.:ProjectManager
• LeadingtheOnlineLaunchofDomainAdvantageEarly Education Products globally
AIESECInternational:VicePresidentExternalRelations
• Leadingmulticulturalteamstoexpandglobalpartnershipsinemergingmarkets
• AchievedrevenuesofUSD1.2millionandsignedlargestpartnershipwithaglobal bank
AIESEC in India: President of AIESEC in India
• LeadingstrategicgrowthandexpansionofAIESECinIndiato14citiesand 900 members
• LeadingthecreationofAIESECIndiavision2010document
Rishabh Chopra
English, Hindi
B.E. (Hons.) (Mechanical), Delhi College of Engineering, University of Delhi
4 years of experience in Consulting and Manufacturing industry.
Accenture Management Consulting: Consultant, Supply Chain Management
• Categoryprofiling,industryanalysis,spendanalysisandnegotiationstrategy development for a financial services client: Achieved cost savings of USD 3 million
• Low-cost-countrystrategicsourcingengagementforanautomotiveclient:Market AssessmentandVendorManagement
• PivotalindevelopingGlobalOfferinginSourcingandProcurementpractice
Maruti Suzuki India Ltd.: Assistant Manager
• Projectmanagement:Designingprocessesandsystemsforinboundsupplychain activities and sales and dispatch operations
Rishi Suri
English, Hindi, Punjabi
B.Tech. and M.Tech (Bio Chemical Engineering and Bio Technology), IIT Delhi
5 years 9 months of experience in Pharmaceuticals industry.
Biocon Ltd.: Deputy Manager
• ProductionManagerforfiveproductionunits generating annual revenue of USD 22 million
• CompletedcertificationsforregulatoryauditsbyUSFDAandEuropeanMedical Agency (EMEA)
• Ledacross-functionalteamtooptimizefermentationprocessfortwoproducts resulting in annual savings of USD 2.8 million
• LedtwofacilityexpansionprojectswithcombinedCAPEXofUSD5.75million
• ReducedenergyconsumptionresultinginannualsavingsofUSD180,000
Ritesh Kumar Sharma
![Page 34: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/34.jpg)
66 67
English, Hindi , German
B.Sc. (Hons.) (Computer Science and Management Studies), University of Nottingham, UK
4 years 6 months of experience in Private Equity industry.
MKT Securities Pvt. Ltd.: Director
• Co-founderofwealthmanagementfirmhandling portfolios of HNIs
Dubai International Capital (DIC): Analyst
• Sourcedandevaluatedinvestmentopportunitiesinemergingmarkets
• Developedportfoliocompaniesthroughbusinessexpansionstrategies
• KeymemberofIndiafocusteam
Citigroup: Relationship Manager
• Managedaportfolioof30firmsforcommercialcorporatebanking
• ProjectLeadforRealEstateCreditProgrammeforCitiUAE
• SelectedforManagementAssociateProgramme,aGlobalLeadershipProgramme within the corporate banking division
Rohaan Kapoor
English, Hindi
B.Com. (Hons.), Shaheed Bhagat Singh College, University of Delhi
4 years 9 months of experience in Consulting industry.
Grant Thornton: Consultant
• LedateamforBusinessPlanManagement,Project Planning, and client interface
• Evaluatedbusinessopportunities,firmedupbusinessvaluepropositions
• WasinvolvedinStrategicAdvisoryandFinancialModeling.AlsoexperiencedinHR advisory which included Manpower Planning
Ernst & Young Pvt. Ltd.: Trainee
• IndustryAnalysis&ResearchandTransactionSupport
Rohit Bahadur
English, Hindi, Punjabi
B.Tech. (Electronics and Communications), Dr. B. R. AmbedkarNationalInstituteofTechnology,Jalandhar
5 years 9 months of experience in Electronics and IT (Services) industry.
Freescale Semiconductors: Design Engineer II
• HandledIndiaDesignCenter’sactivitiesrelatedto verification of multi-core networking chip
• CoordinatedwithteamsfromCanada,US,Israelandexternalvendors
• Providedtrainingtoteamsinnetworkingdepartment
Wipro Technologies: Senior Project Engineer
• LeddesignteamoffiveinVLSIdomain;interfacedwithNewLogicteaminFrance
• ReceivedExcellenceaward‘Trailblazer’,March2006,forBestProjectdelivery
• Improvedproductivityby20%andreducedpowerconsumptionofIPby7%
Roopan Aulakh
English, Hindi, Marathi, Konkani, French
CA, ICAI
B.Com., R A Podar College of Commerce and Economics, Mumbai University
4 years 2 months of experience in Investment Management industry.
Deutsche Asset Management (India) Pvt. Ltd.: Manager
• WasinstrumentalinsettingupthecompletebackofficeprocessforthePMS Business
• WasuptodatewiththePMSRegulationsandensuredcompliance
• PlayedanimportantroleinsettingupfirstnondiscretionaryPMSProductformutual fund investments
ICICI Prudential AMC Ltd.: Assistant Manager
• Haveahandsonexperienceoftheentirebackofficeprocesses
• Wasrated‘ExceedsExpectations’inanalyticalthinking,processconsciousnessand initiative
Roshal Dsa
English, Hindi, Tamil, French
B.E. (Computer Science), Manipal Institute of Technology, Manipal Academy of Higher Education
5 years 6 months of experience in Consulting industry.
KPMG - UAE: Consultant
• Advisedclientsonstrategicengagementsfrom business plan development to business process re-engineering
• Co-developedandimplementedstrategyprogrammestogrowfirmsrevenueby37%
• Developedwinningmulti-milliondollarglobalproposalswithKPMGmanagement from 35 global offices
• ExpandedpresenceintheUAEbysettingupanewofficeinanotheremirate
Torry Harris Business Solution: Business Development Executive
• Builtrelationshipswithglobaltechnologyvendors
• Selectedtoset-upoperationsinOman
Roshan Victor Joseph D’Souza
English, Hindi
BS (IT and Finance), Rochester Institute of Technology
5 years 3 months of experience in IT (Services) industry.
Tata Consultancy Services Ltd.: Assistant Systems Engineer
• GapAnalysisforcentralisingCitiFinancials’subprime mortgage lending operations
• ImplementeddistributionchannelforAXAInsurancewhichledtoUSD28millionyield for insurance products
• SecuredTechnicalSupportoffshoringprojectfromCVSPharmacyworth USD 8 million for TCS by submitting a competitive financial and technical proposal
• StreamlinedWalgreen’ssupplychainandlogisticsoperationsacross3000+US branches
Saad Ahmed
English, Hindi, Marathi
B.E. (Computer Science), Sardar Patel College of Engineering, University of Mumbai
4 years 9 months of experience in Publishing & Media and IT (Services) industry.
Thomson Reuters: Sales Specialist
• Identifiedandqualifiednewopportunitiesintreasury and fixed income
• Formulatedsalesplansandexceededtargetby30%fortreasuryandfixedincome products in South Asia
• Preparedandpresentedbusinessproposals.Negotiatedcontracts
• ClosedstrategicdealsworthUSD250,000(annualrecurring)
• NominatedtoHiPo-aprogrammetogroomtop10percentforleadershiproles
Accenture Services Ltd.: Software Engineer
• Designedsolutionbyunderstandingclient’srequirements
• Managedsoftwaremodulesend-to-end
Sachin Kumar Somani
English, Hindi, Telugu
MS (Computer Science), University of North Carolina, Charlotte
B.Tech. (Computer Science & Engineering), Kakatiya Institute of Technology & Science, Warangal, Kakatiya University
4 years 3 months of experience in IT (Products) industry.
EMC Corporation: Technical Lead
• DevelopedandreviewedoneofthemodulesofStorageAreaNetworkmanagement software
• Preparedthescopingdocumentandwrotefunctionalspecification,unittestand integration test plan documents
• Gavetechnicalpresentationstopre-salesandtestingteams
• Awarded‘EMCWhoDoneIt’prizeforresolvingaproblematoneofcompany’s largest clients
August Technologies: Software Consultant
• Fixedbugsinsoftwareandenhancedtheproductforfuturereleases
Sai Swaroop Thota
English, Hindi
B.Sc. and M.Sc. (Mathematics & Computing), IIT Kharagpur
4 years 6 months of experience in Financial Services industry.
Ocwen Financial Services: Practice Manager
• Ledateamof3inconstructingassetpricingmodels, used currently to price assets worth USD 48 billion
• Ledateamof4tobuildpredictivemodelsusedinpricingassetsworthUSD40billion
Futures First Info Services: Derivative Analyst
• Tradedinworld-widecrudemarketsonNYMEXandICEexchangeswithintra-day trading limit of USD 1 million
• Analysedgeo-politicalfactorsaffectingcrudeprices
i2 Technologies: Associate Consultant
Saket Giri
English, Hindi
BS (Computer Science), Georgia Institute of Technology
4 years 7 months of experience in Consulting industry.
Deloitte Consulting: Senior Consultant
• Extensiveexperienceinfullrangeofsourcingand procurement processes including category
management, strategic sourcing, contracts management and supplier enablement as well as enabling technologies
• Deepexperiencewithstreamliningsourcingandcontractsmanagementprocesses, software selection, systems integration, and organisation design
• Helpedorganisationalre-deisgnandmanagedresultingchange
• Workedwithin-houseGeneralCounselstoredesignandimplementcontracts management
• Solee-SourcingconsultantatDeloitteConsulting
Salil Das
English, Hindi, Punjabi
B.E. (Computer Science), Shirdi Sai College of Engineering,VisvesvarayaTechnologicalUniversity
5 years 9 months of experience in IT (Products) industry.
SumTotal Systems India Pvt. Ltd.: Solutions Architect (Intercontinental Sales, APAC Region)
• Pre-salesandconsultingforHumanCapitalManagementSoftwareproductsacross domains
• ExperiencedinSaaSandEnterprisesoftwaredealsinIndiaandSouthEastAsia
• End-to-endproductlifecycledevelopmentandmanagementexperience
• CreatedandlaunchedthebusinessplanforSaaSsalesinIndia
• Created,implementedandmanagedglobalsupportprocessesforallcustomersin Japan
Sameer Mehta
English, Hindi
MS (Computer Science), University of Texas, Arlington
B.E.(Hons.)(ComputerScience),VaishCollegeofEngineering, Maharshi Dayanand University
5 years 11 months of experience in Venture Capital industry.
Riverdale Investments Pvt. Ltd.: Founder
• Startedaseedfund(Riverdale),raisedUSD300,000
• InvestedinFood&BeverageandSaaSfortraveldomaincompanies
• Handledfinanceandpurchasefortheinvesteecompany(F&B),grossingINR50 million in revenues in its first year of operations
HCL Technologies Ltd.: Associate Business Manager
• Bidandwonaccounts(retail,media&entertainment)withUSD50millionannualsales
• LedHCLforayintoE-learningmicro-vertical
Zensar Technologies Ltd.: Business Analyst (BFSI domain)
Tata Consultancy Services Ltd.: Systems Engineer (BFSI domain)
Sandeep Goel
![Page 35: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/35.jpg)
68 69
English, Hindi, Kannada
B.E.(MechanicalEngineering),GoldenValleyInstituteofTechnology,VisvesvarayaTechnologicalUniversity
5 years 8 months of experience in Manufacturing industry.
Deccan Hydraulics Pvt. Ltd.: Director - Material control
• Establishedanewlogisticscompany,DeccanLogistics
• ImprovedoutputatfactoryproducingVolvochasisby200%
• Increasedproductivityatfactoryproducingfueltanksby50%
• Automatedwarehouseoperationsleadingtoa20%inventoryreduction
• IntegratedSAPacrossallcompanyofficesandfactories
• Taughtstudentsinruralschoolsaspartofourfoundation’sactivities
Deccan Hospital: Engineer
• Implementedhospitalmanagementsoftware
Sandeep Ramakrishnappa
English, Hindi, Bangla
B.Tech. (Hons.) (Instrumentation), IIT Kharagpur
5 years 9 months of experience in IT (Products) industry.
VmokshaTechnologies/RetiveSolutions:AssistantConsultant
• SupervisedenhancementstotheRetailITsuite-70% revenues for USD 1.5 million retail vertical
• TeamLead(6members)fordesignanddevelopmentofretailframework
• Built15-memberteamin8monthsanddeliveredfirstsolutionwithin6months
• Managedintegrationof10applicationsacrossTangs4subsidiaries
• ImplementedUSD500,000merchandisingsolution
VmokshaTechnologies:AssociateSoftwareEngineer(Retaildomain)
• RedesignedRBSmerchandisingsystem,enablingtheclienttoexpandfrom30to 130 stores
Sandip Chaudhuri
English, Hindi, Malayalam, Tamil
B.E.(ComputerScience),SardarVallabhbhaiNationalInstitute of Technology, Surat
4 years 9 months of experience in IT (Services) industry.
CSC India Pvt. Ltd.: Senior Software Engineer
• LedaglobalteaminanenterpriseITintegrationand successfully executed USD 2 million system integration project
• RecepientofSpecialRecognitionAwardfromGlobalPresidentofCSCConsulting
• SixSigmaGreenBeltCertified
• PartofthetaskforcethatdefinedprojectprocessesforCSCIndiaConsultingGroup
• LedaSixSigmaprojecttoimproveproductimplementationandmaintenance processes which reduced defect count by 40%
Sangeeth Aloysius
English, Hindi, Tamil, Sindhi
MBA, ICFAI University, Chennai
B.Com., Loyola College, University of Madras
5 years 1 month of experience in Retail industry.
Foodworld Supermarkets: Area Manager
• Settingbudgetsandmonitoringperformanceof 6 stores in Chennai
• Identifyingsitesforthesettingupofsupermarketstoincreasecompanypresence
• Increasedprofitabilityby7%usingsalespushandreducingcosts
Spencers Retail: Assistant Manager
• ThreefoldincreaseinsalesofapparelcategoryinChennaibyusingnewPlanogram
• Reductioninemployeeturnoverby20%inChennaistores
• Effectedanewtrainingscheduleresultinginreductionofemployeeattrition
Sanjeev A Nichani
English, Hindi, Punjabi
B.Tech. (Electronics and Communication), IIT Roorkee
5 years 9 months of experience in Consulting industry.
Evalueserve: Group Manager
• Managedresearchoncompetitiveandcustomer landscape, investment opportunities and technology evaluation for a Fortune 15 energy major
• Consultedglobalenergyclientsonoptimisingstrategicintelligenceandknowledge management portfolio
• SetupenergyanalystteamsinIndia,ChinaandChile
• Didbusinessdevelopmentin10+countriesacross4continents
• WontheEvalueserveleadershipandbestteamawards
Larsen & Toubro Ltd.: Management Trainee
• Marketandtechnologyidentification
• Preparationofcommercialbids
Sanjeev Bhalla
English, Hindi, Punjabi
B.E. (Mechanical Engineering), Thapar University, Patiala
4 years 8 months of experience in Hospitality industry.
Sunshine Gardens: Managing Partner
• Saved28%projectcostconstructinganeventvenue for 1000 capacity
• Consolidatedeventmanagementserviceswiththevenuetoprovideonestop solution
• Consolidatedeventmanagementpublicitythroughnetworkingandcollaboration
• EstimatedrevenuefromoperationsFY2010-INR6.5million
Sanjit Singh Paul
English, Tamil
B.E. (Computer Science), PES Institute of Technology, VisvesvarayaTechnologicalUniversity
5 years 8 months of experience in IT (Products) industry.
Independent Technology Systems Pvt. Ltd.: Senior Development Consultant
• BSS/OSSSolutionArchitectureandDesignforIPbaseddataservicesforanISP business
• KeyroleindeliveryofBSS/OSSsolutionsforMTNNigeriausinganAgile Development approach
• SolutionEffortEstimationandBusinessImpactAnalysis
Tecnomen Lifetree Corporation: Senior Software Engineer, Delivery
• ManagedprojectdeliveryforvoiceandbroadbandservicesforMTNAfrica
• CMMIapprasialTeamMember,partofimportantCMMIL3SCAMPI
• BestEmployeeAward2004
Santhosh Shankar
English, Hindi, Telugu, Kannada
B.E.(ElectronicsandCommunications),RVCollegeofEngineering,VisvesvarayaTechnonogicalUniversity
4 years 7 months of experience in Electronics industry.
Agilent Technologies India Pvt. Ltd.: Application Engineer
• WorkedwithsalesonRFandMicrowavesolutionsfor Defense, Aerospace and Telecom
• RunnersuppositioninAgilentIndiaInnovationcontest
• ‘QuotabusterAward’and‘TopContributorAward’
National Instruments: Product Specialist
• GrewsalesofmotionandvisionproductsinPharmaandManufacturingsectors
• Identified2channelpartnersfortheseproductlines
• Conductedthefirstevertrainingonmotionandvisionproductsforchannelpartners
Santosh Reddy Nigudagi
English, Hindi, Kannada
Masters in Information Systems Management, Carnegie Mellon University
B.E. (Information Science), BMS College of Engineering, Bangalore,VisvesvarayaTechnologicalUniversity
4 years 8 months of experience in Consulting industry.
Collabera Solutions: Senior Consultant
• Advisedmid-tierUSBankontheenterpriseCRMstrategyandvendorselection
• ManagedanSOAmigrationstrategyandevaluationforelectricitygridregulator
Diamond Management and Technology Consultants: Senior Associate
• ManagedtheoverallprogrammeexecutionofaUSD15millioncustomerexperience initiative at a leading financial services company
• Advisedaninvestmentbankonthelaunchofanationalbank
Deloitte Consulting: Consultant
• Workedwithhealthcareandpublicsectorclientsontechnologyarchitectureand strategy projects
Santosh S Kumar
English, Hindi, Punjabi, French
B.E. (Computer Science), Netaji Subhas Institute of Technology, University of Delhi
4 years 8 months of experience in IT (Products) industry.
Q3Technologies,Inc.:Lead-JavaGroup
• Newprojectappraisals,pricingandstrategicplanning fortheJavadivision
• Nurturingandexpandingthe20memberJavateam
gDev: Team Lead
• SettingupandmanaginggDevsgTeam-agloballydistributedteamofdevelopers
• Trackingteamperformanceandhelpdefineworkflowandserviceguaranteesfor gTeam
Tribal Fusion: Senior Software Engineer
• Designingstrategiestoimproveperformanceof‘LeadGenerationPlatform’
Trilogy E-Business Software (India) Pvt. Ltd.: Technical Associate
• PartofcoreteamthatdesignedFord’s‘BuildandPrice’onlinesolution
Sarabjit Singh Dua
English, Hindi, Malayalam
B.Tech. (Hons.) (Energy Engineering), IIT Kharagpur
4 years 9 months of experience in IT (Products) industry.
Sterling Commerce Solutions India Pvt. Ltd. (An AT&T Company): Delivery Consultant
• Analysingcustomerrequirementsandrecommending customised IT solutions to meet their requirements
• DesignedandDeliveredcustomisedsupplychainITsolutionsforseveralFortune 500 retail majors
• DeployedITsolutionsatcustomerssites
Sarath Chandran
English, Hindi, Kannada, Tamil
B.E. (Electronics and Communication), Bangalore Institute ofTechnology,VisvesvarayaTechnologicalUniversity
4 years 10 months of experience in IT (Products) industry.
Hewlett Packard, India Software Operation Pvt. Ltd.: Software Engineer - (level T2)
• TeamLeadfordesignanddevelopmentofvirtualisationandnetworkingproductsfor Storage and Server division
• PartofVSEevangilisationprogramme
• WorkedonThinkHPFirstfreshtalentrecruitmentteam
• MostValuablePlayerforQ32007fromSeverVirtualisationandI/Olab
• TopPerformer-Ratedinthe‘consistentlyexceedingexpectations’bandof employees for two consecutive years
Satish Kumar Subramani
![Page 36: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/36.jpg)
70 71
English, Hindi
B.Tech.(InformationTechnology),BharatiVidyapeeth’sCollege of Engineering, GGSIP University
4 years 7 months of experience in Electronics industry.
Freescale Semiconductors: Design Engineer 2
• Workedonpre-packagedchipsetsolutionsfor Automotive and Consumer Durable industry
• Showcasedprototypesolutionsinproductmarketingcycles
• LedateamtowinClustorautomationchipdesignforNano
• Securedonedefensivedisclosureandwrote6technicalpublications
• WonBravoawardsfortwoconsecutiveyears,onepersonselected
Montalvo Computer Systems Pvt. Ltd.: Design Engineer 1
• Moduleleaderformicrocontrollerdesign
Conexant (India) Pvt. Ltd.: Software Engineer
• LedIndiateamtowinUSD5millionworthpowerlinecommunicationdesign
Saurabh Jhamb
English, Hindi
Master in Finance and Control, Dept of Financial Studies, University of Delhi
B.A. (Hons.) (Economics), Shri Ram College of Commerce, University of Delhi
4 years 11 months of experience in ITES/BPO industry.
Genpact Ltd.: Senior Consultant - Catastrophe Pricing
• Estimatedlossandpremiumforreinsurancepoliciescoveringnaturalcatastrophicrisk
• WorkedonCatastropheBonds,insuranceproductsrelatedtoterrorismandState Catastrophe Funds
• Analysedcatastropheexposedbooksforcapacityallocationandprovidedrealtime loss estimates
• Trainedreinsuranceunderwritersofclientoncatastrophepricing
• WonthecrucialbusinessfromtheNewYorkofficeofSwissReinsuranceCorporation
Saurabh Verma
English, Hindi
AFP, International College of Financial Planning, Financial Planning Standards Board, India
B.Sc.(Hons.)(Maths),SriVenkateswaraCollege,Universityof Delhi
4 years 9 months of experience in Education & Financial Services industry.
Bajaj Capital’s International College of Financial Planning: Senior Manager - Strategic Education
• Strategictie-upsforexchangeprogrammesandcorporaterelationsforplacements
• Handledcoursesonpersonalitydevelopmentandcommunicationskills
• 100%placementsofstudentsatpan-Indiacampuses
• LaunchedFuelSourceManpowerSolutions(ExecutiveSearchCompany)forBajaj Capital
Fidelity Business Services India Pvt. Ltd.: Customer Relations Executive and Business Continuity Planner
• HandledescalatedqueriesasperFSAprocedures
• HandlingbreachdepartmentandMIStoseniormanagement
• PlatinumAward-highestindividualaward
• BestNewcomerAward
Saurav Atri
English, Hindi
Bachelor of Applied Sciences (Electrical Engineering), University of Windsor
4 years 3 months of experience in Engineering industry.
Technico Industries Ltd., Bawal, Haryana: Chief Operating Officer
• Setupanewplant(300workmen)formanufactureofautoparts
• StreamlinedthesupplychainandERP(50members)
• Productionplanningforassemblyshop
Leggett and Platt Automative, Windsor, Ontario: Control Systems Engineer
• Retrofitedmajorautomatedlines
• Trainedengineersandskilledtradesonautomation
• Ledthecontinuousimprovementteam-PlantAutomation
Hastech Mfg, Linamar Corporation, Ontario: Manufacturing Controls Engineer
• Programmedrobots,logiccontrollers
• Implemented5Sandleanmethodology
• Improvedoperatorhealthandsafety
Sawan Sethi
English, Hindi, Bengali
CA, ICAI
B.Com. (Hons.), St. Xavier’s College, University of Calcutta
4 years 8 months of experience in Consulting & Banking industry.
PricewaterhouseCoopers: Senior Consultant
• PartofEnergyandPublicEnterpriseReformsgroups under PwCs GRID practice
• Involvedinprojectsondisinvestments;performanceimprovementofelectricity utilities
Citibank NA: Assistant Manager
• AspartofCorporateBank,ledCashManagementSolutionsteaminKolkata
• HandledmigrationofpaymentplatforminKolkatabranch
PricewaterhouseCoopers: Consultant
• Involvedindevelopingrestructuringstrategiesforpublicenterprises
• Involvedinsuccessfulprivatisationof3enterprisesofGovernmentofWestBengal
Sayak Dey
English, Hindi
CA, ICAI
B.Com. (Hons.), Shri Ram College of Commerce, University of Delhi
4 years 7 months of experience in Consulting industry.
PricewaterhouseCoopers: Assistant Manager (Tax & Regulatory Services)
• ProvidedholisticbusinesssolutionsandrepresentationservicestoMNCs(Oil&Gas domain)
• Partofteamimplementingaschemeofmergeranddemergerforalistedcompany (3 stock exchanges)
• InstrumentalinwinningacaseinvolvingdisputeofINR15billionatTribunalLevel
• Co-authouredanarticlepublishedin‘TheHindu’andPetrofedjournal
SR Batliboi & Co. (member Firm of Ernst & Young India): Executive (Taxation)
• TPdocumentation/presentation
GE India Business Services Pvt. Ltd.: Senior Officer
• DesignedanddocumentedTPpoliciesofGEHealthcareentities
Shally Gupta
English, Malayalam
BS (Electrical/ Computer Engineering), Calvin College, Grand Rapids, Michigan
4 years 2 months of experience in Diversified Manufacturing industry.
Emerson Process Management: Principal Engineer
• Createdandconductedtestplans,established timelines and scope, generated reports and recommendations
• Ledprojectstostandardisecustomerinterfacesacrossproductlines
• RestoredBPprojecttoscheduleandcostparametersbyutilisingbestpractices
• DesignedcontrolsystemarchitectureforBPTexasCity
ABB Inc.: Engineer - I
• ImplementedABBsystemforChevronsWestAfricaGasPipeline
• Managedsubcontractorswork,providingtrainingandassigningwork
Sharon Abraham
English, Hindi, Maithili
MS (Transportation), University of Missouri
B.Tech. (Civil), IIT Chennai
5 years 5 months of experience in Engineering industry.
ICON Consultant Group Inc.: Transportation Engineer/Planner
• Performedtechnicalanalysisanddesign
• NegotiatedoverUSD5millioninImpactFeesforUniversityofSouthFlorida
• Preparedproposalsandco-ordinatedwithclients(Public&Private)
• DevelopedefficientdesignandcalculationproceduresfortheTrafficDesignGroup
Post,Buckley,Schuh&Jernigan,Inc.:TransportationEngineer
• Interpretedtrafficdataandforecastfuturetraveldemand(roadsector)
• Performedoperationalanalysisandrecommendedsolutions
• Presentedfindingstoclient(Government)
• Presentedfindingsreviewofstudiesconductedbyotherfirms
Shashi Ketu
English, Hindi
B.Tech. (Information Technology), College of Technology, Govind Ballabh Pant University of Agriculture & Technology, Pantnagar
4 years 6 months of experience in IT (Services) industry.
Tata Consultancy Services Ltd.: Assistant Systems Engineer
• LedateamtomigrateOpenSourceproductsforNonStopenterpriseserversplatform
• ManagedclientrelationshipforHPBenchMarkProductsSuite
• Reducedperformance-footprintofHPflagshipserverby300%in4months
• Wonpitchesfor2developmentprojectsfromHP
• ManagedoperationsofteamworkinginTransactionServicesGroup
BlackBull Investments: Co-founder
• Co-founderofastart-upinretailinvestoreducation
Shivam Gupta
English, Hindi, Gujarati, Marathi
B.E. (Computer Science), Mahavir Education Trust’s Shah Anchor Kutchi Engineering College, University of Mumbai
5 years 7 months of experience in IT (Services) industry.
Dave Shah & Co. Switchgear Pvt. Ltd.: Director
• Startedanewbusinessverticalbyprovidingend-to-end electrical solutions
• DeployedERPtoreduceoperatingcosts,aidday-to-daymanagementandsupport strategic planning
• Inventorymanagementandvendordevelopment
Satyam Computer Services Ltd.: Associate Consultant
• WorkedonERPprojectsacrossdomains
• 100%resolutionofallclientissueswithintheSLAtime
Godrej Infotech Ltd.: Programmer Analyst
• ERPprogrammingandadministration
• TechnicalLeadforERPimplementations
• Involvedin3ERPimplementations
Shivang D Dave
English, Hindi
B.Tech. (Civil), IIT Guwahati
5 years 8 months of experience in IT (Products and Services) industry.
Oracle India Pvt. Ltd.: Project Leader (Supply Chain Planning)
• ManageddevelopmentandreleaseeffortsforDemand Signal Repository product at IDC
• Leddevelopmentteams(6members)formultipleproductsinValueChainPlanning area
• Designedandevaluatedtechnicaldesignsfordatawarehousingandanalytics
• AppreciationforoutstandingcontributioninsuccessfulreleaseofAPCCandDSR products
• Recruitmentpanelistincampusandwalk-inrecruitmentdrives
Tata Consultancy Services Ltd.: Assistant Systems Engineer (Group Insurance)
• Developedsoftwaresupportforpricingdecisionsforaglobalmajor
Shreyans Daga
English, Kannada
B.E.(ComputerScience),RVCollegeofEngineering,VisvesvarayaTechnologicalUniversity
4 years 9 months of experience in IT (Products) industry.
Cisco Systems Inc.: Software Engineer
• Leda3memberteamonFaulthandlingforVPN failures
• WorkedonIn-servicesoftwareupgradeproject,reducingboottimeoftherouterfrom 5 minutes to 5 seconds
• Formedandleda6-memberteamoncertificationeffortsforcustomers
• WorkedonIPRANsolutionforMotorola;projectrevenueUSD65millioninthenext one year
• Front-endedMGXIndiateamforcustomerescalation
Shruti Purohit
![Page 37: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/37.jpg)
72 73
English, Hindi, Bengali
B.Tech. (Computer Science), ISM Dhanbad
5 years 8 months of experience in IT (Products) industry.
ARIENE Inc.: Programmer Analyst (Project Lead)
• Analysedanddesignedglobalsoftwarearchitectureof AIG Life Insurance in close liaison with the CTO
• LedateamatAIGLifeInsurancetodevelopLifeInsurancesoftwaresforbranch offices worldwide
Oracle India Pvt. Ltd.: Member Technical Staff
• ManagedProductOwnershipofOracleBusinessIntelligenceProductsuite
• DevelopedBusinessIntelligencesoftwaresolutions
Infosys Technologies Ltd.: Software Engineer
• DeliveredseveralhighworthprojectsforFortune500clients
• MemberofCenterofExcellenceTeaminContentManagementdivision
Shubhra Maji
English, Hindi, Bengali
B.Tech. (Computer Science), IIT Roorkee
4 years 9 months of experience in IT Products industry.
Oracle India Pvt. Ltd.: Senior Applications Engineer
• Designed,developednewfunctionalitiesforOracle Fusion
• Ledprojectstoenhancesecurity,decreasecustomerupgradedowntime
• Institutionalisedprocessestoincreasedevelopment-teamefficiency
• Implementedmorethan90bugs(67fixes,23features),lowestratioofbugs reopened to bugs fixed
• Reviewed60bugscomparedtoanaverageof25bypeers
Solidcore Systems (McAfee): Software Engineer
• Developed,testednewfeaturesofproductinhighlychargedentrepreneurial environment
Shukti Das
English, Hindi, Oriya, Bengali, French
B.E.(MechanicalEngineering),VishveshwaryaNationalInstitute of Technology
4 years 8 months of experience in Aerospace and Automobile industry.
Indian Space Research Organisation: Scientist Engineer C
• Co-ordinationwithmultipleteamstoevolvethe optimisedLaunchVehicleconfiguration
• Test,integrationandhandlingstagesandsub-assemblies
• Realisedcomponentsforsub-assembliesandstages
• Designed,integratedandtestedMoonImpactProbeofChandrayaanmission
• In-housetrainingworkshop
Bajaj Auto Ltd.: Engineer
• Improvedproductivity,qualityofcellsintheshopwiththeimplementationofTPM
• Reduceddeliverytime
Shuvashish Chatterjee
English, Hindi, Malayalam
B.Tech. (Electrical Engineering), NIT Rourkela
5 years 9 months of experience in IT (Services) industry.
Cognizant Technology Solutions: Senior Associate - Projects
• Ledandmanagedteamsworkingonsoftware maintenance and development projects
• Handledprojectestimationandresourcemanagement
• Consultedonsoftwareandprocesschangesforoverallsystemimprovementsand cost savings
• ProposedandimplementedaprojectthatsavedourclientoverUSD7million annually
• WorkedonclientlocationsintheUSA
• Startedprojectsandgrewthemintoprofitablebusinessaccountsforthecompany
Siddharth Rajiv Nair
English, Hindi
B.Tech. (Computer Engineering), Sikkim-Manipal University
4 years 11 months of experience in IT (Services) industry.
Encora Technologies Pvt. Ltd.: Module Lead
• Workedoninternettrawlingteamtogathershopping related data for Google Base and Google Product search
• Increasedthescopeandproductivityofmyteamresultinginhighercustomer satisfaction
Infosys Technologies Ltd.: Software Engineer
• CustomersupportinterfaceforRiskAnalystsatGoldmanSachsforDailyand Quarterly reporting needs
• WorkedonvalidationofCreditPricingmodelfromtechnologyperspective
Siddharth Raman Singh
English, Hindi, Punjabi
B.E. (Computer Science), Thapar Institute of Engineering and Technology
4 years 8 months of experience in IT (Services) industry.
Deloitte Consulting LLP: Consultant
• ClientFacingOnsiteLeadinUSAforDataMigration, managing offshore team in India
• Requirement-Analysis,Scope-Design&EstimationinProcuretoPay&FinancialERP
• WorkedaspartofDeloitteRFPteamtoestimateprojectscopewhilebiddingfor Global ERP consulting projects
CSC India Pvt. Ltd.: Software Engineer
• DesignanddevelopmentofOracle-EBSRICEcomponents
• 6certificatesofappreciationforoutstandingworkin3years
• NominatedforCSCEmployeeofQuarterandCSCWorldwideTechnicalExcellence Award
Simrandeep Singh Parmar
English, Kannada, Marathi
B.Tech.(InstrumentationTechnology),SJCE,VisvesvarayaTechnological University
4 years 8 months of experience in Consumer Products industry.
Taylor Nelson Sofres (TNS) India Pvt. Ltd.: Research Executive
• Recommendedclientchangeadvertisingstrategy,thatincreasedsalesby15%
• Ensuredfieldworkcompletionevenduringfloodsandterroristattacks
AC Nielsen Bases: Team Leader
• WorkedontheconceptandproducttestingforClorox’sGreenWorks,andP&G’s Ariel Green concept, the first green products launched by these companies
• Designedandimplementedbusinessprocessesintheglobalresearchcentre,of AC Nielsen Bases, India
Wipro Technologies: Project Engineer
• Rebrandedasalesportalsinglehandedly
Sindhu V Kakade
English, Telugu
B.E. (Electronics & Communications), ANITS, Andhra University
4 years 9 months of experience in IT (Services) industry.
Mahindra Satyam: Developer
• WorkedonImplementationofCollectionsandBilling system for Ericsson UK and Ireland
• WorkedonRomanianrolloutofUKCollectionssystem
• DevelopedamiddlelayerapplicationforrealtimeintegrationbetweenBillingand Collections
• ImplementedRetailPointofSalesystemfor‘3’UKtomanagestoresales
• HandledtheFirepondemailmanagementforContactCenterof‘3’UK
Sireesha Dandu
English, Hindi, Kannada, Marathi
B.E. (Information Science), PES Institute of Technology, VisvesvarayaTechnologicalUniversity
5 years 5 months of experience in IT (Services) industry.
Dell Perot Systems: Technology Specialist
• Ledateamtobuildworkflowapplicationtoenable service booking, execution and fulfillment for largest relocation company in USA
• Customerinterfacetoplanproductroadmap
• Workedwiththeresource-managementteamfortheUSD4millionaccount
• Wasrated‘exceptionalperformer’everyyear
Smitha Vijendra Purohit
English, Hindi
MS (Electronics and Computer Engineering), The University of Birmingham
B.E. (Hons.) (Electronics and Software Engineering), The University of Birmingham
4 years 11 months of experience in Telecommunications industry.
Ericsson: Local Customer Manager
• RepresentedEricssonIndiaonGlobalR&DIntegrationproject
• EstablishedSLAswithallclients
• DevelopedTestEnvironmentsforclientsinIndia
• SetupEricsson’sGlobalTrainingAcademyinGurgaon
Ericsson UK: Computer Systems Engineer
• Upgradationofclient’snetworksfrom2GMobileTechnologyto3GTechnology
• EricssonUK’srepresentativefortwoproprietarysolutions,implementedacrossthe globe
Interesource Ltd.: Developer
• Improvedin-housecontentmanagementsystem
• Workedoneononewithclienttodeveloptheirportal
Somi Rai
English, Hindi, Tamil, Malayalam
BS (Computer Science and Engineering), Nanyang Technological University, Singapore
4 years 9 months of experience in IT (Services) industry.
IBM Singapore Pte Ltd.: Bid Manager, Asean Deal Hub
• Workedwithmulti-functionalteamstodevelop competitive proposals to win business opportunities
• Handledproposalsforfinance,educationandtravelsectorsofvalueUSD0.5-45 million with a success rate of 65%
• LedinitiativetomentorandtrainthebidmanagersinVietnam
IBM International Holdings: Software Engineer (Supply Chain Management Domain)
• SingaporeTeamLeadforarealtimewarehousetrackingprojectforNestle
• ProgrammemanagerforISCInventorAwakeningprogramme
Sowmya Ramakrishnan
English, Hindi, Marathi, Telugu, French
Dual Degree - B.Tech. and M.Tech. (Civil Engineering), IIT Madras
4 years 10 months of experience in Construction industry.
CRISIL Risk and Infrastructure Solutions Ltd.: Manager
• Managedteamsonconsultingassignmentsforurban infrastructure projects
• Workedondemandstudies,financialfeasibility,projectstructuringandrisk assessment, bid process management
Tamil Nadu Road Development Company (TNRDC) Ltd.: Project Engineer
• ResponsibleforsitesupervisionandapprovingcontractorsworkonITCorridor project in Chennai
Road Infrastructure Development Company of Rajasthan (RIDCOR) Ltd.: Project Engineer
• InvolvedinallstagesofMegaHighwaysproject-reviewofdetailedProjectReports, selection of contractors, project implementation and co-ordination with government agencies
Srikrishna Chaitanya Gujjar
![Page 38: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/38.jpg)
74 75
English, Telugu, German
MS (Computer Science), Amherst, University of Massachusetts
BS, Amherst, University of Massachusetts
5 years 5 months of experience in IT (Products) industry.
EMC Corporation: Senior Product Manager
• ProductStrategy
• Managedproductmanagementinitiativesforcoreportfolioproducts
Srinath Gaddam
English, Hindi, Kannada, Konkani, Tulu, French
B.E. (Electrical & Electronics Engineering), NIT Suratkal
4 years 8 months of experience in Automation industry.
Honeywell Technology Solutions Pvt. Ltd.: Senior Engineer
• TechspecialistintheAvionicsdomain,withproven functional excellence in Test Instrumentation &
Automation, Product Innovation, Project Management and Six Sigma implementation
• SixSigmaGreenBeltandtrainer,recognisedfortrainingexcellencein2008and2009
• YoungestrecipientoftheHoneywell‘All-Rounder’award,forexcellenceatworkand in extracurricular activities
• WontwoPartnerAwardsfromcustomersforexceptionalprojectexecution
Subhas Harishchandra Sumithra
English, Hindi
Dual Degree - B.Tech. and M.Tech. (Chemical Engineering), IIT Bombay
4 years 8 months of experience in Consulting industry.
KPMG Advisory Services: Management Consultant
• AdvisedclientsinInfrastructure,ConsumerMarkets, Healthcare, Travel & Leisure, and Financial services
• StrategyConsulting/BusinessPlanningfordomesticclients,MarketEntryStrategyfor foreign clients
• TransactionAdvisory-Commercial/FinancialevaluationofpotentialtargetsforPE investments (Buy/Sell)
• OperationsConsulting-BusinessProcessRe-design,Supply-chainoptimisation, Large scale Transformation for private/ public sector
• Consistentexceptionalperformance,2successivepromotions
• Co-developedThoughtLeaderships,pioneeredCSReducationinitiative
Sudeep Laad
English, Hindi
B.Tech. (Civil Engineering), IIT Roorkee
5 years 7 months of experience in IT (Services) industry.
Tata Consultancy Services Ltd.: Information Technology Analyst
• Ledhomeloanadministrationapplicationupgrade costing USD 8.2 million-reduced operational costs by 50%
• BuiltapplicationtoanalyzetheJPMCmortgageservicingapplication,involving150 personmonthseffort;developedaninductionprocessfortheproject
• Trained20resourceswhiletransferringTCSdevelopmentcenterfromNoidato Bangalore
• Streamlinedtrainingfor60resourcesacross3functions-homefinance,autofinance andIVRS,increasingmonthlyrevenuebyUSD100,000
Sudhir Kumar Sharma
English, Hindi, Marathi
B.E. (Electronics & Telecommunications), Pune Institute of Computer Technology, University of Pune
5 years 6 months of experience in IT (Products) industry.
KPIT Cummins Infosystems Ltd.: Senior Software Engineer
• TeamLeadforproductdesignlifecyclesincluding system programming for industrial automation
• LedaprojectonnetworksensorsforOilTanksvaluedatEuro225,000
• Initiatedqualityprocessessuchasautomateddocumentationandregression analysis
Embedded Computing Machines: Senior Embedded Engineer
• Team-leadforproductdevelopmentofembeddedsystemframeworks
• DesignedanddeliveredcustomisedtrainingmodulestoinstitutessuchasC-DAC
Persistent Systems Pvt. Ltd.: Member of Technical Staff
• ResearchworktowardsaknowledgemanagementsystemthroughOpenSource collaboration
Sudip Ajit Shah
English, Hindi, Punjabi
CA, ICAI
B.Com.,DAVCollege,Amritsar,GuruNanakDevUniversity
4 years 4 months of experience in Transaction Structuring Advisory industry.
S.R. Batliboi & Co. (member firm of Ernst & Young): Manager
• Managedend-to-endtransactionstructuringprojectsandclientrelationships
• Developedregulatoryandtaxsolutionsforfunding,restructuring,andacquisitions
• SelectedforAcceleratedCareerPath,whichresultedinadoublepromotion
• AdvisedonadebtfundingtransactionworthUSD5billion
• Led,developedandcoachedateamoftenpeople
Anmol Sekhri & Associates: Trainee
• Valuedcompaniesandbrands
Suhas Khullar
English, Hindi, Oriya
B.Tech. (Electronics and Communications), NIT Warangal
4 years 9 months of experience in IT (Products) industry.
Oracle India: Senior Applications Engineer
• DevelopmentofHumanCapitalManagementmodules for Oracle Fusion (ERP)
• Ledateamforautomatedunittesting,whichimprovedefficiencyofDevelopment Team by 12.5%
• DevelopedcompletesolutionsforDutchHumanResourceManagementlegislative reports, which led to a 300% drop in time taken to produce reports
• Receivedteamrecognitionawardforacriticalautomationprocessfor9,000 employees
Suman Mohanty
English, Hindi
CA, ICAI
B.Com. and M Com., Sydenham College of Commerce & Economics, University of Mumbai
4 years 9 months of experience in Consulting industry.
KPMG: Assistant Manager
• AccountingadvisoryonIFRS,USGAAPandIndianGAAP
• LedIFRSconversionprojectsforcompaniesinconsumer-goods,mining,mediaand BPO industries
• WrotewhitepaperonimpactofIFRSonmediacompanies
• Conductedtechnicaltrainings
• Assistedinbusinessdevelopmentactivities
BSR & Co (member firm of KPMG in India): Assistant Manager
• Conductedfinancialstatementsauditsandduediligences
• Keyresponsibilities-project,teamandclientrelationshipmanagement
• SecondedtoKPMGUKtolearninternationalbestpractices
Sumit Maheshwari
English, Hindi, Punjabi
Executive Program in Applied Finance, IIM Calcutta
PGDM (Agri-business), National Institute of Agricultural Extension Management
BachelorofVeterinaryScience,CollegeofVeterinary&Animal Science, Rajasthan Agricultural University
5 years 8 months of experience in Commercial Banking industry.
Kotak Mahindra Bank Ltd.: Chief Manager (Corporate Banking - Large Corporate Group)
• AcquisitionandmaintenanceofCorporateRelationshipsforthebank
• Handledvariousproductslikedebtandequitycapitalmarketproducts,treasuryand derivatives, working capital, etc
• HandledtwoofthelargestCMSandsecuritisationdealsfortheBank
• Selected‘YoungAchieveroftheYear’inFY2007
• Selected‘BestRelationshipManager’inFY2008
Sumit Sachdeva
English, Hindi
B.E. (Electrical and Electronics), NIT Suratkal
4 years 8 months of experience in Electronics industry.
Ittiam Systems Pvt. Ltd.: Senior Engineer
• LedtheMPEGbasedvideoCODEC’sproductlinefor Cisco’s Telepresence solution
• WorkedonaninnovativeunderwatersurveillanceproductforLockheedMartin
• Workedonencoding/decodingprocessesonclient-servermodelforaninflight entertainment system
• Contributedtoproductmanagementinitiativesbyinteractingwiththecustomers across the globe and providing technical as well as pre-sales support
Sushmita Sharma
English, Hindi
CA, ICAI
B.Com. (Hons.), Hansraj College, University of Delhi
5 years 8 months of experience in Financial Services industry.
Macquarie Group Ltd.: Executive - Fund Accounting
• Migratedtax/financeworkforPEfundsfromSydney; reported directly to Sydney Associate Director
• PreparedmonthlyinvestorreportsforPEfunds
• SavedEuro2.3millionintaxcreditsthroughkeyfinancialsanalysisforGermanPE fund
Emaar MGF Land Ltd.: Assistant Manager - Management Assurance Services
• Implementedriskmanagementstrategies/practicesacrosslocationsinIndia
• RepresentedEmaarsuccessfullyincommercialsitebidding
Lovelock and Lewes (PricewaterhouseCoopers): Assistant Manager - Assurance and Business Advisory Services (ABAS)
• ReporteddirectlytopartneronSOX,USGAAP/IFRSaudits
• Highclientsatisfactionrating(5.5/6)onkeyassignments
Tushar Agarwal
English, Hindi
M.Tech. (Computer & Information Technology), IIT Kharagpur
B.Tech. (Computer Science), IIT Kharagpur
4 years 11 months of experience in IT (Products) industry.
Microsoft R&D Pvt. Ltd.: Software Development Engineer - II
• Led3engineerstodesignanddevelopcomponentsofMicrosoftCRM(Customer Relationship Management)
• PatentforextensiblechartingengineforMicrosoftCRM
• Patentfornewmethodtodetectduplicatesinbusinessdata
• MicrosoftGoldstarawardforcross-teamimpact
• Conceivedapeer-feedbackmechanismtomeasuresoftperformanceaspectssuch as quality, teamwork
• MicrosoftIndia2009InnovationAwardforbestdesignamong75projectsdeveloped in India
Tushar Bhatia
![Page 39: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/39.jpg)
76 77
English, Hindi
CFA, The Council of Chartered Financial Analysts, India
M.Sc. (Finance), ICFAI University
B.Com. (Hons.), St. Xavier’s College, University of Calcutta
5 years 11 months of experience in Manufacturing industry.
VedantaResourcesPlc.:ProductManager-PrimaryProducts
• Sales&MarketingofPrimaryAluminiuminEasternIndia(exceptChhattisgarh)- increased sales by 288% in 6 months
• Suggestedimplementablewaystoincreaseproductivityby30%forRolledProducts (RP) division
• DevelopedProductivityandCostingModelforRPdivision
• ‘StaroftheBusiness’Award
• Expandedintonewgeographies-SriLanka,Greece,Nigeria(AluminiumFoils Division)
Narayani Nitwel Pvt. Ltd.: Executive
• Assistedinsettingupthenewproductionunit
Uday Sanganeria
English, Hindi
CA, ICAI
B.Com. (Hons.), Shri Ram College of Commerce, University of Delhi
4 years 7 months of experience in Financial Services industry.
KPMG, Transaction Services: Senior
• PartoftheduediligenceteamonM&Atransactions
• Analysedfinancialstatementstoidentifyissuesandthenrecommendstepsforrisk mitigation
• Assistedclients(sellside)insettingupdataroomsandmanagingbuyer’sdiligence teams
PricewaterhouseCoopers: Associate
• Responsibleforentireauditfieldworkatclientlocations
• MaintainedrelationshipswithAuditClient’smanagementteam
Arren & Arren: Engagement Manager
• Managedclientrelationships
• Responsibleforentireexecutionoftheauditprocedure
Vaibhav Arren
English, Hindi
B.A. (Hons.) Fashion Merchandising and Production Management, Pearl Academy of Fashion, Nottingham Trent University
4 years of experience in Retail industry.
Landmark Group - Splash: Store Manager
• Research:FashionTrends/Competition/Retail technology
• Achievedgrowthof13%insalesrevenue
• Improvedconversionratioby10%
• Ledateamof40peopleofdifferentnationalities
ITC Ltd.: Assistant Manager Merchandiser
• Achievedannualgrowthof20%deliveringbusinessofUSD6million
• On-timeshippingimprovedby30%
Triburg Sportswear: Merchandiser
• Achievedagrowthof25%inrevenuewithin1styearofoperations
• PromotedfromAssistantMerchanttoMerchant
Varun Handa
English, Hindi
B.E. (Instrumentation and Control), Netaji Subhas Institute of Technology, University of Delhi
4 years 8 months of experience in IT (Products) industry.
Ittiam Systems Pvt. Ltd.: Senior Engineer
• Designing,developingandproductisingvariousVideo Compression algorithms on microprocessor based DSP Systems
• OwnedtheH264encoderproductandwasresponsibleforitsprogress,qualityand performance during entire life cycle
• Mentoredjuniors,planningandreviewingtheirwork,facultyforinitiationandtraining programmes
• CompanyrepresentativeforastrategiccustomerinUSA.Convertedrequirements to technical specifications, feasibility analysis, effort estimation, presented the designed solution
Varun Rai Bansal
English, Hindi, Tamil
MBBS,JIPMER,PondicherryUniversity
4 years of experience in the Pharmaceutical and Healthcare industry.
RxMD Pharmaceutical Physicians Pvt. Ltd.: Clinical Scientist
• Closelymonitoreddynamicsofglobalmedical emergency;involvedinauthoringrelevantmanuscriptforpublication
• Co-authoredreportservingasbasisforhealth-authorities’drug-useguidelinesfor at-risk population
• DevisedRiskManagementPlanforadverseeventsfrommilliondollardrug(inat-risk population)
• AuthoredsectionsofDrugSafetyReportsevaluatingneedforchangeindrugsafety profile
• Preparedguidancedocumentsforglobalpharmaleaderforreleasing/withholding microbe-contaminated drugs
SRM Medical College Hospital and Research Centre: Resident/Tutor
JIPMER:MedicalIntern
Vedhavalli S
English, Hindi, Tamil
MS (Optics and Photonics), University of Alabama, Huntsville, USA
B.E. (Electronics and Communications), Dr M G R Engineering College, University of Madras
4 years 6 months of experience in Manufacturing industry.
Photonics Industries International Inc.: Laser Engineer
• Ledmanufacturingteam,productdevelopmentandsetupqualityandreliability criteria
• Trackedandmonitoredteamperformanceagainstcustomerexpectations,setup project schedules
• Providepreandpostsalessupportandliaisebetweencustomersandengineering
• Introducedinnovativetechniquesinproductionandqualitycontrol
Laser Propulsion Group: Graduate Research Assistant
• Set-upprojecttimelines,teammeetings&monitorteamandindividualprogress
• WorkedonJointAirForce&NASAfunded(JANNAF)project
Venkata Krishnan Mukundarajan
English
B.A. (History), Dartmouth College
5 years 8 months of experience in ITES/BPO industry.
ClutchGroup,LLC.:VP-Marketing
• SourcedlegaloutsourcingassignmentsfromUS Fortune 500 companies and AMLAW 200 law firms
• AssistedtheacquisitionandmergerofJuriMatrixwithClutchLegaltoformClutch Group
• Contributedtogrowingtheteamfrom3to200
Accenture: Service Manager
• QualityManagement
• SLAManagement(HR,Insurance,F&AandCallCentreClients)
• VendorManagement
• Trackedcenter-widemetrics
Weil, Gotshal and Manges LLP: Corporate Paralegal
• Assistedlargetransactions
• Maintaineddealdocuments
Vijay Rao
English, Hindi
B.Tech. (Electronics and Communications), NIT Hamirpur
4 years 8 months of experience in IT (Products) industry.
Wipro Technologies: Project Engineer
• Designed,developedandsupportedLayer3DSL multiplexer for Alcatel Lucent
• Managednetworkedenvironmentofhardwareandsoftwareprovidersandclient resulting in better synergy
• Prunedswitchsoftwaretoimprovemaintainabilityresultingin50%decreasein defect rate
• Designednewfeatureonswitchforbetterfaultdetectionandselfcorrection
• Mainorganiserforteambuildingandstressrelievingactivities
• Recognisedforexceptionalsupportfromclient
Vikas Saroha
English,Hindi,Japanese
M.A. (Economics), School of International Studies, JawaharlalNehruUniversity
B.A. (Hons.) (Economics), St. Stephen’s College, University of Delhi
4 years 2 months of experience in Consulting industry.
Deloitte Research - Deloitte Services LP (USA): Senior Analyst
• Engagedwithseniorpartnersasmemberofstrategicresearchgrouptoproduce thought leadership reports for business development
• Co-authoredreport‘MaximizingROICtodrivegrowthinconsumerproducts’
• Managedprojectdeadlinesanddeliverablesincollaborationwithkeyseniordirectors and partners
• LedresearchforreportonChina’sretaillandscape
• DevelopedcasestudiesofUSPharmaceuticalcompanies
Confederation of Indian Industry: Executive
• PreparedbriefsandwhitepapersonWTOissues
Vinay Hukumchand
English , Hindi
BBA, University of Texas, Austin
4 years 6 months of experience in Consulting industry.
Ernst & Young US LLP: Senior (Performance Improvement)
• EngagementsincludeSOX404,mortgagereviewand process improvement work in Energy and Financial
Services domains
• Builtamortgagecalculatorimprovingconfidencelevelsby95%andachievingcost savings of USD 200,000
• Developedanddeployedlossmitigationsolutionsinatargetedgeography,saving USD 50 million
• LedSOXengagementforanOil&GasgloballeaderinAustralia
• AppointedPeerAdvisorfornewrecruits
Vinay Pamnani
English, Hindi, Kannada
B.E.(Electronics&Communication),RVCollegeofEngineering,VisvesvarayaTechnologicalUniversity
5 years 8 months of experience in IT Products industry.
SAP America Inc.: Consultant
• Managedupto8accountswithcombinedsupport revenue of USD 6 million
• HandledcriticalcustomersituationsbyinvolvingrelevantpartyinsideandoutsideSAP
• Providedtechnicaladvisoryserviceforthedesignofend-to-endbusinesssolutions
• TwoServiceAchievementAwardsin2008forcontributionsatNewYorkTimes
• Involvedinpre-salesactivities;Productdemostoclientexecutiveteams
Sap Lab (India) Pvt. Ltd.: Software Developer
Vineeth Gururaj
English, Hindi, Telugu
B.E. (Hons.) (Computer Systems), University of Auckland
5 years of experience in Manufacturing industry.
Rakon Ltd.: Project Engineer
• Securedakeydesignwininakeymobile manufacturer’s next generation phone (tier-1 US company)
• ManagedaNZD4.4milliongovernmentfundedhighprecisiontimekeeping (Calibrated Crystal Oscillator) project as technical lead
The Auckland Lite: Strategy and Marketing Director
• Createdcompanywithvisionofmakingitthefirstfreeweeklynewspaperfor commuters in Auckland
• Soldadvertisingspaceofupto45%oftotalrevenuein4monthsandformed partnerships
Vinod Chinni
![Page 40: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/40.jpg)
78 79
English, Hindi, Tamil, Kannada, Malayalam
LLB, Seshadripuram Evening Law College, Bangalore University
B.Com., Christ College, Bangalore University
5 years 7 months of experience in Legal Services & Audit industry.
Tata Advanced Materials Ltd.: Deputy Manager (Legal)
• Negotiated3highticketinternationalcontractsforthecompany
• Trained130employeesonExportControls
• AwardededucationalgrantbySirRatanTataTrust
Pramata Knowledge Solutions Pvt. Ltd.: Delivery Lead - Data Analysis Group
• ResponsibleforadvancedbusinessanalyticsforClientsinoutsourcingdomain
• Builtinternalcontrolsaroundcontractualinformationandprovidedstrategic management solutions
UAE Exchange LLC., Dubai: Assistant Manager - Legal, MIS and Pricing Analysis
• Drafting,vettingandreviewingAgreements,implementingantimoneylaundering policies for the entire company
Trans Movers and Packers Pvt. Ltd.: Manager (Internal Audit & Legal)
C R Nulvi and Associates: Audit Team Leader
Vinod Subramanian Sundaram
English, Hindi, Sindi, Marathi
B.E. (Computers), TSEC, Mumbai, University of Mumbai
5 years 7 months of experience in IT (Services) industry.
Emirates Bank Group: Senior Analyst
• LedtheprojecttocalculateFundTransferPricing between treasury and other units
• IntegratedCreditCardunitperformancereportingintoMIS
• AssessedsoftwarelicenseutilizationresultinginUSD100,000savings
Orient Information Technology Ltd.: Senior Systems Analyst
• SinglepointcontactforMISrequirementsforProfitability,CostAllocationsand interest statements
NSE Infotech Services Ltd.: Associate System Analyst
• LedF&OData-MartProjecttoenableassessmentofperformanceofF&Osegment
Vishal Motwani
English, Hindi, Punjabi
B.E. (Mechanical), Delhi College of Engineering, University of Delhi
5 years 9 months of experience in Energy industry.
Hindustan Petroleum Corporation Ltd.: Project Engineer
• Received500crossingsapprovals,75daysearlierthan expected date for the project of INR 4.5 billion entailing
laying of an underground finished product pipeline
• PublicationofGazettenotificationanddisbursementofcompensationforland acquisition in record time
• Energysavingsthroughinnovationslikecommissioningofsolarsystematoutlets
• Commissioningof7outletsinUttarakhandenablingHPCLtoattainmarket leadership
Godfrey Philips India Ltd.: Graduate Engineer Trainee
Vishal Sharma
English, Hindi, Punjabi
B.Tech. (Computer Science), Main Campus, Guru Nanak Dev University
4 years 5 months of experience in IT (Products) industry.
Microsoft R&D Pvt. Ltd.: Software Design Engineer/Test 2
• WinnerofMicrosoftIDCInnovationAward2009,for development of Automation Health indicator which saved USD 2 million in costs
• ReceivedGoldStarAwardforExecutionexcellenceforhandlingcriticalsituations such as security attacks by hackers
• Promotedtwiceinaspanof3years,forsuccessfullyexecutingmilliondollarprojects
Wipro Technologies: Project Engineer
• WontheBestDeliveryManagerAwardintheProjectLifecyclecompetitionarranged for new joiners
Vishesh Sethi
English, Hindi, Tamil
M.Sc. (Biological Sciences) and B.E. (Electrical & Electronics), BITS Pilani
5 years 6 months of experience in High Technology industry.
QualComm Inc.: Senior Engineer
• BenchmarkingandOptimisationofQualcommAndroid Solution
Mediatek (India) Pvt. Ltd.: Software System Design Engineer II
• TechnicalinterfacewiththeMarketingteamforRFWSGSM/GPRSWireless baseband product definition
• ProjectLeadforValidationactivitiesinHyderabad
Analog Devices (India) Pvt. Ltd.: Software Systems Design Engineer II
• ProductdefinitionforWirelessBasebandchipset,AGPStechnology
• SystemAnalysisandBenchmarking
• DeviceDriverDevelopmentandValidation
Visweswaran Gowrisankaran
English, Hindi, Tamil
Bachelor of Law (Hons.), Cardiff University, UK
4 years 3 months of experience in Consulting industry.
Deloitte Consulting: Business Analyst
• Conductedstrategicsupplychainanalysis,identified USD 185 million in savings for a global LCD manufacturer
• IdentifiedUSD125millioninsavingsforaninternationaloilshippingcompany
• FoundingmemberofDeloitteAdvancedAnalyticsGroup
QuisLex, Inc.: Project Manager
• Ledoneoftheworld’slargestcorporateforensicinvestigations(80-memberteam, 40+countries)
• Managedindustry’sfirstlarge-scaleoffshoreantitrustanalysis(100-memberteam)
• Spearheadedinitiativetoachieveenterprise-wideISOaccreditation-industryfirst
Vivek Sekar
English, Hindi
B.E. (Electronics and Telecommunications), Government EngineeringCollege,Jabalpur,RGPV
5 years 5 months of experience in Telecommunications Industry
Aricent Technologies (Holdings) Ltd., Gurgaon: Technical Lead
• Recruitedandmanagedateamof10engineersfor3GtestinginEurope(Poland, France, Germany and UK) and Korea
• ResponsibleforUSD600,000billingbythecustomer
Invest Faith Technologies Company Ltd., Hong Kong: Consultant
• DuediligencephaseofCapitalSemiconductor,aUSD200millionstart-up
• BuiltuptheteamandprocuredIPandtestequipment,worthUSD50million
Freescale Semiconductors, Bangalore: Software Engineer
• 3GFeatureleadonFreescalechipset,handling6engineers
• Receivedemployeeexcellenceaward
Vivek Shrivastava
English, Hindi
B.Tech. (Electronics and Telecommunications), Army Institute of Technology, University of Pune
5 years 5 months of experience in IT (Services) industry.
Accel2Market: Co-Founder
• Builtcompanyfromscratchtoacashpositiveventure in 4 months
• WorkedonmarketingprojectswithITcompaniesacrossAPACandUSA
Calsoft Pvt. Ltd.: Manager - Business Development
• LedsalesteaminIndia;revenuesearnedwere50%ofcompany’stotalrevenues
• IntheUSA,handledAccountManagementforSiliconValleyandBostonAreaclients
• Closedmaximumnumberofdealsforthecompany;dealsvariedfromstart-upto Fortune 500 clients
Vivek Vikram Singh
English, Hindi
B.Tech. (Hons.) (Civil), IIT Roorkee
5 years 9 months of experience in IT (Products) industry.
Amdocs Inc.: Senior Subject Matter Expert
• Ledateamof8atAT&T,USAsupportingbusinessand product development in telecom billing segment
• DesignedsystemssavingUSD2.5millionpermonthincostsandincreased productivity by 10%
Amdocs (India) Pvt. Ltd.: Senior Subject Matter Expert
• Proposed,designedanddevelopedanOrderManagementApplication(budget USD 10 million) for Sprint, USA
Infosys Technologies Ltd.: Software Engineer
• DesignedanddevelopedamortgageapplicationforBankofAmerica
Tata Motors Ltd.: Graduate Engineer Trainee
• WorkedondesignandimplementationofTata-Daewoo(NOVUS)AssemblyLine
Vivek Vishal
English, Hindi
B.E.(IndustrialEngineering&Management),RVCollegeofEngineering,VisvesvarayaTechnologicalUniversity
5 years 8 months of experience in Consumer Products and Automotive industry.
Adidas (India) Marketing Pvt. Ltd.: Area Manager - Sales (Golf - South Asian Region)
• Grewoutletsfrom17to78
• GrewsalesfromUSD150,000in2007toUSD1.1millionin2009
• Tappednewmarkets-Pakistan,Nepal,SriLanka(USD150,000sales)
Tata Motors Ltd.: Manager - Dealer Development (Northern region)
• AsHeadofProcessActionGroup,achievedthehighestgrowthandimprovementin the region for M I P index
• Grewthedealersfrom36to44
• ContributedtoNorthernregionscoring1stinTNSSalesSatisfactionSurvey
PiaggioVehiclesPvt.Ltd.:SalesandServiceEngineer
Yuvraj Chadha
![Page 41: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/41.jpg)
80 81
UPTO 4 YEARS
![Page 42: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/42.jpg)
82 83
English, Hindi, Kannada, Tamil, Telugu
MBBS, Bangalore Medical College, Rajiv Gandhi University of Health Sciences
3 years 3 months of experience in Healthcare industry.
Columbia Asia Hospitals Pvt. Ltd.: Operations Executive
• Formulatedpolicies,SOPs,MISformatsandquality indicators across the hospital chain
• Productivity/utilisationmanagement,inventorymanagement,processimprovement and quality monitoring
• InvolvedinNABHaccreditationprocess
National Institute of Mental Health & Neuro Sciences (NIMHANS): Medical Officer
• Managedneurosurgerypatients
• Co-ordinatedstudyworkflow,identifiedinefficienciesandinstitutedcorrective measures
Bangalore Institue of Oncology: Medical Officer
Bangalore Medical College: Intern
• Managedpatientsacross7govenmenthospitals,villagehealthcamps,anganwadis and govenment schools
• Handledmorethan50patientsperday
Aarthi Rao
English, Hindi
B.E. (Mechanical Engineering), Delhi College of Engineering, University of Delhi
2 years 9 months of experience in Automobile industry.
Maruti Suzuki India Ltd.: Assistant Manager
• Conceptualised,created,andimplementedMaruti Insurance Express, a breakthrough product that generated more than a 1000 additional sales leads from Total Loss Claims
• ReducedtheIncurredClaimRatioofinsurancecompaniesby3%
• DesignedMarutiSuzuki’sin-houseonlineclaimsprocessingsystem
• SpearheadedcustomerrelationshipmanagementofinsuranceclaimsacrossIndia
• Co-ordinatorofSouthzone(115dealers)foroverallbusinessdevelopment
Abhinav Bhatia
English, Hindi
CFA, Cleared Level III, CFA Institute, USA
B.E. (Hons.) (Computer Engineering), Nanyang Technological University
3 years 9 months of experience in Financial Services industry.
Deutsche Bank, AG, Singapore: Associate
• DefinedandhelpedlaunchDBdirect,thestrategicmulti-millionEuroglobal transaction banking product, to serve as a single global internet channel
• DefinedandanalysedanewliquiditymanagementproductforDB’stransaction banking and capital markets verticals
• Received‘RecognisingandRewardingExcellence’(RARE)awardin2009fortop2% performance
• Initiatedaglobalknowledgesharingprogrammeamongallbusinessanalystswhich facilitated internal transfers
Abhinav Garg
English, Hindi
B.Tech. (Hons.) (Chemical Engineering), Institute of Engineering & Technology, Lucknow, Uttar Pradesh Technical University
3 years 8 months of experience in Energy industry.
Technip KT India Ltd.: Engineer - Sales and Marketing
• Ledteamsoftechnical/commercialexpertstoprepare techno-commercial proposals
• Handledthehigh-endtechnologyclient,AXENSandgeneratedrecordbusinessof USD 1.4 million
• Developedanewclientinpharmasector,anewsectorforourcompany
• Chosentobepartofthesix-memberteamtojointlybidwithParisofficefor international projects
• Juniormostmemberofcorporateplanningcommittee,consistingof70managers across India
Abhinav Jain
English, Hindi
B.Tech. (Chemical Engineering), IIT Mumbai
3 years 9 months of experience in Consulting industry.
ZS Associates (India) Pvt. Ltd.: Associate Consultant
• Designedcustomerstargetingstrategytooptimise sales efforts
• Streamlinedandoptimisedbrandmarketingeffortsacrosspromotionchannels
• Evaluatingpromotioneffortsandrecommendingchangestoenhanceresults
• Modeledcustomerlife-cycletoidentifyhighimpactmarketingopportunitiesand designing appropriate interventions
• Healthoutcomesresearchtoidentifyandcapitaliseondrugpurchaseandusage patterns of industry stakeholders
• Deployedonsite(US)todeliverthepreceding3projects
Abhinav Khare
English, Hindi
B.Sc. (Computer Science), Amity School of Engineering, Guru Gobind Singh Indraprastha University
3 years 10 months of experience in IT (Products and Services) industry.
Microsoft Corporation: Software Development Engineer
• Ledadesignanddevelopmentteamforanalyticsin business intelligence software
• DevelopmentleadinprojectonboardedsuccessfullyfromUSA;projectwasworth USD 5 million
• ForWindows7,developedautomationsoftware,reducingtestingtimefrom3 months to 3 days, awarded ‘IT Star’
• AwardedMicrosoft‘ITPro-Dependable’forstabilisingglobaltechnicalreporting consolidation
VerizonDataServicesIndiaLtd.:DatabaseAdministrator
• Pointofcontactforordermanagementwebsite
Abhineet Bhardwaj
English, Hindi, Telugu
B.Tech. (Naval Architecture and Ocean Engineering), IIT Madras
3 years 8 months of experience in Investment Banking industry.
Morgan Stanley India: Manager
• Involvedindesignandimplementationofsalesand operation performance reporting for top management
• Designedanintegratedproductrepositoryofallglobalinvestmentmanagement products of Morgan Stanley
• ConductedtrainingsonreportingapplicationatChicagoandNewYork
• Workedonstreamliningdevelopmentlifecycleandimprovingqualityofdeliverables
• Mentoredandguidednewrecruits
Abhiram Alamuru
English, Hindi
Dual Degree - B.Tech. and M.Tech. (Mechanical Engineering), IIT Bombay
3 years 9 months of experience in Investment Banking industry.
BA Continuum Solutions (Bank of America): Analyst
• Workedaspartofglobalcorporateandinvestment banking team to provide transactional and business development services
• DevelopedadvisoryproposalsonM&A,capitalraisingandrestructuring
• GainedexpertiseinbuildingLBO,DCFandaccretion/dilutionmodels
• CreatedacomprehensiveideageneratingproposalontheIndianrealestatemarket
• Gainedexposureintherealestate,financialsponsorsandhealthcaresectors
Abhishek Modi
English, Hindi, French
MS (Environmental Engineering), Georgia Institute of Technology
B.E. (Environmental Engineering), Delhi College of Engineering, University of Delhi
2 years of experience in Consulting industry.
Trinity Consultants, USA: Environmental Consultant
• SalesandmarketingleadinUSAandgloballyforBREEZE‘RiskAnalyst’software,an internally developed environment risk analysis software
• Primarytechnicalleaderforcompany’sfirsthumanhealthriskassessmentproject
• DevelopedGreenhousegasinventoriesandclimatechangecostanalysisfor USD 2.8 billion natural gas distribution client
• Managedthreeclientsforenvironmentalcomplianceprojects (amounting to USD 60,000)
• Achievedhighestbillableutilisation(94.8%)inAtlantaofficein2008
Abhishek Srivastava
English, Hindi, Bengali
B.E. (Environmental Engineering), Delhi College of Engineering, University of Delhi
2 years 9 months of experience in Consulting industry.
Evalueserve SEZ (Gurgaon) Pvt. Ltd.: Senior Business Analyst(EnergyVertical)
• WorkedwithanOilandGasmajoronstrategyformulation,marketassessment, competitive intelligence and industry monitoring
• Teamlead(2-4analysts)formorethan20projectsinenergysector
• Evaluatednewbusinessofferingsforthecompany
• Assistedclientexecutivesinbusinessdevelopment
• Spearheadedtheimplementationofproductivityimprovementinitiative(VBbased)in the team
• Co-ordinatedwithteamsacrossgeographiesandfunctions
Aditya Jha
English, Hindi, Tamil
B.Arch., Dr B N College of Architecture for Women, University of Pune
3 years 8 months of experience in Real Estate industry.
CB Richard Ellis Inc.: Assistant Manager - Transaction Management Group
• Providedoptimumrealestatesolutionstoclients
• WonmultipleprestigiousclientssuchasCanon,Daesung,etc.
• RealestatesupplymanagementforofficeandITspaces
VishwashreeConstructions:Architect
• Conceptualisedanddesignedforhospitality,educationalandresidentialprojects
SE ARCH: Architect
• Designedanddetailedforexistingresidentialandcommercialprojectsincluding landscape design
• Grantedopportunitytohandleaprojectwiththeprincipalarchitect
Akila Jayaraman
English, Hindi, Punjabi
B.Com. (Hons.), SGTB Khalsa College, University of Delhi
2 years 9 months of experience in Consulting industry.
WTE Energy Pvt. Ltd.: Entrepreneur/ Senior Consultant
• ConsultedHeroGroupUSD3.5millioncarbonfinance project, project due for UN registration
• WorkedwithStanfordUniversitytoevaluate103renewableenergystart-upsfor Sequoia Capital
Nucleus Software Exports Ltd.: Management Trainee
• InterfacingwiththePRagenciesin3regions-APAC,MEandIndia
• SupervisedthePRcampaignforIITDelhi’sNucleusFormulaCar,achieved100% funding requirement
• BroughtanewPRagencyon-boardforEMEAregion,increasingPRcoverageto 166%
Akshat Kshetrapal
![Page 43: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/43.jpg)
84 85
English, Hindi
BS (Biomedical Engineering), Drexel University
3 years 2 months of experience in Pharmaceuticals industry.
JubilantOrganosysLtd.:ExecutiveAssistanttoMD
• Marketstrategyforkeyproductlinesforenteringinto the Indian market
• Growthstrategyfortheallergyandtheanimalnutritionbusiness
• LedthemergerandacquisitionteamfortheKazakhstanmarket
JubilantBiosysLtd.:AssistantManager-CorporatePlanning
• Developedamutualgo-to-marketstrategywithJapaneseconsultantsforJapanese market
• IdentifiedandassessedpotentialacquisitionoptionsintheChinesecontractresearch market
• Mappedanddocumentedprocessesacross5corefunctionaldepartments
Akshay Bawa
English, Hindi
B.A. (Hons.) (Economics), Delhi College of Arts & Commerce, University of Delhi
3 years 6 months of experience in Consulting industry.
Corporate Executive Board: Senior Analyst - Corporate Strategy and Development
• TransformedCEBIndiafromcostcentretoAPAC revenue centre with CFO cohorts project generating approximately USD 1 million in 2009
• AdvisedCFOsatsomeofIndia’slargestcompaniesonriskmanagement,IFRSand governance
• Publishedarticlesinleadingbusinessjournals(includingMintandBusinessLine)on governance practices
• LaunchedmanagementbestpracticesadvisorynetworksforIndianCEOsandCFOs
Akshay Chopra
English, Hindi
B.E.(Mechanical),KJSomaiyaCollegeofEngineering,University of Mumbai
3 years 10 months of experience in Engineering industry.
Auditra Engineering Pvt. Ltd. (part of Agra Engineering Company Group): Head of Business Development
• SetupabusinesstoexportmachineryandconsumablestoministeelplantsinAfrica
• Turnkeycontractsforasteelrollingmillprojectandaplastictubemanufacturing project in Tanzania
• InitiatedsalestoUganda,Ethiopia,Mozambique,etc.
• Createdastrongnetworkofdomesticvendors
• ImplementedSAPinthecompany
Akshay Satish Gupta
English, Hindi, Tamil, Telugu
B.Tech. (Metallurgical Engineering), IT-BHU
2 years 9 months of experience in Energy industry.
Shell Technology India Pvt. Ltd.: Materials and Corrosion Engineer
• ProjectleaderintheUSchemicalplanttosolvea critical plant reliability issue, which averted a potential
shutdown, and prevented a loss of USD 150,000 per day
• WonspecialrecognitionawardformyworkinMalaysia,draftedaglobalstrategyfor appraising mills that manufacture pipelines
• SavedapproximatelyUSD100,000byre-framingcylinderinspectionstrategy
• PreparedmaterialsselectionreportforBruneiLNG
Akshay Rajagopalan
English, Hindi, Danish
B.E. (Hons.) (Electronics and Communications), P D Memorial College of Engineering, Maharshi Dayanand University
3 years 9 months of experience in IT (Products) industry.
IBM India Pvt. Ltd.: Associate System Engineer
• Testanalystforacustomerserviceandfulfillmentapplicationinshippingindustry
• Plannedandexecutedend-to-endtestingonlegalandregulatorydocumentationflow
• Workedonbuildinganapplicationforcontainerallocationandmovementtracking
• Ratedamongsttopperformersforlasttwoyears
• IBMBravoawardstwoyearsinsuccession
Amit Ojha
English, Hindi
B.Tech. (Electrical Engineering), IIT Roorkee
3 years 9 months of experience in Energy industry.
Hindustan Petroleum Corporation Ltd.: Engineer - Projects
• Installationandcommissioningofelectricalequipments costing INR 140 million for effluent treatment plant
• Co-ordinatedwithconsultants,vendorsand contractors for timely completion of projects
• Preparedandreviewedtenderspecificationsformaterialsandservicescontracts
• WonHPCL’szonallevelannualbusinesssimulationcontest
Amit Singla
English, Hindi, Bengali
B.Sc. (Statistics), St. Xavier’s College, University of Calcutta
3 years 9 months of experience in Consulting industry.
McKinsey Knowledge Centre: Analyst
• Ledanalyticalprojectsforclientsacrossfunctionsand industries
• Workedlargelyoncreditriskmanagementprojectsforclientsinfinancevertical
• StarAwardforamarketinganalyticsprojectforaleadingbankinThailand
• Awarded‘BestAnalyst’twiceforexceptionalclientimpact(USbankmajor)
• ConductedexceltrainingworkshopsforMcKinseyconsultantsandclients
• Ledtrainingefforts(statistics,SASandSPSS)fornewjoinees
Anal Ghosh
English, Hindi, Malayalam, Tamil
B.Sc. (Statistics), Loyola College Chennai, University of Madras
3 years 10 months of experience in Financial Services industry.
Goldman Sachs Services Pvt. Ltd.: Associate
• Responsibleforportfolioaccountingandasset servicing of private wealth management accounts
• Involvedinsettinguptheprivatewealthmanagementantimoneylaunderingand compliance team in Bangalore
• FoundedtheGoldmanSachsBangaloreEnvironmentalCommitteewithaviewof reducing the carbon footprint of the office
Anand Ananthapadmanabhan
English, Hindi, Bengali
CFA, ICFAI
B.Com. (Hons.), St. Xavier’s College, University of Calcutta
2 years 11 months of experience in Auto Components industry.
Aditya Gears Group: Director
• Leda3-memberteamtorestructurethesecuredloans with a commercial bank
• Instrumentalinobtainingjobworkcontractsandresumingtradingactivitieswhich was vital in turning around the company
• Negotiatedeffectivelywithcreditors,dealersandothermajorstakeholdersto implement the proposed restructuring plan
• Conceptualisedandimplementedinnovativemarketingcampaignswhichincreased sales by 10% beyond target
• Designedmanagementandperformancereportingframeworks
Anant Veer Harlalka
English, Hindi, Bengali
B.A. (Hons.) (Sociology), Lady Shri Ram College for Women, University of Delhi
2 years 7 months of experience in Consumer Products industry.
Trutopia Foods Pvt. Ltd.: Managing Director
• Liaisedwithinvestors,vendors,governmentbodies and consumers and executed pilot run for fresh fruit juice business
Hindustan Unilever Ltd.: Area Sales & Customer Manager
• DesignedBTLlaunchplanforClearShampooandhelpedlaunchVaselineBody Wash in Thailand
• Ralliedteamof25fieldstaffand56distributorstodeliverhighesteverterritory turnover of INR 720 million in first year on the job
• Director’sAwardforoutstandingteamperformanceincustomerdevelopment
Ananya Ukil
English, Hindi, Telugu
B.Tech. (Information Communication Technology), DAIICT Gandhi Nagar
3 years 11 months of experience in IT (Services) industry.
Pioneer Marketing Corporation: Head Business Development
• Workedonmarketingandretailstrategyensuring18%growthduringrecession
• Plannedandorganisedpromotionalevent-‘LaptopMania’
• AttractednewcorporateclientstoPioneer
Infosys Technologies Ltd.: Software Engineer
• CorememberoftheUNIXanddatabasesolutionsteam
• BecameteamleadforKraftFoodsUNIXtrackwithin9months
• Improvedefficiencyofassessmentphaseofmigrationprojectsbynearly99%
• Consistentlyratedamongtop5%ofpeergroup
Anila Narla
English, Hindi, Bengali
M.Tech. (Computer Science and Electrical), IIT Delhi
B.Tech. (Electronics), ISM Dhanbad
3 years 10 months of experience in Electronics industry.
Calypto Design Systems Pvt. Ltd.: Senior Member, Technical Staff
• Conceptualisedanddevelopedmultiplelanguagesynthesisproductswhich contributed to 30% of Calypto’s revenue in 2009
• Projectleadfor64-bitproducts;ledteamof35engineersinIndiaandtheUSA, enabling product deployment on large designs for customers like Texas Instruments, Apple, Cisco and Sony
• SinglepointofcontactforthehardwarelanguagesynthesisteamacrossIndia,USA, JapanandEurope
Anindita Mukherjee
![Page 44: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/44.jpg)
86 87
English, Hindi
B.E. (Computer Science), Institute of Technology & Management, Maharshi Dayanand University
3 years 9 months of experience in IT (Services) industry.
Infosys Technologies Ltd.: Technical analyst
• ITconsultingininformationsecurityandbusiness continuity planning space for BFSI clients
• Salesandpre-saleswork,preparingRFPresponseandprojectestimates
• Costandeffortnegotiationswithmultiplevendorsandstakeholdersforpre-sales proposals
• Buildingaknowledgerepositoryforpre-salesactivities
Anish Jain
English, Marathi, German
B.E.(Printing),PVG’sCollegeofEngineeringTechnology,University of Pune
3 years 3 months of experience in Publishing and BPO industry.
Macmillan Publishing: Manager - Account Management
• Managedoperationsandsupportforateamof65 members
• Handledthecompleteportfoliofortwoofourlargestyellowpageadvertisingclients
Affinity Express, India Pvt. Ltd.: Project Manager
• Ledateamof45associates
• HandlingoperationsforfournewspaperclientsinUSAandCanada
• DualfunctionsofProjectManager-AdvertisingandTransitionManager-Advertising
• Trained500+associates-IndianandFilipino.SetupprocessesinPhillippineCentre
Anjali Rajendra Datar
English, Hindi
CFA, Cleared Level III, CFA Institute, USA
B.Tech. (Textile Technology), IIT Delhi
3 years 10 months of experience in Investment Management industry.
Irevna Research Services Ltd.: Senior Research Analyst
• Partoftheclients,aLondonbasedhedgefund,relative value desk
• Responsibleforconceptualisinginvestmentstrategiesusingtechnical,fundamental and macroeconomic indicators
• Workedonassetallocationandsectorrotationmodelsthatoutperformedbenchmark allocations by 5%
• Developedmodelstoidentifyturningpointsinequityindices
IndusValleyPartnersPvt.Ltd.:SoftwareEngineer
• Conceptualisedtheintegrationofadditionaltradingdesksandproductsduringthe client site stint in New York
Ankit Kumar Garg
English, Hindi, Dogri, Punjabi
B.Tech. (Computer Science), NIT Kurukshetra
3 years 7 months of experience in IT (Products) industry.
Computer Sciences Corporation India Pvt. Ltd.: Application Developer / Programmer Analyst
• TechDesignforAXA’sannuityinsuranceproductsusing CSC’s wealth management product
• CustomerinterfacewithAXAforCSC’swealthmanagementproduct
• Co-ordinationofqualitycompliance,causalanalysisfordefectsandpost-project reviews
• RecipientofCSC’sKeytoSuccessAward‘09;NominatedforCSC’sYoungTurk Award ‘07
• Alwaysratedunderperformancecategory1
• 3Certificateofappreciationawardsforexcellenceinprocessoptimisation
Ankur Sharma
English, Hindi
B.Sc. (Hons.), St. Stephen’s College, University of Delhi
3 years 9 months of experience in Automobile industry.
Maruti Suzuki India Ltd.: Territory Sales Manager
• WorkedinGurgaonandRewarimarkets,handling5 dealers, achieving INR 300 million sales per month
• LedateamtoreviveA-StarperformanceinDelhiNCRresultingina25%sales growth
• Co-ordinatedmarketingactivitiesfortheentireregion
• RegionalbrandmanagerforA-Starbrand:createdandexecutedamarketing roadmap for the brand
• Controlledcostsintheregionaloffice,savingINR27.5million
Anmol Joneja
English, Hindi
B.Tech. (Metallurgical Engineering), IIT Bombay
3 years 9 months of experience in Consulting industry.
Sterlite Technologies Ltd.: Project Analyst
• Workedonassessingmarketpotentialofbroadbandin India
Analysys Mason India (Formerly BDA Connect Pvt. Ltd.): Senior Analyst
• PerformedduediligenceofwirelessbroadbandproviderforaleadingSingapore based PE company
• Developedgo-to-marketstrategyforaFortune10technologyvendorinIPTVspace in India
Deloitte Consulting India Pvt. Ltd.: Senior Analyst
• GrowthstrategyandvalidationofbusinessplanforaFortune10companyinoptical films and display business
• Go-to-marketstrategyforaleadingnetworkequipmentvendorinIndia
Anugrah Aggarwal
English, Hindi
B.Tech. (Hons.) (Computer Science), Harcourt Butler Technological Institute, Uttar Pradesh Technical University
3 years 6 months of experience in Consulting industry.
IBM India Pvt.Ltd.: Consultant (Business Consulting Services)
• DevelopedthebusinessstrategyforIBMinBFSI captives segment
• Developedtheroadmapforpost-mergerintegrationoftwolargeUSfinancialservices firms
• MaturedthefirstSwedishBFSIclientdealforIBMGBSIndia
• ConsultedforRBS,Barclays,JPMorganandANZ
• PublishedtwotechnicalpapersininternationalconferencesinICNN(Cairo)and ICAAS (Athens)
• Filedapatentongeneticalgorithms
Anupama Pande
English, Hindi
B.E. (Electronics and Communication), Manipal Institute of Technology, Manipal Academy of Higher Education
3 years 9 months of experience in Semiconductor industry.
Freescale Semiconductors: Design Engineer
• Ledplatformdesignteam;createdroadmap,defined responsibilities and timelines
• Managedprojectthroughitslifecycleandensuredachievementoftargets
• Co-ordinatedactivitiesofallchipdesignteamsacrossIndia,USA,IsraelandChina
• Developedprocessforimprovementindesignmethodology;publishedinCadence CDN Live, an international semiconductor conference
• WasawardedFreescalecommendationaward-‘Bravo’severaltimesfor outstanding performance in projects
Anuradha Agrawal
English, Hindi
B.Tech. (Hons.) (Chemical Engineering), IIT Kharagpur
2 years 9 months of experience in Energy industry.
Shell Global Solutions (US) Inc.: Senior Associate Consultant, Hydrocarbon Management
• Implementedadvancecrudeconstraintmanagement system
• Developedyieldandpropertiesvalidationsystemforrefineries
Shell Technology India Pvt. Ltd.: Senior Associate Consultant, Feed Supply
• LedbasicdataandprocessmodellingactivityforTuprasOilCompany,Turkey
• SolvedcrudeassaysproblemforPTTAR,Thailand,savingUSD500,000
ShellGlobalSolutionsInternationalB.V.:SeniorAssociateConsultant,SupplyChainOptimisation and Management
• DevelopedmodelsandmethodologytocalculateCO2footprintforeveryrefinery product
• LedprocessmodelingactivitiesforPortArthurRefineryexpansion
Anurag Sharma
English, Hindi, Kannada, Konkani, Mandarin (Chinese)
M.Sc. (Economics), Singapore Management University
B.A. (Hons.) (Economics), St. Stephen’s College, University of Delhi
2 years 8 months of experience in Energy industry.
Platts: Petrochemicals Editor - Asia and Middle East
• DailymarketcoverageofpetrochemicalsacrossAsia, including news, pricing, analysis
• Managedatradingwindoweveryafternoonandsettlingpricingdisputes
• EngagedtheindustrythroughseminarsinDubai,SouthKorea
• ExtensivelycoveredChinesemarketusingmarketknowledgeandlanguageskills
GMO LLC.: Intern Economist
• MacroeconomicsresearchandindustryanalysisoftheMiddleEast
• AnalysedtheequitymarketandmeansofinvestinginSaudiArabia
• Usingeconometricstostudymacroeconomictrends
Anusha Pai
English, Hindi, Tamil
B.Com., Stella Maris College (Autonomous), University of Madras
2 years 9 months of experience in Financial Services industry.
Goldman Sachs Services Pvt. Ltd.: Technical Specialist
• Providedbackofficesupporttosettlementofcredit derivative trades
• Pointofcontactfortheteamforthequarterlyrollprocess
• Settherecordforthehighestmatchrate(99.68%)duringSeptember‘09roll
• DeputedtoGoldmanSachsInternational,Londonforbusinesscontinuity programme
• Involvedinprojectstoimplementprocessimprovementsfortheworkflowintrade settlements
• Trainednewmembersinductedintotheteam
Anusha Ramakrishnan
English, Hindi, Bengali
B.E. (Electrical Engineering), Sardar Patel College of Engineering, University of Mumbai
3 years 9 months of experience in Manufacturing industry.
Larsen & Toubro Ltd.: Executive Design Engineer
• Designedanddevelopedformanufacture,awide variety of MCCB and associated accessories
• Validateddesignsthroughtypetestingofnewlydevelopedproducts
• Havefiledfor3patentsundermynameinaspanof3years
Anwesh Das
![Page 45: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/45.jpg)
88 89
English, Hindi
B.Tech. (Civil Engineering), IIT Delhi
2 years 9 months of experience in IT (Products) industry.
Manhattan Associates India: Consultant
• Consultingforsupplychainsolutions,expertisein warehouse management
• Ensuringsmoothproductimplementationsandsubsequentdefectresolution
• Providingdesignforclientspecificenhancements,suggestingproductimprovements based on industry requirements
• Redesignedwarehouseoperationsflowthatimproveddailyshippedvolumeforthe India factory of one of the world’s largest cosmetics firm
• IncreasedshippingcapacityforMiddleEasternsupermarketschainbyreducingpost implementation defects by 70%
Apurva Prakash
English, Hindi, Telugu,Tamil
B.E. (Hons.) (Civil), BITS Pilani
2 years 6 months of experience in Energy industry.
Schlumberger Asia Services Ltd.: Field Engineer
• Workedasaleadengineerinover20oilwell commissioning projects both on onshore and offshore rigs, responsible for job planning and execution
• Asassistantsupervisorledthefirstevertemperaturearraysysteminstallationinthe KG-D6 deep-water gas-field for Reliance Energy
• Workedinseveral,shortduration,wellcommissioningprojectsforBritishGas,Total, ONGC and Hardy
Archana Ramana
English, Kannada
BS (Electrical Engineering), Georgia Institute of Technology
2 years 11 months of experience in Electronics industry.
Siemens Industry Inc.: Sales Application Engineer (F & B domain)
• TechnicalconsultanttoP&Gevaluationsandadvised on project rollouts
• ExecutedanenergymanagementprojectforPepsi
• Top+2009Awardforbusinessprocessimprovementproject
• InductedintoSiemensthroughtheprestigiousengineeringleadershipdevelopment programme
• Ledandexecutedabusinessgenerationproject
• Top+2008Awardforcontributiontomarketingdivisionofdiscreteautomation business unit
Arjun Krishna Bhatt
English, Hindi
CFA, Cleared Level I, CFA Institute, USA
B.Sc. (Accounting), Bethune-Cookman University
2 years 8 months of experience in Financial Services industry.
UTI Asset Management Company Ltd.: Private and Foreign Banks Channel - Relationship Manager
• Drivesalesinregionallotedthroughthechannel
• EquityAUMgrewfromINR80milliontoINR140millionfromAug‘09toApr‘10
Motilal Oswal Securities Ltd.: Advisor
• Adviseclientsontheirinvestmentandtradingpositionsinequitiesandderivatives
• Achievedthreetimestargetin2007-08,andtargetin2008-09inatough environment
• Increasedcustomerbaseby15%over2years
Arjun Singh
English, Hindi
B.Tech. (Mechanical Engineering), IIT Kanpur
3 years 8 months of experience in Transportation & Analytics industry.
Prem Cargo Movers: Business Manager
• Streamlinedbusinessoperationslikeinventory management, preventive maintenance and payment
processes
• Developedvehicletrackingsystemandfleetpermitexpirationtracking
• Initiatedbuyingvehiclesbyonline-bidding,onlinefundtransfersandonlinetender listings for cost savings of 5%
Zinnov Management Consulting: Senior Consultant - Analytics
• LedateamtodevelopworkforceplanningmodelforaFortune10company
• Preparedamodeltoestimatecallcentreoperation-costforaFortuneGlobal500 company
Arpit Patni
English, Hindi, Telugu, Tamil
B.Tech. (Chemical Engineering), Alagappa College of Technology, Anna University, Chennai
3 years 5 months of experience in IT (Services) industry.
Cognizant Technology Solutions: Associate - Projects
• Workedontransferagencyapplicationforalarge financial services major in USA
• Qualityandinnovationteamchampion,automatedcodemigrationresultinginUSD 75,000 savings
• Certifiedwithknowledgeofthetransferagencybusinessandyoungestentrantto the Global TA team
• LeadofaTeamof5associatesinM&Aactivities
• WonCognizantStarawardamong35,000employeegroup
Arun Panta
English, Hindi
B.E. (Electronics and Communications), Delhi College of Engineering, University of Delhi
3 years 8 months of experience in Consulting and Semi Conductor industry.
BGJeffreysConsulting:Consultant
• Helpedclientsinstallperformancemanagement systems in their organisations
• Providedsolutionstoclientstoeliminateinhibitorstogrowth
ST Microelectronics Pvt. Ltd.: Design Engineer - II
• Developeddesignplatformsthatenabledsignificantreductioninproduct development cycle times
Conexant (India) Pvt. Ltd.: Design Engineer
• Evolvedinnovativedesignsthatsignificantlyreducedproductcosts
Ashish Gupta
English, Hindi , Punjabi
B.E. (Computer Science), Thapar Institute of Engineering and Technology, Patiala
3 years 10 months of experience in Financial Services industry.
BA Continuum Solutions (Bank of America): Team Leader
• Createdanewrevenuestreamwithaprojectedworth of USD 3 million for an engagement with Bank of America-Merrill Lynch
• OnlycandidatefromIndiaofficetobeselectedforthequantitativemanagement programme, conducted by the bank in the USA
• Developedprofitandlossstatementsforvariousonlinebankingproducts
Inductis (India) Pvt. Ltd.: Programmer Analyst
• Generatedcriticalbusinessinsightsusingadvancedstatistical,econometricand stochastic modeling methodologies
Ashwinder Singh Sethi
English, Spanish, German
M.E. (Telecommunications), University of Oviedo
Master in Innovation and Business Development Management, University of Oviedo
3 years 3 months of experience in Manufacturing industry.
Arcelor Mittal: Research Engineer
• WorkedonidentifyingkeyresearchideasforR&DcenteratAsturias
• Launchingofresearchaxisforblastfurnacehearthwearestimation
• Projectproposalsapprovedforregional(2),national(1)andEuropean(1)R&D programmes
• Supportforblastfurnaceblow-inindifferentplantsofthegroup(Bosnia,Belgium, France, Spain)
• PursuingPh.D.inprojectmanagementatUniversityofOviedo
Aurelio Gutierrez Perez
English, Hindi
B.E. (Computers), Sardar Patel College of Engineering, University of Mumbai
2 years 4 months of experience in Education industry.
Career Launcher India Ltd.: Key Accounts Manager
• Headed2centerswithrevenuesofINR16millionand 11 member team
• ResponsibilitiesforP&L,marketing,teammanagement,developnewkeyaccounts
• Ledregionallaunchofnewproductsandmarketingcampaigns
MindTree Ltd.: Pre-Sales Team Lead, Concierge
• Ledteamof3tonegotiate,implementandpresentprototypetoDanamon,Al-Rajhi and SCB business heads
• Prototypelead,P&GMDMreporting
• Top5%inthecampuslearningprogrammeamong585recruits
Ayush Ahuja
English, Hindi
B.E. (Hons.) (Mechanical Engineering), IIT Kharagpur
2 years 9 months of experience in Manufacturing industry.
ITC Ltd.: Assistant Manager Process Improvement
• Spearheaded13SixSigma,12lean,101innovation and 110 work-out projects saving INR 51 million
• Ledtrainingof44managersonprocessexcellence
• Improvedqualitystandardsof8brandsandreducedcomplaintindexby60%
• Achievedzeronon-conformitiesinISOaudits
• Evaluatedcigarette-buffersystemstopurchasetechnologyworthINR200million
• ReducedmaintenanceinMungerfactoryinBiharfrom2shiftsto1shift
Ayush Mathur
English, Hindi, Gujarati, Marathi
CFA, cleared all Levels, CFA Institute, USA
CA, ICAI
M.Com., Sydenham College of Commerce & Economics, University of Mumbai
B.Com., Narsee Monjee College of Commerce & Economics, University of Mumbai
3 years 9 months of experience in Financial Services industry.
Warburg Pincus India Pvt. Ltd.: Research Analyst
• Keymemberofdealteamsthatevaluatedprivateequityopportunitiesacrosssectors
• Closelymonitoredtheperformanceofportfoliocompanies
• Valuedadiversifiedfinancialservicescompanywithpresenceinbanking,insurance, assetmanagementandcapitalmarkets;stresstestedthebank’sprovisioningneeds
• Evaluatedinvestmentopportunitiesinmedia-broadcasting,cableandsatellite
• Evaluatedanopportunityinthethermalpowergenerationspace
HDFC Securities Ltd.: Research Analyst
• Coveredthemid-capsector
Bhairav Rajnikant Shah
![Page 46: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/46.jpg)
90 91
English, Hindi, Kannada
B.E. (Mechanical), M S Ramaiah Institute of Technology, VisvesvarayaTechnologicalUniversity
2 years 9 months of experience in IT (Services) industry.
Infosys Technologies Ltd.: Senior Engineer
• Performedstructuralanalysisandprovidedengineering solutions for a major aerospace client
• Handledtheoffshoreimplementationforanewapplicationdevelopmentprojectin the insurance domain
• AwardedacertificateofrecognitionbytheCEOforaHRDbrandbuildinginitiative, ‘In-Corporate’
• ‘ExtraMiler’awardforQ3FY2009-10
• Workedonadoptingthe‘ToyotoProductionSystem’intheinternalworkflow processes
Bharath Bevinahally Raghunath
English, Hindi, Marathi, German
B.E. (Computer Engineering), Cummins College of Engineering, University of Pune
2 years 7 months of experience in IT (Services) industry.
Deloitte Haskins & Sells/ S. B. Billimoria: Assistant Manager
• Workedonriskmanagementandassuranceprojects for global and Indian organisations across industries
• LedcontractriskandcomplianceteamsandrecovereduptoINR20millionin shortfall for two software multinationals
• Excelledinmarketing,businessdevelopmentandcreatingbrandmaterial,identified 700 prospective clients through independent research
• Nominatedbyseniormanagementtoconductinternaltrainingsessionsonanalytical and communication skills and mentor analysts
Chaitrali Sujay Joshi
English, Hindi
B.Tech. (Information and Communication Technology), Dhirubhai Ambani Institute of Information and Communication Technology
3 years 11 months of experience in Tourism and IT (Products) industry.
ThrillophiliaAdventureToursPvt.Ltd.:Co-founder;Marketing Head
• Establishedownventure(boot-strapped);ledbusinessdevelopmentandoperations of the company
• Grewthecompanyfromstaffstrengthof2to10;achievedINR1millionsalesin 6 months
• Relationshipmanagementwithmediapartners-OutlookTraveler,Kingfisher,FMand radio partners
• Onlinemarketingandsearchengineoptimisation
Sap Lab (India) Pvt. Ltd.: Senior Software Engineer
• Softwaredevelopment(supplierrelationshipmanagement)
• Ledteamforcustomerramp-upforSRM7.0product;achievedzerocustomer escalations
Infosys Technologies Ltd.: Software Engineer
Chitra Gurnani
English, Spanish, French, German, Hindi
M.E. (Telecommunications), Higher Engineering College, Sevilla, Universidad de Sevilla
3 years 9 months of experience in Telecommunications industry.
red.es - Spanish Government: Project Manager
• ImplementationandreportingofEuropean commission policies for the i2010 programme for the development of the information society in Europe
• Technicaldesignandimplementationofinfrastructureprojectsforthepublicsector
• Negotiationandco-ordinationwithdifferentstakeholdersinordertoensuretheir participation (state governments, private corporations, independent institutions)
• Budgeting,trackingandfinancialreporting;harmonisationwithEuropeanreporting standards and intra-communitary partners
red.es - Spanish Government: Trainee
Daniel Gomez Diaz-Pines
English, Portuguese
Dual Degree - M.E. (Software Engineering), University of Southampton
2 years 9 months of experience in Diversified Manufacturing and Service industry.
Mozambique Holdings Ltd.: Executive Director
• Administrationofmaincompanyandsubsidiaries
implemented automated inventory and accounting system, which reduced inventory cost by 5%
• ManagedEximBankofIndiafundedwaterproject,ofsizeUSD28million
• ManagedrestorationofMaputoOilTerminal(largestsourceofoilforMozambique)
• Creatingandmanagingofcontracts/tenders
• Designedhospitalprojectforfunding
Deepak J. Parayanken
English, Hindi, Tamil
BBM, Christ College, Bangalore University
3 years 3 months of experience in Consumer Products industry.
ROR Infotech: Marketing Manager
• Consumerresearchandcrosspromotionaltie-ups
Hindustan Unilever Ltd.: Brand Officer, Ice Cream Division
• Brandactivationofallthebrandsintheicecreamportfolio
• Sales-support-retailvisibilityrolloutsandon-groundactivation
• Marketingbudget-brandallocationandcontrol
• Planned&ExecutedProjectDoorstep:HomeDeliveryofIceCreams
• Favourablementioninbook‘Where’smyketchup’(Gonda&Khan)forhandlingof Consumer Complaint
JWalterThompsonPvt.Ltd.:TraineeAccountExecutive
• WorkedontheLeviStraussaccount
Deepak Subramanian
English, Hindi
B.Com.(Hons.),SriVenkateswaraCollege,UniversityofDelhi
2 years 6 months of experience in Consulting industry.
The Energy and Resources Institute: Research Associate
• Identifyingfinancingmechanismsforthe‘Lightinga Billion Lives (LaBL)’ campaign
• DevelopedPDDforLaBLasaprojectunderCleanDevelopmentMechanism(CDM)
KPMG: Analyst
• Understoodprocesscontrolsformanufacturing,BPO,hospitality,mediaand power clients
• Identifiedrisksandsuggestingprocesscontrolsalongwithcost-benefitanalysis
• Recommendedcontrolsforexistingprocessesandredesigningprocesses
• Exceptionalperformerratinginbothyears
• Handled4outof9clientsindependently
Deepika Seth
English, Hindi
B.E. (Electrical Engineering), Shri Govindram Seksaria Institute of Technology and Science, Indore, Rajiv Gandhi ProudyogikiVishwavidyalaya
3 years 3 months of experience in IT (Services) industry.
Accenture: Senior Software Developer
• WorkedondatamodellingforaninsuranceclientbasedinUSA
Capgemini (India) Pvt. Ltd.: Consultant (P2) (Software Developer)
• Partoftheteamthatdevelopedsalesanalyticaltoolforclient’sROIanalysis
• Developedadatamodeltobringinsupplychaindataforclient
• Awarded‘BestLearner’foroverallperformanceduringthefreshers’training programme
• Awardedfirstprizeforpresentationon‘BusinessIntelligence&Virtualworld’
Deepshikha Yadav
English, Hindi, German
B.Com.(Hons.),SriVenkateswaraCollege,UniversityofDelhi
2 years 9 months of experience in Consulting industry.
PricewaterhouseCoopers: Associate (Business Advisory Services)
• Executedbusinessadvisory,processreviewandinternalauditassignmentsfor clients in oil & gas, FMCG, professional services and aviation domains
• DevelopedapproachpapersonClause49,SOXandinternalcontrolframeworks
• Memberofbusinessdevelopmentandmarketingteam-obtainedprojectsfromRIL and Canadian High Commission
Corporate Executive Board: Research Associate
• Researchedoninternalandexternaldatabasesforsolutionsandbestpracticesin financial service industry
Dhruv Vohra
English, Hindi, Kannada
B.E.(IndustrialEngineering&Management),RVCollegeofEngineering,VisvesvarayaTechnologicalUniversity
3 years 9 months of experience in Consulting industry.
Deloitte Consulting: Consultant
• Unifiedtheordermanagementsolutionforanindustrial gases major with over 7 million customers
• Onsiteco-ordinatorfortheaboveengagement
• ProcessLeadinasolutionupgradeprojectforanaircraftmanufacturer(teamsize-8)
• TrainedandmentorednewrecruitsintheSAPpractice
• ApplauseAwardforaSAPdesignsolutionforautilitiesmajor
Divyashree
English, Hindi, Oriya, Bengali
B.Tech. (Hons.) (Energy Engineering), IIT Kharagpur
3 years 9 months of experience in FMCG industry.
ITC Ltd.: Assistant Manager-Projects
• Drivingdesign,planningandexecutionofaINR3.5 billion Greenfield cigarette manufacturing factory
• Developmentandcompetencybuildingofamulti national vendor base
• Initiationandimplementationofaknowledgeportaltomanageprojects
• CertifiedSixSigmablackbeltandleangreenbelt
• Memberofthemanagementteamtonegotiatemanpowerrationalisationwithtrade unions
Durga Madhab Dash
English, Hindi
B.E. (Computer Science), Thadomal Shahani Engineering College, University of Mumbai
2 years 9 months of experience in IT Products and Engineering industry.
Acrovent Systems Pvt. Ltd.: Engineer (Planning)
• Projectengineering,planningandmanagementfortwo big air-conditioning projects for CMC and L&T
• Handledasmallmanufacturingunit
• Increasedproductionbyintroducinganewpaymentstrategyforworkers
Google India Pvt. Ltd.: Software Test Engineer
• Ledateamofvendorsandco-ordinatedthetestingforGooglePack
• Increasedproductivitybymakingtheautomationlanguageindependent
• Ownedintegration/releasesofapplications
• MovedreleaseprocessestoHyderabadfromKirkland
Dyuti Barma
![Page 47: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/47.jpg)
92 93
English, Hindi
B.E. (Information Technology), DCE, University of Delhi
2 years 9 months of experience in Consulting industry.
PricewaterhouseCoopers: Consultant
• Engagedwithhealthcare,retailandgovernmentclients for MS dynamics ERP implementation
• Involvedinimplementationoftravelersclinicandstaffclinicmodulesforahospitalin Bangladesh
• Wasinstrumentalingettingtwonewprojectsfortheorganisation
Esha Agarwal
English, Hindi, Gujarati, Marathi
M.Com., H R College of Commerce & Economics, University of Mumbai
BMS, H R College of Commerce & Economics, University of Mumbai
3 years of experience in Construction & Financial Services industry.
Spenta Properties Pvt. Ltd.: Director
• Managementofday-to-dayoperations
• Organisationoffundingandliaisingwithgovernmentofficialsforrequiredpermitsand permissions
• Oversawthefirstcertifiedgreenbuildingbuiltbythecompany
• Handledaccounting,taxplanning,marketingandsales
JPMorganChase:Analyst
• ConductingfundamentalcreditresearchonJPM’sIBclients
• Workingwithportfoliosmanagersandtraderstomanagerealestateportfolio
Farshid Aspan Cooper
English, Hindi
M.A. (Economics), Delhi School of Economics, University of Delhi
B.A. (Hons.) (Mathematics), St. Stephen’s College, University of Delhi
3 years 10 months of experience in Investment Banking industry.
ICICI Bank Ltd.: Manager Structured Finance Group
• WorkedwithMckinsey&Cotodeviseroadmapforbankforayintodistressedasset market
• WorkedonIndia’sfirstdistressedassetsecuritisationworthUSD80million;completed securitisation worth USD 1 billion across product classes and multiple buyers
• HandledstrategiccarveoutofdebtcollectiondivisionworthUSD100million
• Carriedoutequityinvestmentindistressedfundsandcreditbureaus
Gaurav Arora
English, Hindi, Russian, Spanish
B.A. (Economics), Yale University
3 years 7 months of experience in IT (Services) industry.
TwoFour Global: Systems Analyst
• SoftwaresolutionsdeliveryforBFSIdomain
• WorkedonFXtradingsystemsforMorganStanley private wealth management
• RedesignedworkflowsystemsforanewABS/CDStradingsystematMerrill-Lynch
• WorkedatLondonandNewYorkmarkets
• Droveinitiativetocreateinternalknowledgebasetocollectandcategoriseknown system issues
• IndependentlywroteVBAmacropackagestoimproveefficiencyoftestcreationteam
Gaurav P. Sajjanhar
English, Hindi
BBS, College of Business Studies, University of Delhi
3 years 6 months of experience in Consulting & Financial Services industry.
Talent365: Founder
• Launchedanonlineplatformforcompaniestorecruit from colleges
UBS AG: Project Officer, Global Strategy & Business Development (Wealth Management)
• Managedtheprojecttodevelopretailbankingstrategy
• LedanoffshoringprojectfromZurich,NewYorkandLondontoHyderabad
• Workedontheannualglobalplanningprojectforthetopmanagement
KPMG: Analyst (Risk Advisory Services)
• Advisedclientsaboutbusinessrisksandcontrolsrequiredtomitigatethem
• Conductedprocessreviews,analysisandinterviewswithclientsacrossdifferent industries
Gaurav Pasricha
English, Hindi
B.Tech. (Hons.) (Mechanical), IIT Kharagpur
3 years 6 months of experience in IT (Products) industry.
Adobe Systems India Pvt. Ltd.: Member of Technical Staff
• ResearchanddevelopmentonFlashandIDE
• Filed5USpatents
• ‘SpecialContribution’awardforleadingstrategicenterprisepartnershipsforproduct development
• WorkedtowardsmarketdevelopmentofFlashbuilder
• Workedwithbusinessteamsoftechnicalcollaborators
Onmobile Asia Pacific Pvt.Ltd.: Software Engineer Trainee
• ActingtechnicalleadforISteam
• Received‘OnMobileEmployeeIcon’award
Gaurav Priyadarshi
English, Hindi
B.Tech. (Electronics), Harcourt Butler Technological Institute, Uttar Pradesh Technical University
3 years 8 months of experience in Engineering industry.
Schneider Electric (India) Ltd.: Senior Automation Engineer
• GeneratedrevenuesworthINR70millionforthe financial year 2009-2010
• Businessdevelopementforautomationproductsandsolutions
• Channelandstrategicaccountmanagementforsustainedbusiness
• AwardedbestgraduateengineertraineefortheGETbatch2006
• SelectedasoneoftheonlytwomembersacrossIndiafortheMarcoPolo programme
• Youngestmemberoftheautomationteam
Gaurav Taragi
English, Hindi
B.E.(InformationTechnology),DwarkadasJSanghviCollege of Engineering, University of Mumbai
2 years 6 months of experience in Manufacturing industry.
Strata Geosystems (India) Pvt. Ltd.: Business Development Executive
• IdentifiedthepotentialforgeocellsinIndiaafteranalysingseveralgeosynthetic products
• InstrumentalinestablishingapartnershipwithPRS,worldwideleadersingeocells
o3 Capital Advisors Pvt. Ltd.: Assistant Manager - Technical
• Setupandimplementedanautomatedarbitragetradingsystem,generatingan above average return using complex derivative trading strategies
• InitiatedandimplementedaCRMsolution
• Designedanddevelopedaportfoliomanagementsystemforourbrokingoperations
Gautam Narendra Dalmia
English, Hindi
Green Belt Certification in Six Sigma, BMG International, Mumbai
B.Tech. (Hons.) (Chemical), IIT Kharagpur
2 years 9 months of experience in FMCG industry.
ITC Ltd.: Maintenance Incharge, PMD (Primary Manufacturing Department), Bangalore
• Ledmaintenanceteamof23toimplementconditionbasedmonitoringandreliability centric maintenance, reducing plant downtime by 23%
• Developedandimplementedprimaryknowledgeportalforcigarettemanufacturing; trained 45 managers post implementation
• Plannedandexecutedcapexprojects(INR12million)
• ExecutedprocessimprovementprojectsusingSixSigmatoimprovetobacco utilisation by 1.3% (INR 8 million savings)
Gautam Sharma
English, Hindi, Malayalam
B.Tech. (Mechanical Engineering), NIT Calicut
3 years 8 months of experience in Offshore Oil & Gas EPC Industry
Larsen & Toubro Ltd.: Assistant Manager - Marketing and Business Development (MENA)
• Inchargeofevaluatingopportunities(aboveUSD100 million) from technical, commercial and strategic perspective
• Workedcloselywithmanagementoninternationalisationstrategyforoilandgas projects
• PartoftheteamthatformedstrategicbusinessunitatAbuDhabi
• AmongthefewidentifiedandpromotedtothetoptalentschemeManagement Leadership Programme (MLP)
• Projectmanagementteamfor4WPP(value:USD250million)managing sub-contractors at fabrication yard and offshore
Gautham Krishnan
English, Malayalam, Bengali, Marathi
B.A. (Economics), St. Xaviers College, University of Mumbai
3 years 8 months of experience in Broadcasting industry.
Discovery Networks Asia-Pacific: Assistant Manager - Advertising Sales
• Handled33%ofallIndiaannualsalestargetof INR 250 million
• AchievedannualsalestargetwithYoYgrowthof10%
• Workedondeepeningandexpandingcustomersegments,notablyPSUs,autoand finance
• SalespersonforDiscoveryTravelandLiving’slargestclientHULfor2yearsinarow, growing it by 20% YoY
• Youngestnon-MBAemployeeinsalesfunction
Gayatri Rajagopal Tampi
English, Hindi, Sindhi
CA, ICAI
B.Com., PMB Gujarati Commerce College, Devi Ahilya Vishwavidyalaya
3 years 7 months of experience in Financial Consulting and Banking industry.
Grant Thornton India: Senior Consultant
• Ledteamsforbusinessplanreviewsandfinancialduediligenceacrosssectors
• WorkedononeofthelargestBPOacquisitionsinIndia
• AdvisedvariouscorporateclientsonM&AandIFRSrelatedvaluations
Citibank NA: Assistant Manager (Product Control Group)
• SupportedFXtreasuryfrontofficeindecisionmakingandriskmanagement
• Waspartoftheteamthatimplementednewriskmanagementsystem
Geetesh Ahuja
![Page 48: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/48.jpg)
94 95
English, Hindi
B.A. (Economics), Hansraj College, University of Delhi
3 years 11 months of experience in Real Estate industry.
DLF Ltd.: Deputy Manager, Finance and Investor Relations
• RaisedINR10billioncommercialpapers
• RaisedINR5billioncorporateloanfromUCOBank, also worked on other funding proposals including NCDs
• Gotshort-termratingfromCAREforcommercialpapers
• Increasedequityresearchcoverageto25brokerages
• Closeliasioningwithanalysts/investors
Adfactors PR Pvt. Ltd.: Account Executive - Investor Relations
• Investorrelationsfor10+clientsacrosssectors
• Strategisinginformationflowforkeyeventsandfinancialresults
• Organisedroadshowswithtopfunds
Geetika Chhabra
English, Hindi
BMS,JaiHindCollegeandBasantsinghInstituteofScienceandJTLalwaniCollegeofCommerce,Universityof Mumbai
3 years 8 months of experience in Consulting industry.
Protiviti Consulting Pvt. Ltd.: Business and Risk Consultant Incharge
• Rebrandedaconsultingfirm-performedacomprehensivereviewoftheclient’s business offerings
• Reviewedoperationsinhospitality,manufacturingandretailsectorsanddeveloped standard policies and processes for clients in these sectors
• Recognisedasthemostemergingplayer(March2009)
Axis Risk Consulting Services Pvt. Ltd.: Senior Analyst
• Re-designedthechannelmanagementstrategyforaDTHserviceprovider
• Analysedtheeffectivenessofmarketingpromotionalspendsforanentertainment service provider
Hana Al Fahoum
English, Hindi
B.E. (Civil Engineering), Delhi College of Engineering, University of Delhi
2 years 9 months of experience in Real Estate industry.
Laing O’Rourke: Package Engineer
• Resourceplanning,tendering,sub-contractor management and project commercials for packages worth USD 31 million (team size: 40)
• Projects:DubaiInternationalAirport,HarvardUniversityHospital
• Filedapatentfor‘Methodoflocatingandmanagingelementsinbuiltenvironment’
• CSR,environmentandhealthandsafetyrepresentative
Laing O’Rourke: Assistant Manager
• Consultanttoteams(7-8members)forconstructionsoftware/hardwaredevelopment
• Establishedprocessesforproductcommercialisation
• Clientinteractionsforsales;materialisedadealwithALDAR
Haresh Vazirani
English, Hindi, Telugu
MBBS, NTR University of Health Sciences, Osmania Medical College
3 years 9 months of experience in Construction industry.
Chava Techno Constructions: Managing Partner
• Constructeda30apartmentresidentialcomplexat Khammam
• Single-handedlyfoundedthecompany,conceivedtheprojectandexecutedthesame
• MarketedtheprojectandsoldtheapartmentsatanaveragepriceofINR2million per flat
Hari Krishna Chava
English, Hindi, Tamil
B.Sc. (Statistics), Loyola College, University of Madras
2 years 9 months of experience in Market Research industry.
AC Nielsen ORG-MARG Pvt. Ltd.: Senior Diagnostic Consultant
• Workedonmarketresearchprojectsacrossdomains- FMCG, telecom, durables, OTC, F&B, alcohol, etc.
• FiveCircleofExcellenceAwards
• Leadroleindevelopmentofanewmarketresearchframework
• Leadpersonfortwotechniques-segmentationandproductlaunchareas
• Supportedupto10clientsatonetimeacrossgeographies-AsiaandEurope
• HandledstudiesofmajorclientslikeP&G,Kraft,Phillips,etc.
Hariharan V S
English, Hindi, Punjabi
B.Tech. (Hons.) (Electronics & Communication), Guru Nanak Dev University, Amritsar
3 years 9 months of experience in IT (Services) industry.
Wipro Technologies: Senior Software Engineer (BFSI domain)
• Developmentandimplementationofscriptsforglobalgeneralledgerproject
• Managingquarterlyandoff-cyclereleasessinglehandedly
• Providingeffectivedesignsolutionstointernalandexternalteamsbasedoutof Asia, Europe and US
• Soleonsiteco-ordinatoroftheteamatSingaporeforfifteenmonths
• Recognisedas‘KeyTalentoftheCompany’fortheyear2009
Henna Mehta
English, Hindi, Bengali, German
B.A. (Hons.) (Economics), Miranda House, University of Delhi
3 years 9 months of experience in Consulting industry.
McKinsey Knowledge Centre, McKinsey & Co: Research Analyst
• Firstresearchteamincompanytointeractdirectlywithclients
• Specificareasofresearchfocusincludemarketandcompetitiveintelligencein consumer electronics industry
• Conductedworkshopstocoachjuniorcolleaguesonworkflowprocesses
• Receivedannualawardforexcellenceinprocessandpeoplecapabilities,givento top 5% of employees
• Receivedanawardforintroducingchangesthatreducedturnaroundtimein preparing reports by 50%
Ipshita Sinha
English, Hindi, Bengali
B.Sc. (Hons.) (Physics), St. Stephen’s College, University of Delhi
3 years 9 months of experience in Transportation industry.
A.P. Moller Maersk Group: Assistant Manager, Dubai
• Co-ordinatedmovementandportoperationsofships calling West & Central Asian ports from Dubai, including US Military cargo ships
• NominatedfromWestandCentralAsiaforglobalproject‘OnTimeDelivery’in Copenhagen
• AchievedhighestcustomersatisfactionscoreforNorthIndia,asteamleader (customer service) with 17 members
• Amongtop10inMaerskLeadershipManagementProgramme
• SavedUSD500,000incostsinJanuary2010
Ipsita Das
English, Hindi
M.A. (Economics), Delhi School of Economics, University of Delhi
B.A. (Hons.) (Maths), St. Stephen’s College, University of Delhi
3 years 9 months of experience in FMCG industry.
ITC Ltd.: Assistant Brand Manager (Candyman & Mint-O fresh)
• LaunchedCandymanintolactoandfruit-toffeesegmentsandMint-OGOLacross India
• MemberofBingotaskforce,strategisedlaunchofBingo-16%marketsharein 9 months
• AsAM,marketresearch,analysedretailauditdatatostrategisepromotions
• Developedlong-termforecastingmodelswithconfidencelevelof98%
• AsASM,increasedcigarettesalesofAPby27%,secondhighestinthecountry
Jagjeet Harode
English, Hindi, Gujarati
B.E. (Computers), SAKEC, University of Mumbai
2 years 4 months of experience in IT (Products) industry.
Tata Consultancy Services Ltd.: Assistant Systems Engineer
• In-chargeofnewcustomeronboardingprocess automation for a large telecom client
• Designedchangecontrolsystemfor115teams,implementedfor25
• Teamreceivedrecordcustomersatisfactionindexofover99%forthreehalf-year periods
• Projectachievedsavingsworth5000manhoursannually
• Keydriverbehindsuccessfulglobalrolloutofdomesticcontentmanagementsystem
• Received‘Outstandinginnovationsandout-of-the-boxthinking’certificateatTCS
Jainam Bharat Shah
English, Hindi, Tamil
B.E. (Electronics and Telecom), CCOEW, University of Pune
3 years 3 months of experience in IT (Products) industry.
Netezza Corporation (USA): Technical Support Engineer
• Providedsupporttodatawarehouseoperationsofbig retailers
• Workedonextendingcapabilitiesofexistingdatawarehouse
• ‘CustomerSupportEngineeroftheMonth’inthesecondmonthofwork
Archibus/ FM Pvt. Ltd. (USA): Application Engineer
• Managedcustomerserviceescalations
• Developedtheuserinterfaceforfaciltiesmanagementproduct
• Providecustomsolutionstopartnersanddirectcustomers
Brainvisa Pvt. Ltd.: Associate Programmer/ Project Lead
• Designedanddevelopede-learningcourseware
• Mentorednewmembersoftheprojectteam
Janaki Ramakrishnan
English, Hindi
B.Sc. (Hons.), St. Stephen’s College, University of Delhi
2 years 9 months of experience in Financial Services industry.
Ernst & Young Pvt. Ltd.: Analyst (Oil & gas domain for M&A)
• Valuationstudies,comparativebenchmarking, investor searches and business development
• Preparingpitches,informationmemoranda,clientpresentationsfortransactions
• HelpedclientswincitygasandNELPbids
• Independentlyexecuteddatarooms
Evalueserve.com Pvt. Ltd.: Business Analyst
• Financialandbusinessresearchforprivateequitiesandhedgefunds
• Projectmanagementofmarketstudiesandcompetitiveanalysis
• Instatedoffshoreresearchcenters
• Thoughtleadershipmodules(sovereignwealthfunds,PIPES,etc.)postedonintranet
Japun Ahluwalia
![Page 49: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/49.jpg)
96 97
English, Hindi, Malayalam
B.Tech. (Electrical & Electronics), College of Engineering, Thiruvananthapuram, University of Kerala
3 years 8 months of experience in Manufacturing industry.
VictoryGlassandAluminium,Dubai:OperationsManager
• Increasedproductioncapacityby60%,from50to80 glass sheets per day
• Ensuredzerodowntimefrommachinerybreakdown
• Formedthedesigndepartmenttherebyincreasingtheproductbase
• Establishedthetradingdivisionofthecompany
Larsen & Toubro Ltd.: Graduate Engineer Trainee (Strategic sourcing department)
• MadeoverUSD3millionworthofpurchasewith16%savings
• 10annualmaintenancecontractsforthefinancialyear2007-08
Jince Joy
English, Hindi
B.Arch., C R State College of Engineering, Maharshi Dayanand University
2 years 8 months of experience in Hospitality and Consulting industry.
VatikaHotelsPvt.Ltd.:Executive-ProductStrategy
• Projectmanagement-backofhouseareasofThe WestinHotel(Starwood);‘TopPerformeroftheCompany’awardforcostreduction
• Co-ordinationwithmanagement,purchaseandoperationstofacilitateprocurement and approvals
• Workedwithconsultantsandcontractorstoresolvesiterelatedissues
Incubis Consultants (India) Pvt. Ltd.: Executive - Architecture
• Designconsultant-TheMetropolitanHotel(EmaarMGF)
• Technicaldetailing;projectcostandmaterialrequirementestimation
• Preparingbillsofquantities,tenderdocuments,finishingschedules
Juhi Dang
English, French, German
M.E. (Electrical Engineering), IIITM, University of Karlsruhe
B.E. (Electrical Engineering), Institute National Polytechnique de Grenoble
3 years 9 months of experience in Automotive industry.
Robert Bosch GmbH, Stuttgart, Germany: Chassis System Engineer
• Initiatednumerousprocessimprovementstoreducetimelines.
• Growingexpertiseandenthusiasticleadershipmademebecomeakeyplayer
• Tooktheinitiativetosetupsmallteamstoworkonthrillingresearchtopics
• Estimationofvehiclemassaswellasend-of-linetestingledtopatents
Julien Levrier
English, Hindi
B.Tech. (Mechanical Engineering), NIT Suratkal
2 years 9 months of experience in Automotive industry.
Tata Motors Ltd.: Assistant Manager
• Responsibleforperformanceofchannelpartnersin after sales and service marketing across North
• Co-ordinationandimplementationofJDPowerrelatedactivities
• Deploymentofaftersalespolicyinitiativesintheregion
• KeyroleinachievinghighestgrowthinJDPCSIsurvey‘09forDelhi/NCRregion
• LedKaizeninitiative-improvedproductivityoffreeservicecategoryby74%
Karan Sahni
English, Hindi
BS (Electrical Engineering), Purdue University
3 years 9 months of experience in Manufacturing industry.
Zenith Forge Ltd.: Executive Director
• Implementedtwoexpansionprojectsformanufacturing automotive finished products
• Conceptualisedamanagementinformationsystemtomonitorqualityandcost
• SetupanancillaryunitfortheTataNano;productionfacilitiesbeingshiftedtoPune
• ImplementednewqualitycertificateTS16949
Motorola Inc.: Electrical Engineer
• TeamlaunchedthefirstMOTORAZRinJapan
• ConceptualisedamatrixtotrackSixSigmalogistics
• IntegratedanRFIDprototypeonacellphone
Karan Sood
English, Hindi
BBS - Finance, College of Business Studies, University of Delhi
2 years 8 months of experience in Manufacturing industry.
Supra Craft Packaging Pvt. Ltd.: Manager-Marketing and Process Controls
• Developedmarketingandbusinessdevelopmentstrategyforthecompany
• Involvedina3-monthlongpackagingprojectforHondaIndia
• Conductedinternalassessmentofsystemsorientationandprocessre-engineering, and worked to introduce an ERP system to improve operations
• Co-ordinationbetweenmarketingandproduction,planningandcontrol
KPMG Business Advisory: Analyst
• Undertookinternalaudits,mademodelbusinessprocessesandSOPsforsomeof the country’s leading companies
Karn Bhugra
English, Hindi, Kannada, Telugu, German
B.E.(Mechanical),RVCollegeofEngineering,VisvesvarayaTechnologicalUniversity
3 years 9 months of experience in Automotive industry.
National Instruments India: Field Sales Engineer
• ManagedUSD2millionterritoryacrossSWIndia; accountmanagerfromconcepttodelivery;clientsincludedRBI,GE,L&Tand American Power Conversion
• Exceededrevenuetargets;grewbusinessby40%in2009-10
• Executedagreement(USD1millionrevenue)withNITSuratkalforestablishingaCOE
Robert Bosch (India) Ltd.: Engineer
• Workedonsite(Germany)onspecificationsforautomativediagnosticcontent
• Increasedprojectdeliveriesby35%QoQ
• ‘BestEmployeeoftheDepartment’,2007
Karthik P Kishore
English, Hindi, Gujarati, Bengali
B.Tech. (Information Technology), NIT Durgapur
2 years 10 months of experience in IT (Products) industry.
Cisco Systems Inc.: Software Engineer
• LedtheR&Deffortsfortwonewhardwaremodules, collaborating with global cross functional teams
• OwnedthedevelopmentactivitiesofservicemodulesonCatalyst6500,an enterprise/ internet switching product
• Filedtwopatents:oneonincreasingservicingcapacityofanetwork,andanotheron efficient load sharing and connection movement in a network
• Awarded‘CiscoAchievementAward’and‘CiscoSTAR’foroverallperformance
Khilan Haria
English, Hindi
M.Sc. (Employment Relations), London School of Economics
B.A. (Hons.) (Literature) and M.A. (Literature), Hansraj College, University of Delhi
3 years 6 months of experience in Consulting industry.
GradTrain: Associate Director
• Businessheadforastartupineducationsector
• Responsibleforproductdevelopment,salesandmanagingteamoftenemployees
Ernst & Young Pvt. Ltd.: Associate Consultant - Business Advisory Services
• Consultingexperienceacrossretail,utilities,infrastructure,bankingandtechnology for competency development, ESOP’s and sales force effectiveness
• Streamlinedknowledgemanagementsystemforthepractice
Komal Jalan
English, Hindi, French
B.Tech. (Metallurgy), IIT Kharagpur
3 years 9 months of experience in Investment Banking industry.
Global Market Centre, Deutsche Bank Group: Senior Analyst
• Equitystructuring,structured/pricedmorethan300 complex exotic derivatives using state of art techniques
• HelpDeustcheBankstructureandhedgeUSD4billioncash/synthetic/hybridCDOs
Byte Consulting Pvt. Ltd.: Software Engineer
• Buildingmodelsfordebtcashflows
• Modelingsecuritisationofassetsusingdealdocuments
Krishanu Sinha
English, Hindi
B.Sc., St. Stephen’s College, University of Delhi
2 years 9 months of experience in Consulting industry.
Accenture Services Ltd.: Business Analyst
• Workedonstrategyandsupplychainprojects, delivered 20% cost savings in the supply chain of a
consumer electronics client
• Shareholdervalueanalysistoidentifypotentialareasofengagement
• DevelopedbusinessworthINR20millioninstrategyconsulting
• Consistentlyrankedamongsttop5%inpeergroup
• CreatedanM&AtoolkittoidentifycostbenefitsofUSD10millionforaUStelecom company
Kriti
English, Hindi
BS (Electrical and Computer Engineering), Carnegie Institute of Technology, Carnegie Melon University
2 years 8 months of experience in Internet Development Services industry.
SnatchKing Online Pvt. Ltd.: Founder and CEO
• ExclusiveallianceswithTimesofIndiaGroup,Mid-day and Dainik Bhaskar for online classifieds
• OperatedIndia’slargestonlineclassifiedwebsiteSnatchKing.com
• Provisionalpatentsinartificalintelligenceandnaturalanalysis
• Grewthecompanyfromanemployeestrengthof2to15in2years
• CompanyhasnowbeenacquiredbyMid-dayInfomediaLimited
Kunal Kapur
![Page 50: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/50.jpg)
98 99
English, Hindi
B.E. (Computer Science), Delhi College of Engineering, University of Delhi
3 years 9 months of experience in Pharmaceuticals and Market Research industry.
Medo Chem Laboratory Pvt. Ltd.: Director
• Instrumentalinsettinguptwopharmaceutical manufacturing plants in North India
• Diversifiedcompany’sproductportfoliobyintroducingnutraceuticals
• Increasedrevenuesby80%intwoyearsbylaunchingproductsinfivenewstates
• Implementingglobalmanufacturing,environmentalandsupplychainpractises
The Smart Cube: Consultant
• AdvisedAsiansupplychainstrategyforglobalpetrochemicalscompany
• StrategisedentryofEuropeanaircargocompanyintotheexpresscourierservicesin the Nordic Region
Kunal Bansal
English, Hindi
CFA, Cleared Level I, CFA Institute, USA
B.Tech. (Civil), IIT Roorkee
2 years 9 months of experience in Financial Services industry.
Capital One Services (India) Pvt. Ltd.: Senior Associate
• Identifiedfraudtrendsandconstructeddefencesto save over USD 10 million annually (7.7% of overall transaction fraud)
• Received‘CapitalOne-Icon’awardformentoringjunioranalysts
• Collaboratedwithteamsacrossgeographiestodesignandimplement‘International Traveller’ strategy
• Developedbreak-throughquantitativemodelstoimprove‘defaultrisk’predictionsin collections
Kunal Garga
English, Hindi, French
B.A. (Economics), Franklin and Marshall College
3 years of experience in Real Estate industry.
Knight Frank India Pvt. Ltd.: Assistant Manager - Research
• Workedonfirsteverofficerentforecastingmodel formulated by an Indian IPC
• Formulatedmodeltoquantifypotentialmarketsizeof middle income housing by 2011
Zenta Knowledge Services Pvt.Ltd.: Process Lead - Citigroup/ Barclays Underwriting Team
• InstigatedareductionofcycletimeforunderwritingofCitigroup/Barclays commercial mortgages
• Awarded‘EmployeeoftheMonth’forthesuccessofaqualitycontrolmodelI devised for a project
Zenta: Consultant: Bear Stearns Securitization Group
• Oversawassetsummaryreportpreparationandclientcommunication
Kunal Sabharwal
English, Hindi
Masters in Finance & CFA Charter, ICFAI University
B.Com. (Hons.), Bhawanipore Education Society College, University of Calcutta
2 years 11 months of experience in Insurance industry.
AON Specialist Services Pvt. Ltd. (ASSPL): Assistant Manager
• Investmentadvisoryservicesforpensionfunds
• TeamLead(10members)handlingthehighestrevenuegeneratingoffice
• Actuarialvaluationsandassetliabilitymodellingforpensionfunds
• Advisoryservicesforpensionfundbuyouts
• Oneofsixoutof100selectedfortheleadershipdevelopmentprogrammeofthe company
Rakhecha Insurance Consultants Pvt. Ltd.: Consultant
• Teamleadforsourcingclientsforinsurancebrokeragebusiness
• Handledthelargestclientaccount
Laxmipat Singhi
English, Hindi, Telugu
B.Arch.,JNTUSchoolofPlanning&Architecture,Hyderabad
3 years of experience in Real Estate industry.
Freelancer: Architect/ Interior Designer
• Designaspects-spaceplanning,volumetricstudy, furniture and illumination design
• Managementaspects-clientservicing,projectplanning,productspecificationand financial estimations, periodic site evaluation and supervision
Freelancer: Actress/ Model
• ActedinfourTelugufilms(KarthikeyaCreations-SasirekhaParinayamu,SM Creations - LIfestyle, WorthWatching Entertainment - Yuvatha, Amigos Creations- Happy Days)
• ActedinaTelugutelevisionserial(AnnapurnaStudios-Yuva)
Madhumita N
English, Hindi, Telugu
B.Tech. (Civil), IIT Madras
3 years 5 months of experience in Financial Services industry.
Capital One Bank (UK): Senior Business Analyst (credit cards)
• Identifyingimpactofloyalty/satisfactiononcustomer value
• Creatingmonthlymarketingplansaligningwithbusinessstrategy
• Relaucheddirect-mailchannelwith>75%reductioninfixed-cost
• Created‘Balanced-Scorecard’,afirstofitskindattempttointegratestrategyacross different teams
• Developedchequestargetingmodelleadingto40%decreaseinmarketingspend
• Created2008,2009and2010marketingbudgetplansforentireacquisition/ customer-management activity
Mallika Kodali
English, Hindi
B.Tech. (Hons.) (Electronics & Communication), NIT Kurukshetra
3 years 9 months of experience in IT (Services) industry.
Accenture: Senior Software Engineer
• CRMsolutionarchitectforamajorpublicservices ‘Diamond’ client
• Client-liaisonperson,responsibleforschedulingprojectreleases
• Teamleadinthesoftwaretestphase,involving900man-daysofeffort
• Co-ordinatorforLife@Accenturesocialeventsandteamsuccesssurveys
• Responsibleforend-to-endtestingof2CRMfunctionalities
• Winner-ASEAchieversAward2006-2007andcontributedtooffshoringof70% project activities
Manavendra Davar
English, Hindi
B.Tech. (Civil), IIT Kanpur
3 years 9 months of experience in Financial Services and IT (Services) industry.
HSBC Electronic Data Processing India Pvt. Ltd.: Assistant Manager (Analytics)
• Toassessandmitigatecredit-riskinpersonalfinancial services portfolio of HSBC, Europe
• StartedenvironmentalclubtomakeHSBCagreenerplace
Fair Isaac Software (India) Pvt. Ltd.: Software Quality Assurance Engineer
• Detailedanalysisoffeaturesofpredictiveanalyticsproduct,acreditrisk management tool
• SpotAwardforoutstandingperformance
• MentorforFairIssacBuddyProgrammeforcampusrecruits,2008
Manjari
English, Hindi
B.E. (Information Technology), Delhi College of Engineering, University of Delhi
2 years 9 months of experience in Electronics industry.
ST Ericsson: System Software Engineer
• Evaluateandimplementnewdesignfeaturesin Bluetooth IP
• Createandstandardisetestingandvalidationproceduresfornewfeatures
• Inventedprocessforenablingcommunicationstacktorunacrossseveraldevices, patent pending
• Inventionrecognisedasamongsttop3patentproposalsfromIndia
• NominatedforCEO’scorporaterecognitionawardfordevelopingkeyproduct differentiator for IP
• Significantlyimprovedefficiencyoftestingprocessesbycreatingautomatedsuite
Mayank Agarwal
English, Hindi, Tamil
MBBS, Sri Ramachandra Medical College & Research Institute, Sri Ramachandra University
2 years 10 months of experience in Healthcare industry.
Dr.RamManoharLohiaHospital:JuniorResident
• Helpedorganize‘WoundCon2009’and‘WorldKidney Day’
Public Health Foundation of India: Intern
• Assistedseniorstaffincarryingoutresearchactivities
• UndertookastudyontheAarogyasrischemetounderstandtheutilityofsuch schemes in future
Pushpanjali Medical Centre Heart and Trauma Hospital: Resident Medical Officer
• Undertooktheinitiativeofreducingbillingtimeby50%
Dr. Ram Manohar Lohia Hospital: Intern
• Exposuretoruralaspectofhealthservicesthroughthreemonthsruralposting
• Activeparticipantinthenationalpulsepolioeradicationcampaign
Mayank Bharat
English, Hindi
Dual Degree - M.Tech. (Mechanical Engineering), IIT Madras
2 years 9 months of experience in FMCG industry.
ITC Ltd.: Maintenance Incharge
• Partofmanagementteamtoplanandnegotiatethe long-term agreement with labour union
• CapitalexpenditureplanningworthINR830million
• Led17Technicianstoincreaseplantproductivityby25%
ITC Ltd.: Project Engineer
• Improvedoperationsandmaintenancesystemsoftwonichetobaccoprocessing lines with focus on labor productivity and capacity planning
• LedSixSigmaprojecttoimproveoverallproductqualitygainsworthINR3million
• WorkedonINR2100milliongreenfieldtobaccoprocessingproject
Mayank Sharma
English, Hindi, Tamil, Spanish
B.Com. (Hons.), Lady Shri Ram College for Women, University of Delhi
2 years 10 months of experience in Consulting industry.
Ernst & Young: Analyst
• Led15memberteamtoachieveINR6millioncost saving, through supply chain efficiencies, for a INR 7 billion company
• ConductedINR4millionmarket-studyforaFortune500company
• InitiatedE&Y’sfirstpro-bonoconsultingengagement
Bank of America: Project Trainee
• IndependentlyhandledaUSD70millionletterofcreditaccount
• LedateamoffourtocentralisetradefinanceoperationsinChennai
KJJohn&Co:ResearchAnalyst
• Recommendedreleventcaselawstosupportcounselsinpreparingargument
Meenakshi Ganesh
![Page 51: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/51.jpg)
100 101
English, Hindi, Kannada
B.Tech.(Hons.)(ComputerScience),NITJamshedpur
3 years 9 months of experience in IT (Services) industry.
MindTree Ltd.: Associate
• Co-ordinatedwithteamsfromEurope,USandAsia, managing global purchasing applications for an
automobile manufacturer
• Initiatedapplicationperformanceimprovementandachievedcostreductions
• Mainframecommunitychampion;organisedknowledgesharingsessionsfor250 members
Cognizant Technology Solutions: Programmer Analyst
• Leda7-memberteamtodesignandimplementhealthcareenterprisecapitation modules
• Analysedandautomatedbusinessprocessesreducingeffortsby35%
• Adjudged‘BestPerformer’forcontributionstofinanceandhealthcareverticals
Megha Yethadka
English, Hindi, Bengali
CA, ICAI
B.Com. (Hons.), Shri Ram College of Commerce, University of Delhi
1 year of experience in Investment Management industry.
JaiMaaVinimayPvt.Ltd.:Director
• Identifiedandanalysedinvestmentopportunitiesinequitymarketsandformulated investment strategies
• Expertinvestorinopportunitieslikeopenofferanddelisting
• ManagedaninvestmentportfolioofapproximatelyINR100million
• Earned36%returnfortheportfolioin2009-10
• ExtensivelyinteractedwithSEBIandmerchantbankersinrelationtoinvestmentsand the laws governing situations like open offer and delisting
Mehul Choudhary
English, Hindi, Gujarati
CA, ICAI
CS, Institute of Company Secretaries of India
B.Com., Narsee Monjee College of Commerce & Economics, University of Mumbai
2 years 3 months of experience in Investment Banking industry.
Classic Stripes Ltd. (ASTARC Group): Analyst
• Preparedentrystrategyandbusinessmodelfornewbusinessline(fleetgraphics)of existing company
• Preparedbusinessmodelfor1320MWpowerplant
Yes Bank Ltd.: Associate
• Preparedfirstrealestatemodeloftheinvestmentbankingteam
• Negotiatedtermsheetsfor2prospectiveinvestments
• Preparedfinancialmodelsandinvestorpitchesacrossindustries(education,OOH, realestateandmobileVAS)
• Unearthedfraudsin3branchaudits
Mihir Shailesh Kamdar
English, Hindi, Bengali, Punjabi, Marathi
B.Des. (Fashion Design), NIFT Delhi
2 years 8 months of experience in Textiles and Apparel industry.
Technopak Advisors Pvt. Ltd.: Associate Consultant
• Marketingservices:Representationforbusiness development for a globally renowned fashion forecasting service in the Indian sub-continent
• Travelandmallretailstrategy,involvingbrandportfoliodevelopment,performance management and market research
V.F.ArvindBrandsPvt.Ltd.:Designer
• Productdevelopment,womenswear,Wrangler:Trendforecasting,line conceptualisation, graphics and silhouette design
• Marketingactivities:Assistanceintakingforwardthedevelopmentofmarketing material such as catalogues, line books, photoshoots and fashion shows
Mili Kapoor
English, Hindi, Telugu
MS(Telecommunications),JamesClarkSchoolofEngineering, University of Maryland, College Park
B.E. (Electronics and Telecommunications), Cummins College of Engineering for Girls, University of Pune
2 years 10 months of experience in Telecommunications industry.
IBM (India) Pvt. Ltd.: Package Solution Consultant
• Developed3modulesofthetelecomclientsextensivecallcentreapplication
Tech Mahindra (Formerly Mahindra British Telecom): Technical Associate
• Led2releasesforthequalitycontrolofamobiletelecomoperator’ssalesforce application
• Assignedteamleaderrolewith2yearsexperience,againstthe3-4yearrequirement
• Undertookprojectmanagementandbudgetaryresponsibilities
Linkwell Telesystems: Research Associate
• Researchoninternationaltelecommunicationsunionmodemtransmissionstandards
• Implemented60%oftelecomtransmissionhardwareinsoftwarecode
Mitalee Mulpuru
English, Hindi
B.Tech. (Mechanical Engineering), IIT Guwahati
3 years 9 months of experience in Investment Banking industry.
Global Markets Centre, Deutsche Bank Group: Associate
• Structuredcreditproducts-involvedinnearly15deals ranging from USD 400 million to USD 2 billion
• HelpedDeutscheBanktoreduceexposuretonearlyUSD4billionofleveragedloans during recent credit crisis
• DevelopedmodelstoimplementS&P/Moody/Fitchcriteraforratingandpricing credit derivatives
Byte Consulting Pvt. Ltd.: Software Engineer
• Developedmodelsforidentifyingtradeopportunitiesandassessingcreditrisk
• Developedmunicipalbondtradingsystem
Mithilendu Kumar Jha
English, Hindi
B.E. (Computer Science & Engineering), Sapthagiri College ofEngineering,VisvesvarayaTechnologicalUniversity
3 years 6 months of experience in IT (Services) industry.
Infosys Technologies Ltd.: Technology Analyst
• Workedonproductionsupportofretailexecutionand production planning applications for Kraft foods
• LedKMsoftskillsandleadershipinitiativesfora600memberteam
• PresentedInfosys’workmethodologiesandKMinitiativestoseveralclients
• Performedtheroleofoffshoreteamlead
• TheKMteamIled,receivedInfosysExcellenceAwardsandBestPracticeAward from the client
• Received‘MsInnovator’award
Mrinalini Sinha
English, Hindi
B.E. (Computers), Nanyang Technological University
3 years 8 months of experience in Investment Banking industry.
CreditSuisseAG:AVPProductControl
• Ensuredtheintegrity,completenessandaccuracyof profit and loss and balance sheet for Asia-Pac equity
desk
• Performedindependentpriceverificationandmarketanalysisinadherencewiththe firm’s policies
• Involvedwithstrategicandcontinuousimprovementprojectsandoperation excellence initiatives
• DeployedproductcontrolfunctionsfromLondontoSingapore
• Designedandmanagedinductionprogrammesfornewjoinees
Mudita Chauhan
English, Hindi, Punjabi, Marathi
B.E.(Electronics&Telecommunications),VivekanandEducation Society’s Institute of Technology, University of Mumbai
2 years 8 months of experience in IT (Services) industry.
Accenture Services Pvt. Ltd.: Senior Programmer
• Workedonseverallargestrategicinitiativestoprovidebusinessintelligence solutions to US-based electronics retail giant
• AutomatedquarterlyPCI/SOXauditcomplianceprocessforretailclients
• Keyareas-applicationdesign,developmentandenhancement,onshore co-ordination and knowledge transition
• ‘ASEAchiever’sAward’forexcellenceinperformanceasabusinessoperatorand value creator
• LetterofappreciationfromMDforcommitmenttodevelopingpeopleatAccenture
Namrata Kohli
English, Hindi, Kannada, French
B.Com., Mount Carmel College for Women, Bangalore University
2 years 10 months of experience in Consulting industry.
KPMG: Business Executive - Risk Advisory Services
• Providedindustry-tailoredsolutionssuchasbusiness process re-engineering, internal audits and model business processes
• Re-engineeredHRfunctionsofaleadingmultinationalITsolutionprovider’sIndian operations
• ObtainedrepeatengagementsforKPMGbasedonworkperformedatvariousclients
• SelectedbyExecutiveDirectorofKPMGforbusinessdevelopmentinitiatives
• Coachedandsupervisedjuniorteammembers
Namratha Jagadish
English, Hindi
B.E. (Communications), Main Campus, Purdue University
3 years of experience in Manufacturing and Financial Services industry.
Zenith Forge Pvt. Ltd.: Procurement Manager
• Materialsprocurementandmanagement
Halcyon Resources and Management Pvt. Ltd.: Analyst
• Partoftheinvestmentteamthatanalysedandresearchedprospectiveinvestment opportunities
• Didindustryandcompanyspecificresearchonavarietyofsectors
Trading Technologies: Associate Quality Engineer
• Createdautomatedtestcasesusinginternalautomationsoftware
• SoloprojectwithXetra
Natasha Sood
English, Hindi
B.Tech. (Mechanical Engineering), IIT Delhi
3 years 9 months of experience in Engineering industry.
Applied Materials: Technical Leader - Mechanical
• Providedautomationsolutionsforsolarcelland semiconductor manufacturing
• FiledUSpatentforgripperdesignforhandlingultrathinsolarsiliconwafers
• Technicalpaperselectedforpresentationatannualinternationalemerging technology conference amongst top 350 papers selected globally
Navdeep Gupta
![Page 52: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/52.jpg)
102 103
English, Hindi, Punjabi
BBA(Finance),JIMS,GGSIndraprasthaUniversity
3 years 9 months of experience in Financial Services industry.
Capital IQ Inc.: Senior Research Associate
• Researchedpublicofferingtransactions
• Establishedandledthenon-USandnon-English coverage processes
• Standardisedresearchguidelines
• Becametheprocesstrainerwithin10monthsofjoining
• Performedqualityanalysisandmentoredsubordinates
• Trainednewrecruits
PNB Principal Financial Planners Pvt. Ltd.: Relationship Assistant
• Sourcednewclientsformutualfundsandbonds
• Maintainedclientsportfolios.
• Recordedhighestsalesintheteam.
• Initiatedthe‘RotaryClubProject’thatsubstantiallyincreasedsales
• Mentoredmycolleaguesoncommunicationskills
Navendu P Dogra
English, Hindi
MS (Pharmacology), Medical School, University of Minnesota - Twin Cities
B.Pharm. (Pharmaceutical Science), Institute of Chemical Technology, University of Mumbai
3 years 2 months of experience in Pharmaceuticals industry.
Genentech Inc.: Research Associate
• Businessdevelopmentforlargeproteintherapeutics
• Regulatoryfilings(US,CanadaandEU)
• Pre-clinicalandclinicaltrialPK-PD
• Peerreviewedjournalpublications
• LaunchedmultipleUSFDAcompliantapplications
Colgate Palmolive (India) Ltd.: Research Assistant
• Independentresearchonclinicalsimulations
• Globalcompetitiveanalysisinareaoffabriccareandoralcare
Express Pharma Pulse and Express Healthcare Management: Sub-Editor and Reporter
• Industryspecificscientificarticles
• LiaisonwithleadersinthehealthcareIndustry
• Shortesttimetofrontpageon‘ExpressHealthcareManagement’
Navneet J Sharma
English, Hindi, Telugu, Tamil
B.E. (Hons.) (Electronics and Instrumentation), BITS Pilani
2 years 9 months of experience in Telecommunications industry.
Cisco Systems Inc.: Software Engineer
• R&DforOperationsAdministrationandManagement (OAM) on ethernet networks on a USD 10 million project
• ResearchanddevelopmentinethernettechnologyonCiscoproducts
• HandledcustomercasesinvolvingdirectinteractionwithCiscocustomersspread across different geographies
• SoleownershipofaCiscoproductcomponentwithin1styearatCisco
• RepresentedtheBUatTechShow2007
Neeharika Chenna
English, Hindi
Post Graduate Program in Broadcast Management, MICA Ahmedabad
B.A. (Economics), St. Xavier’s College, University of Mumbai
3 years 7 months of experience in Media industry.
NDTVMedia:SeniorExecutive,Sales
• ManagedadsalesforNDTV24x7withannualtargetofINR130millionfor2009
• ClientrelationshipmanagerforHUL,Loreal,PepsiandBSNLformorethanayear each
• Handledsponsorshipfortelevisedeventssuchas‘NDTVIndianoftheYear’
• Achieved100%salestargetsforthreeconsecutiveyears
• Awardedtwopromotionsinoneyear
Neeti Mishra
English, Hindi, Punjabi
B.E. (Production Engineering), Punjab Engineering College, Chandigarh
2 years 8 months of experience in IT (Services) industry.
Accenture Services Pvt. Ltd.: Analyst Programmer
• Involvedinrequirementgathering,highleveldesign and functional design - technical design transition at onsite
• Definedtestingobjectivesforsuccessoftheprogramme,mobilisedteam
• Responsibleforproductionandownershipofhighqualitytestdeliverables
• Teamleadofassemblytestteamatoffshoreforallprojectreleases
• Associatesoftwareengineer-achieversawardforexceptionalperformance
Neha Khurana
English, Hindi
B.Tech. (Mechanical Engineering), NIT Allahabad
2 years 9 months of experience in Energy industry.
Schlumberger: Mechanical Engineer
• MemberofteamthatestablishedSchlumberger TechnicalServicesIndia(STSI)inIndia;responsiblefor defining and implementing organisational vision and
goals
• Responsibleforbuilding,trainingandsupervisingteamofengineersworkingon equipment design for first Singapore clients of STSI
• ProjectmanagerforoilwellservicesequipmentofUSD1million
• Servedas‘SiteSecurityOfficer’forinformationsecurityofSchlumberger,Pune
Neha
English, Hindi
CA, ICAI
B.Com.,SriVenkateswaraCollege,UniversityofDelhi
1 year 9 months of experience in Financial Services industry.
BSR & Company (KPMG): Assistant Manager, Assurance
• Providedqualityservicestoclientsindiverseindustries by ensuring compliance with accounting and auditing standards
• LedauditteamsforproperexecutionandcompletionofIFRS,USGAAP,SOX, statutory and tax audits
• Builtrelationshipswithkeyclientcontacts
• Ratedanexceptionalperformer,inthetop10%ofthecompany
• KeyresourceinprovidingauditservicestoSEClistedclient
Nidhi Batra
English, Hindi
BS (Computer Science), Purdue University
3 years 2 months of experience in Telecommunications & Financial Services industry.
Starent Networks (India) Pvt. Ltd. (now part of Cisco): Program Manager
• LedthereleasemanagementforGGSN,InTracerand TTG products
• Workedwithcustomerandproductstrategyteams
• Awarded‘EmployeeoftheMonth’twice
Citigroup,Jacksonville:ProjectManager
• Ledplanninganddevelopmentactivitiesfor‘OneCitiView’softwarereleasestotalling 100,000 manhours of work
• Reducedcriticalcustomerissuesby15%incitibusinesscards
• SpearheadedcreationofasupportsystemforNorthAmericanemployeesto enhance telecommuting
Nikhil Alok Goenka
English, Hindi
B.Tech.(ElectricalEngineering),JSSAcademyofTechnicalEducation, Uttar Pradesh Technical University
3 years 10 months of experience in Consulting industry.
The Corporate Executive Board: Senior Research Analyst, Technology Practice
• Developedstrategicresearchproductsthatprovidedguidancetoaclient-baseof 600+PMOandapplicationsexecutives
• Co-authored3books,whitepapers,andwebinarsontopPMOmanagement- specific issues, including EPMOs, stakeholder management, agile methodologies, and project business outcomes
• Receivedfirm-wide‘OutstandingContributiontoSocialService’awardforleadinga pro-bono consulting engagement at Delhi-based NGO, Khoj Foundation
Nikhil Gupta
English, Hindi
B.Tech. (Hons.) (Computer Science), International Institute of Information Technology
2 years 11 months of experience in IT (Products) industry.
Amazon Development Center (India) Pvt. Ltd.: Software Development Engineer II
• DesignedtechnicalsolutionstoavarietyofbusinessproblemsinAmazon’s worldwide customer service space
• StandardisedtheCSprocessoftransferringcustomercontactsresultinginannual savings of USD 744,700
• Mentoredpeersacrossdifferentsites
• Receivedcustomerobsessionawardfortakinginitiativeandreducingsearchlatency in internal applications
• Honouredforpresentingtechnicalpaper‘WizardasaRuleEngine’atAmazon Developer Conference ‘09
Nikita Pandey
English, Hindi
CA, ICAI
B.Com., H R College of Commerce & Economics, University of Mumbai
1 year 9 months of experience in Consulting industry.
IK Oils: Director - Operations and Commercial
• PreparedtheproductionplanforrefineryunitofaINR1billioncompany
• Identifiedopportunitiestoincreasetheturnoverbycreatingbetterdistributor channels
• SetupaB2Bmarketingplantoorganisedretailchains
• Ledateamof50employees
Ernst & Young: Consultant
• Identifiedfavourabletaxjurisdictionsforcompanies
• Partofthecoreteamtoadviseoninternationalacquisitiondeals
Nirav Shah
English, Hindi
B.Tech. (Mining Engineering), ISM Dhanbad
3 years 10 months of experience in Energy/ Extractive Minerals industry.
HindustanZincLtd.(VedantaResourcesPlc.):AssociateManager - Commercial
• HandledannualsalesofUSD250millionto9Asian countries
• Ledmarketshareimprovementfrom4.5%to23%within2years
• Wontheprestigious‘StarofBusiness’award
• Handledprocurement,worthUSD30million,ofcommodities,specialitychemicals, OTR tyres and equipments
• DeliveredannualisedsavingsofUSD3.6millioninprocurement
• Playedkeyroleinfeasibilityassessmentforrailtransportofacid,afirstforIndia
Nishchay Chadha
![Page 53: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/53.jpg)
104 105
English, Hindi, Bengali
B.Tech. and M.Tech. (Mechanical), IIT Kharagpur
3 years 7 months of experience in Consumer Products industry.
ITC Ltd.: Assistant Manager - Technical (Haridwar)
• Partofthe3-memberteamresponsibleforstartingand stabilisingITC’sonlyownedbiscuitfactory(90%+
efficiencies)
• Headofengineering,leading8managersand22workmen
• WorkedonchangeoverofbiscuitSKUsfromstandardpacketsizestonewdeclared sizes to increase contribution
• Technologyevaluationandassessmentforallprojectsatplant
• Energyaudit-reducedconsumptionofpowerby20%andfuelby8%
Nitin Mohta
English, Hindi
B.E. (Hons.) (Electronics & Communication), Delhi College of Engineering, University of Delhi
3 years 9 months of experience in IT (Products) industry.
LearnBiz Simulations LLP: Co-Founder & Designated Partner
• Designedanddevelopedcomputer-runintellectualbusinesssimulationsand software applications
• Handledothertechnicalaspectsforsmoothfunctioningoftheventure
Motorola (India) Pvt. Ltd.: Software Engineer
• EngineeredthedesignanddevelopmentofWindowsMobileSmartPhoneswhich involvedstintsinNewJerseyoffice
• Ledtheprocessforsuccessfulfunctioningofthephone’skeypadandRILdriver
• CollaboratedwithMotorola’sUS,ChinaandLatinAmericateamsforthe development of Q-Series SmartPhones
• Mentoredandhelpedthe‘on-boarding’ofnewrecruits
Nivesh Seth
English ,Hindi
B.Tech. (Hons.) (Mechanical Engineering), IT-BHU
2 years 10 months of experience in Consumer Products industry.
Hindustan Unilever Ltd.: Production Manager - Toothpaste Plant
• Ledateamof7executivesand243workmenatHUL’s biggesttoothpasteplant;annualcapacityof16000tonsandturnoverofINR4billion
• Ledinitiativestoreduceplantconversioncostby20%anddeliveredsavingsof INR 30 million
• Delivered70%improvementinqualityatdepotlevel&5%increaseinproductivity
• Youngestleaderofmaterialwastagereductionteamacross8globaloralfactoriesin Unilever
Pankhuri Sakhuja
English, Hindi
B.Tech. (Electronics & Communication), Malaviya National InstituteofTechnology,Jaipur
2 years 9 months of experience in IT (Services) industry.
Tata Consultancy Services Ltd.: Assistant Systems Engineer
• Moduleleaderintheretaildomain
• Suggestedmethodsasabusinessanalysttooptimisetheclient’s(USretailmajor) inventory and thereby reduce operational cost by 2-3%
• Improvedtheperformanceofdataminingoperationsby50%
• Developedaworkforcemanagementsystemthatimprovedtheutilisationof manpower by 3%
Parul Jindal
English, Hindi
B.E. (Computer Science & Engineering), CMRIT, VisvesvarayaTechnologicalUniversity
3 years 9 months of experience in Electronics industry.
National Instruments India: Training and Services Manager India
• Grewservicesrevenue-training,certification,H/WandS/Wservicesby40%to INR 35 million
• IncreasednumberofNIcertifiedengineersto500in2009
National Instruments India: Technical Sales Consultant Lead
• LedateamtomanagetransactionalbusinessforUSD6.6millionSouth-Westregion (30% of NI revenue)
• WorkedwithOEM/VARSandthetopaccountsinthedefence,aerospaceand automation segments
• RecordedthehighestindividualannualsalesofINR45million
English, Hindi
B.Tech. (Electronics and Communications), NIT Kurukshetra
3 years 9 months of experience in IT (Services) industry.
IBM India: System Engineer
• Designed,developedandimplementedretail management modules to facilitate in-store sales, service
and activation for a major US mobile phone services provider
• Leda7memberdevelopmentteamfortheordermanagementsystemofalarge telecom company
• Nominatedforthe‘TopTalentProgramme’byVP&GM,GlobalDelivery,IBMIndia
• Wonthe‘BravoAward’foroutstandingcontributiontoprojectsandclientdelivery excellence
Pearl Jain
English, Hindi
B.Tech. (Hons.) (Electrical & Electronics), IT-BHU
3 years 9 months of experience in Telecommunications industry.
Samsung India Software operations: Senior Software Engineer - 2
• OutstandingcontributionawardforUSD50million Linux mobile platform project leading 300 professionals
• Ledglobalteam(120developers)forUSD20millionJVprojectbetweenVodafone and Samsung
• Businesscontributionawardforleading3projectswith35professionals
• StarPerformerAwardforoverallcontribution
Arada Systems Pvt. Ltd.: Member of Technical Staff (MTA) - Embedded Systems Engineer
• 5StarPerformerAwardfordesignanddevelopmentofUSD2millionAREProject
• Deployedbusinessprocessesfacilitating80%defectclosuresaving35%manhours
Piyush Singh
English, Hindi, Tamil
B.E. (Computer Science), BSA Crescent Engineering College, Anna University
3 years 10 months of experience in IT (Products) industry.
Oracle India Pvt. Ltd.: Senior Applications Engineer
• WorkedondevelopmentofCRMquotamanagement in fusion suite
• Handledqualityandbugtriagingfortheproductdevelopmentteam
• Leddivisionwideinitiativesforbringingstandardsinproductdevelopment
• Solepointofcontactforexternaldevelopmentandprojectmanagementteams
• Receivedtwopromotionsinthreeyears
Infosys Technologies Ltd.: Software Engineer
• ReceivedtrainingatInfosysMysoreandselectedforretailvertical
Prabhu Ramadas
English, Hindi
B.E. (Electrical & Computer Engineering), Georgia Institute of Technology
3 years 1 month of experience in High Technology and Development industry.
World Possible: Co-Founder, Chairman & CEO
• Designandlead,greencommunitycenterdevelopment
• AdvisortoMinistryofEducation,Oman,EthiopiaandSierraLeoneforICT infrastructure
• Developedstand-alonelowcosteducationserversforEthiopia,SierraLeone,India, and New Guinea
Cisco Systems Inc.: Design and Development Engineer
• DesignedthenextgenerationCisco3Kswitch
• EstablishedbesthardwaredesignpracticestherebysavingUSD175millioninannual engineering re-spins
• ManageproductrevenuestreamofUSD1billion
Pranav Rastogi
English, Hindi, Telugu
B.Tech. (Mechanical), NIT Warangal
2 years 7 months of experience in Manufacturing industry.
Larsen & Toubro Ltd.: Senior Engineer
• PlayedkeyroleinlaunchingIndia’sfirstnuclear- submarine, INS Arihant
• Productionin-chargeforintegrationandsettingtoworkthemainhydraulicsand torpedo, missile systems
• Designedandcommissionedhigh-pressuredecontaminationplantsforsubmarines for first time in India
• Developed200indigenisedproceduresforsubmarineoutfittingandsystem integration, saving INR 50 million
• Workedonmarinebusinessdevelopment-marketstudiesandcollaboration exploration with European companies
Prasanthy Gurugubelli
English, Hindi
B.E. (Environmental Engineering), Delhi College of Engineering, University of Delhi
2 years 9 months of experience Business Research and Consulting industry.
The Smart Cube: Assistant Manager
• Ledteamsinthestrategicservicesgrouptodeliver projects to clients across diverse industries
• Assessedmarketopportunitiesinnichemarkets,suchasbiometrics,microstock photography, and e-governance, for Fortune 500 companies
• ConductedskillenhancementtrainingsforIndianandRomaniananalysts
• Developedprototypeofproductbenchmarkingvendorsforclients;initiateda knowledge management solution
• ReceivedOutstandingAchievementAward(2009)andGoldenCubeAward(2008)
Pratibha Vaishnavi
English, Hindi, French
BBS, College of Business Studies, University of Delhi
2 years 8 months of experience in Consulting industry.
McKinsey Knowledge Centre: Research Analyst
• Workedwithhealthcare,consumergoodsandretail clients
• Developedacustomisedanalyticalmodelforanexpansionstrategyforaleading pharmaceutical company
• Conductedextensiveresearchtoimproveprimaryhealthcaredeliveryinlow-income countries
• LedtheformationofadedicatedresearchteamfortheSouthAfricaofficeinIndia
• Designedskillenhancementworkshopsforovera100colleagues
• Recipientofthe‘SuperContributionAward’
Preeti KumarPayal Bhuptani
![Page 54: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/54.jpg)
106 107
English, Hindi
B.A. (Hons.) (Economics), Delhi College of Arts & Commerce, University of Delhi
3 years 9 months of experience in Financial Services industry.
Capital IQ Inc.: Senior Research Associate
• Led2teams(15members)forresearchonprivate equity firms for iBanking clients
• Introducednewdatasets-sovereignwealthfundandshariahfunds
• Designedandimplementednewworkflowprocessesthatensuredfasterdata delivery to clients and reduced manpower requirement
• Authoredguidelinedocumentsfollowedbyglobalresearchteams
• Createdawikiusedbyclientsupportteamsinglobalofficestoresolveclientqueries
Prerak Bhatia
English, Hindi
B.Tech. (Chemical Engineering), IIT Kanpur
3 years 9 months of experience in Chemicals industry.
JohnsonMattheyChemicals(I)Pvt.Ltd.:ProcessEngineer
• Threeyearsofexperienceasprocessengineerin syngas and GTL industry
• LedintroductionofbreakthroughmethonolconvertercatalystsinAPAC
• LedintroductionoffuelcellbusinessinIndiaandacquiredfirstcustomeratINR5 million
• Reductionincustomerresponsetimeby20%byoptimisationoftasks/processes
• Workedoncustomeranalyticsandtargetingstrategies
Evalueserve.Com Pvt. Ltd.: Research Associate, Intellectual Property
• Workedonpatentdraftingandinvalidationsearches
Prerna Singh
English, Hindi, Maithili
Bachelor of Fashion Technology, Apparel Production, NIFT Bangalore
2 years 10 months of experience in Apparel and Retail industry.
Madura Garments, A division of Aditya Birla Nuvo Ltd.: Assistant Manager-Retail Buying and Merchandising
• Handled35exclusivebrandoutletsacrossSouthandEastregion
• 110%achievementoftargetedsalesandprofitsfor2consecutiveyears
• Turnedaround4stores,fromdegrowthto40%growth
• Managed12newstoreopenings
Lifestyle International Pvt. Ltd. - MAX Retail Division: Regional Retail Planner
• Enhancedsalesthroughmerchandise/spaceplanningforstoresinSouthIndia
• Strengthenedwomenswearcategory,increasedsalesatfullpriceto80%oftotal sales
• AwardedA+ratingtwiceinayear
Priyanka Mishra
English, Hindi
CFA, Cleared Level I, CFA Institute, USA
B.E.(InformationTechnology),DJSCollegeofEngineering,University of Mumbai
3 years 2 months of experience in Financial Services industry.
Citigate Dewe Rogerson: Executive
• Preparedreportsonmarketperception,shareholding,stockupdate,peerreview
• Preparedcorporatepresentations,businessreports,pressreleases
• Salespitchtoprospectiveclientsformanagingtheirinvestorrelations
IDBI Capital Markets Ltd.: Research Analyst
• Technicalresearchonsecondarymarket
• Macroeconomicanalysis
• Introducedmutualfunddistributionbusinessin25branchesofIDBICapital
Mastek Ltd.: Software Engineer
• Consultedprojectstoimproveefficiencyofapplications
• Deliveredtrainingto250peopleondatabasetuning
Priyanka Baxi
English, Hindi
B.Sc. (Statistics), Hindu College, University of Delhi
2 years 10 months of experience in Consulting industry.
McKinsey Knowledge Centre: Analyst
• Ledtheanalyticsworkstreamonconsultingprojects across the globe
• HandledmultipleclientsinSingaporeonvariousITandbankingprojects
• Providedmentorship/coachingtonewrecruits
• Awarded‘Tracking+’rankingtwice(receivedbytheteam’stop5%)
• Builtteamcapabilityinnichedomainsthroughtrainings,trainingmodulescovered 15-20 people at a time
• WorkedinmultiplelocationsinIndiaandSingapore
Priyanka Malik
English, Hindi, Bengali
PG Diploma in Pharmaceutical Management, Narsee Monjee Institute of Management Studies
B.Pharm.,JamiaHamdard,Delhi
3 years 11 months of experience in Consulting and KPO industry.
McKinsey Knowledge Centre: Senior Research Analyst
• Specialistmemberofconsultingteamduringstudiesandclientinteractions
• Fulfillingresearchforhealthcareclients
• Codifyingknowledgeintopracticedocuments
• BronzeMedalwinnerattheGlobalKnowledgeOlympics,USA2008
ORG-IMS Research Pvt. Ltd.: Executive
• Servicinginformationrequirementsforclientsinhealthcare
• Creatingcorporatepresentationsforclientmarketingteams
• Trainingclientsondeliveryplatformsandsoftwaresfordataanalysis
• Firstjuniorexecutiveinvitedtotopmanagement’shalfyearlystrategicconference
Priyanko Basu
English, Hindi, Tamil
CFA, Cleared Level I, CFA Institute, USA
B.E.(ComputerEngineering),VESIT,UniversityofMumbai
3 years 9 months of experience in Investment Banking industry.
Nomura Services India Pvt. Ltd.: Developer
• Single-handedlytransitionedanop-riskapplicationto India operations
• Enhancedop-riskapplicationfornewhierarchicalstructureofacquiringcompany and drill downs
• CollaboratedwithIndiariskmanagerstogo-liveonmarketriskapplicationfor primary dealership business
Lehman Brothers Ltd.: Developer
• ImplementedregulatorycompliancereportresultinginUSD1billionsavings
• AutomatedM&Adealcapturinginthefirm’smarketriskmanagementsystem
Raghuram Ananthasayana
English, Hindi, Telugu
BS (Business Administration), California State University, Pomona
2 years 9 months of experience in Financial Services industry.
PricewaterhouseCoopers: Senior Analyst (Corporate Finance & Investment Banking)
• Workedonengagementsinvolvingprivateequityplacement(realestatesector)
• Scopeofwork-informationmemorandum,financialprojections,investor identification, transaction structuring
• IdentifiedstrategicpartnersforFairmont’sentryintoSouthIndia(hospitality transaction) and syndicated private equity (USD 12 million)
• ExecutedUSD60millionequityinvestmentintoarealestatedevelopmentin Bangalore
• USD10millionequityinvestmentintoTeleDNAcommunicationsbyPeepulCapital
Raghuveer Veeramachaneni
English, Hindi
BS (Entrepreneurship & Economics), Babson College, Wellesley, Massachusetts
3 years 4 months of experience in Media industry.
ADI Media Pvt. Ltd.: Business Unit Head (Healthcare & Telecom)
• Responsibleforbusinessandprocessdevelopment for ADI Media (a business information vendor in B2B segment in healthcare, telecom, consumer electronics and broadcast domains)
• Transformedaprint-intensivebusinesstoabroadbasedmediabusiness
• Doubledthehealthcarebusinessintwoyearsandgrewthetelecombusinessby40%
• Controllededitorialcontentandbuiltpan-Indiareadership
• Managedandexpandedrelationshipswithvendorpartners
Rahul Arora
English, Hindi
B.Tech. (Computer Science), IIT Roorkee
3 years 9 months of experience in IT (Products) industry.
Amazon.com: Software Development Engineer
• Managedprojectschedulinganddependenciesacross internal teams
• Ownershipofthedesign,developmentandreleaseofproductfeatures
Trilogy E-Business Software (India) Pvt. Ltd.: Senior Technical Associate
• Consultingwithclients,providingcustomisedsolutionsforbusinessrequirements
• GeneratednewrevenuestreamsworthUSD6millionbymigratingclient’s compensation systems onto Trilogy’s products
• Ratedannualtopperformerin2008forensuring‘customersuccess’forcompany’s biggest financial domain client
• Executedprojectsinvolvingcollaborationwithcross-functionalteams
Rahul Jain
English, Hindi
MS (Financial Economics), Said Business School, University of Oxford
B.A. (Hons.), Shri Ram College of Commerce, University of Delhi
3 years 2 months of experience in Financial Services industry.
Ernst & Young India Pvt. Ltd.: Analyst (Transaction Advisory Services)
• Identifyingpotentialtargets,preparingpitchesandinformationmemoranda
• Preparingbusinessplansandcarryingoutcompanyvaluations
• IntegralmemberofteamadvisingModernDairiesonraisingfundsfromIFC
• IntegralmemberofteamadvisingSercoGroup’sUSD40millionacquisitionof InfoVisionBPO
• Advisedatelecomoperatoron3Glicensebiddingandalistededucationalservices firm raising funds
Rahul Malik
English, Hindi
B.Tech. (Ocean Engineering & Naval Architecture), IIT Kharagpur
3 years 5 months of experience in Investment Banking & Consulting industry.
SBI Capital Markets Ltd.: Deputy Manager (Project Appraisal & Structured Finance)
• Preparationofprojectinformationmemorandumandraisingfundsforinfrastructure projects (ports, power plants and coal mines)
• Achievedfinancialclosureof4debtsyndicationassignmentswithcombineddeal- size of over INR 25 billion
• WorkedonGopalpur,MumbaiandSalayaPortprojects
i-maritime Consultancy Pvt. Ltd.: Consultant
• Preparationofbusinessplans,entrystrategiesandtechno-commercialfeasibility studies for development of projects in maritime infrastructure domain
• ExecutedthefirstinternationalprojectofourcompanyinAfrica
Rahul Prasad
![Page 55: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/55.jpg)
108 109
English, Hindi
B.Tech. and M.Tech. (Chemical Engineering), IIT Delhi
2 years 9 months of experience in Consulting industry.
McKinsey and Company: Business Analyst
• Workedonmarketentryandgrowthstrategies,sales and marketing transformation projects, strategic due
diligence and M&A across telecom, food products, chemicals and contract research industries
• RatedamongthetoptwobusinessanalystsatMcKinsey
Rajat Agarwal
English, Hindi, Tamil, Gujarati, Malayalam
B.Tech. (Electrical and Electronics), NIT Trichy
2 years 9 months of experience in IT (Services) industry.
J235SoftwareIndiaPvt.Ltd.:SoftwareEngineer
• Leadanoffshoreteamof6astheonsiteco-ordinator in Boston having worked in the areas of project
planning and estimation, requirements gathering, design, development, testing and deployment
• Asqualityauditor,auditedinternalengineeringprocessesbasedonCMMIlevel3/5 guidelines
• Workedonavarietyoftechnologiesandplatformshavingworkedonenterprise-level data migration, custom application development and ERP implementation
Rakesh Krishnan
English, Hindi, Telugu, Tamil
B.E. (Electronics & Communication), Madras Institute of Technology, Anna University
2 years 9 months of experience in High Technology/Electronics industry.
Nvidia Graphics Pvt. Ltd.: ASIC Design Engineer
• Developedautomationprocesstoreduceverification effort of each peripheral controller on the computer chip by 3 man-months
• Performedlogic(gate)leveltestingforthememorycontrollermoduleofa breakthrough chip that provided 5X improvement in graphics performance of Apple Mac Books
• Ledmigrationtonewmethodologythatreducedtimetomarketchipsby20%
• Presentedininternationalconferencesandconductedtrainingsessions
Ravitej Sriram
English, Hindi
B.Com. (Hons.), SRCC, University of Delhi
2 years 7 months of experience in Consulting industry.
Accenture: Analyst
• Executedmarketentrybusinessresearchand developed competitive market landscape for communication and hi-tech clients
• CreatedtradeexecutionblueprintforanFMCGmajorformoderntrade
• Workedonoptimalroutingplanforanairlinemajorinpostmergerscenariousing passenger data
• AttendedaglobaltraininginSpainwith200consultants
• Awardedthe‘AboveandBeyond’award
Ridhi Kumar
English, Hindi, Bengali
CA, ICAI
B.Com. (Hons.), SRCC, University of Delhi
1 year of experience in Investment Banking Industry.
Goldman Sachs: Analyst - Investment Banking
• HelpedaCanadianenergycompanyacquireanother oil and gas company for USD 5.5 billion and boost
production from prolific unconventional gas holdings
• AdvisedanAmericancoalcompanytosellitscokingcoalassetsforUSD568million to a Russian mining and metal company
• HelpedanAmericanenvironmentalandhazardouswastemanagementservices company to acquire a Canadian service provider for USD 380 million
Rishi Gupta
English, Hindi, Telugu, Tamil, Sign Language
B.E. (Electrical & Electronics Engineering), Chaitanya Bharathi Institute of Technology, Osmania University
2 years 7 months of experience in IT (Products) industry.
ThePrIncetonReview:VerbalFaculty
• Trained115studentsforGMATandGREexam
University of Wisconsin, Madison: Research Assistant
• WroteCprogramfunctionsforoptimalbusselectioninadistributednetworksystem
• TocreateadatabaseofnetworkIPaddressesandmaintainthem
• AwardedresearchscholarshipofUSD17,646
• CavinkareAbilityAward,2009
Infosys Technologies Ltd.: Software Engineer (Telecom domain)
• EnvironmentteamleadforthejointprojectforBritishTelecomwithTechMahindra and TCS
• ‘BestTraineeof2006batch’award
Sai Prasad
English, Hindi, French, Spanish
B.E. (Electronics and Communications), Thapar Institute of Engineering and Technology, Patiala
3 years 10 months of experience in IT/ ITES and Commodity Trading industry.
Sambhav Enterprises: Manager/ Partner
• BusinessManagementfor10memberyarn-trading company
• ManagedturnoverofINR30-40millionannually
• Personalisedclientengagementandremovedintermediaries
• Achieved28%revenuegrowth
LearningMate Solutions Pvt. Ltd.: Senior Business Analyst
• Workedone-learningproductsforglobalpublishers
• Workedonsalesproposalswithfeasibilityanalysis,effortandcostestimation
• AcquiredprojectsworthUSD500,000
• Awardedstarperformer
IBM (India) Pvt. Ltd.: Application Programmer
• ApplicationtestingonCRMforBhartiAirtel
• Teammemberforpan-IndiaCRMdeployment
Sambhav Jain
English, Hindi, Bengali, Assamese
B.Com. (Hons.), SRCC, University of Delhi
3 years 9 months of experience in Consulting industry.
KPMG India: Executive
• SpokespersonforGlobalGreenatKPMGInternational
• Implementedcarbonreductionsolutions
• Reducedcarbonfootprintby25%inKPMG
Make a Difference (MAD) Dilli: Founder and President
• Supervisedteamof52volunteersteaching120childrenat2shelterhomes
• AppointedVP(Finance)forMADIndia
• LiaisonedwithColtandIBMforfundraising
Ernst & Young India Pvt. Ltd.: Principal analyst
• DevelopedthebusinessplanforCommonwealthGames,2010
• ProjectleaderforfeasibilitystudyofDelhiVAT
• DevelopedenterpriseriskmanagementforCellTel
Samhita Das Sharma
English, Hindi, Bengali
B.Sc. (Hotel Managment), Institute of Hotel Management, National Council for Hotel Management and Catering Technology, IGNOU
3 years 9 months of experience in FMCG industry.
ITC Ltd.: Assistant Manager - Sales
• RelationshipmanagerforSouthMumbai(corporates and consulates) at The Maratha
• ResponsibleforliaisonwithHyderabad,PuneandKolkatamarketingofficesforThe Maratha
• CustodianforsalesforcetrackingandleadmanagementatTheMaratha
• ConfirmedandmanagedtheUBSInvestorMeetfor3consecutiveyears,with revenues worth INR 16.5 million
• ConfirmedandmanagedthecelebrityengagementofformerMissWorldYuktaa Mookhey
Samyajit Das
English, Hindi, Bengali
M.A. (Economics), Delhi School of Economics, University of Delhi
B.A. (Economics), St. Xavier’s College, University of Calcutta
3 years 9 months of experience in Financial Services industry.
Citi, GDM: Assistant Manager
• Developedoff-usspendestimationGLMmodel,recommendedforpatentinCiti
• DevelopedstrategytooptimisecapitalacrossCitiAPACbusinessestomaximiseROE
• ‘OutstandingPerformance’and‘PGDMProjectExcellence’awards
Inductis(India)Pvt.Ltd.:JuniorModeler
• AppliedsurvivalanalysisonaprojectforatopUSinsuranceplayertoestimate customer lifetime value which won ‘Annual Project Excellence’ and ‘Best IP Created’ awards
• Heldacompany-wideseminaronsurvivalanalysis
Sandeep Gupta
English, Hindi, Marathi, Spanish
MS (Electrical Engineering), Illinois Institute of Technology
B.E. (Electronics), Thadomal Shahani Engineering College, University of Mumbai
3 years 3 months of experience in Transportation & IT industry.
International Road Dynamics South Asia Pvt. Ltd.: Manager - Business Operations
• StreamliningoperationsinMaharashtraandGujaratledtorecoveryofreceivables worth INR 3 million over 5 months
• AcquirednewprojectsworthINR1.5million
• Contractmanagementturnedunprofitablecontractintoprofitforthecompany
• Competitivebenchmarkingofproductsandsolutions
Cintra Concesiones de Infraestructuras de Transporte S.A.: Project Engineer
• Planning,specificationandestimationofbidproposals
• Planning,procurementandinstallationoftollcollectionsystems
• NegotiatingwithITpartners
Motorola: Test Engineer - Contractor
• Mobiletelecomdevicetesting
Sandeep Salunkhe
English, Hindi, Marathi, Telugu, Spanish
B.E. (Electronics and Telecommunications), Fr. CRIT, University of Mumbai
2 years 4 months of experience in IT (Services) industry.
Mastek Ltd.: Executive - Project Management Office
• Ledinitiativestoreducethecostperresource, cost of quality, and productivity improvement which led to a cost reduction of USD 120,000
• Aidedimplementationofcentralisedonlinesystemforcustomerfeedback,resulting in 80% of customers giving feedback, as compared to 20% earlier
• FeaturedtwiceinMastekhalloffame
• Awardedmonthlyrecognitionawardthriceinarowfortopperformance
Sandhya Venkatesh Boyapati
![Page 56: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/56.jpg)
110 111
English, Hindi, Bengali
CA, ICAI
B.Com. (Hons.), St. Xavier’s College, University of Calcutta
3 years 8 months of experience in Financial Services industry.
PricewaterhouseCoopers: Assistant Manager
• Riskandcontrolsreviewacrossportfolioofclients including IBM and Infosys
• Clientrelationshipmanagement
• Directreportingresponsibilitytoseniorpartners
• ManagedaccountsreconstructionprojectinSudanforKenana,world’slargest integrated sugar company
• SecondmentwiththeUKoffice-financialauditsacrossindustrysegmentswith clientssuchasVolvo,AT&T,TNTandEon,recognitionawardbytheUKoffice
• Supervisionandcoachingofpeers
Satyajit Mallick
English, Hindi
B.Tech. (Information Technology), IIIT Allahabad
2 years 9 months of experience in IT (Products) industry.
Kuliza Technologies: Senior Developer & Manager
• PartofinitialteamforWeb2.0basedsocialmedia product LifeBlob
• Enhancedandextendedopensourcecontentmanagementsolutionsforanon-profit organisation
• SpearheadedknowledgebaseandapplicationdevelopmentonDjango
• Spearheadedtheefforttolaunchonlineportalforwebteamandcompanyrecruitment
• RecruitmentchampionatKuliza
• Specialrecognitionawardforcustomersuccess
Saumya Chandra
English, Hindi
Dual Degree - B.Sc. and M.Sc. (Exploration Geophysics), IIT Kharagpur
2 years 10 months of experience in IT (Services) and Infrastructure industry.
Bansal Highway Constructions: Partner
• Devisedstrategiesforverticalintegration
• Standardisedsub-contractsanddevisedincentivepackagesforcontractors
• Increasedrevenueby300%inoneyear
• Maintainedcompletefleetoperations
Headstrong Services India Pvt. Ltd.: Senior Associate
• Maintainedanddevelopedtradingapplications
• Waspartofthe‘Headstrong:TeamoftheYear-2008’
• Conducteddomaintrainingsessionsonbasicsoffinance,fixedincomeassetsand derivatives
Saurabh Jain
English, Hindi, French, Spanish
CFA Level II, CFA Institute, USA
B.Tech. (Hons.) (Metallurgical & Materials Engineering), IIT Kharagpur
3 years 8 months of experience in Investment Banking industry.
Credit Suisse: Quant Analyst
• Quantitativeequityresearchforstockselectionfor130/30products
• Developedamodeltopredicthardtoborrowstockswithapproximately70%hitratio
• Analysedspecialsituationtradesfortheproprietarydesk
• Pricingofcustomfundderivatives
TransMarket Group Research India Pvt. Ltd.: Associate
• Fixedincomederivativestrader
Saurabh Roy
English, Hindi, Kannada
B.E. (Information Technology), NIT Surathkal
3 years 9 months of experience in Financial Services industry.
Goldman Sachs Services Pvt. Ltd.: Analyst Developer (Private Wealth Management)
• ManagedtheITinfrastructuredevelopmentofrisk management for private banking Escrow services
• Ledtherisk-managementanalyticsprogrammeforwealthmanagementvertical, delivering the system ahead of schedule with 30% savings in project cost
• Votedamongtop3innovativeprojectsforconceptualisinganddevelopinga securities management system to detect sensitive trades, saving 2 hours of work per day for 440 analysts worldwide
Shailendra Hegde
English, Hindi
B.E. (Information Technology), Netaji Subhas Institute of Technology, University of Delhi
3 years 9 months of experience in IT (Services) industry.
Inductis (India) Pvt. Ltd.: Assistant Manager
• Createdascorecardtomeasureproductivityand identified improvement areas for customer service division of British Gas
• LedInductisteamascustomerinterfacetoBritishGasaccount
• Employeeofthequarterfortwosuccessivequarters
CSC India Pvt. Ltd.: Software Engineer
• Level2supportleadforanonlineinsurancestorefrontforaleadingUKInsuranceco.
Shailendra Nath Jha
English, Hindi
B.Tech. (Hons.) (Chemical Engineering), IIT Kharagpur
3 years 10 months of experience in Energy industry.
Schlumberger Asia Services Ltd.: Senior Field Engineer
• Preparedestimationandworkscheduleforturnkey drilling projects for various national and international clients
• Mobilisedprojectresourcesatdrillingsiteswithindifferentpartsofthecountry
• Monitoredprojectprogressandperformancegoals.Finalreportdeliverytoclienton achieved objectives
• Planandexecutewelltestingtoestablishreservoirperformance.Themain parameters include productivity, flowrate and composition etc. of the oil reservior
Shailesh Lohia
English, Hindi
B.Tech. (Chemical Technology), Institute of Chemical Technology, University of Mumbai
3 years 9 months of experience in Chemicals industry.
C-Tech Corporation: Senior Manager - International Business Development
• DevelopedinternationalmarketsforRodrepel®andTermirepel®products
• Exploredpotentialapplicationareasandtechnicallyassistedcustomersonnew product developments
• AssistedTEC,GovernmentofIndiainformulatingspecifications
• RepresentedC-Techatvariousinternationalforums
• SpearheadedtheCSRprojectofthecompany,‘FanalesIndia’;producedand exported hand-made wax shapes (German brand)
Atul Ltd.: Management Trainee
• Carriedoutproducttestings(chemicals)inlaboratory
• Technicallyassistedbulktrialsatcustomersend
Shalu Birbal Bhanwariya
English, Hindi
CFA, Cleared Level II, CFA Institute, USA
B.Tech. (Computer Science), IIT Mumbai
2 years 2 months of experience in Investment Banking industry.
UBS AG: IT Analyst
• Developedfront-officeinvestmentbankingapplications
• Developedtheweb-basedFXtradesettlementsystem
• AutomatedthesettlementofKoreaswaptrades
• Introducedchartingtothereportingengineforhedgefundclients
• Providedtechnicalsupporttobusiness
Shashvat Rai
English, Hindi
B.Tech. (Mechanical Engineering), IT-BHU
3 years 10 months of experience in Consumer Products industry.
Hindustan Unilever Ltd.: Project Engineering (Manager)
• ManagedprojectsworthINR1.2billion,settingupnew manufacturing units
• Designedfactories,handlinginternalteams,teamsofengineeringconsultants,and over 500 contractors
• DesignedandexecutedaINR700millionprojecttosetupengineeringinfrastructure in 8 HUL factories for a product innovation
• Leda6months,fast-trackedINR500millionprojectofsettingupanewdetergents factory
• ConceptualiseddesignofHUL’sbiggestcreams-lotionfactory
Shashwat Nigam
English, Hindi, Konkani, Portuguese
B.A. (Economics), St. Stephen’s College, University of Delhi
3 years 8 months of experience in Consulting industry.
Hay Consultants India Pvt. Ltd.: Associate Consultant
• Ledprojectdeliverymodulesandimplementation of change management initiatives
• Workedacrossthemanufacturing,realestate,steel,oil&gas,textileandtelecom sectors
• Assistedinsalesoflargeststrategyconsultingprojectworldwide
HDFC Ltd.: Officer Operations
• Ledasalesteam(11members)toachievehomeloantargets
• DisbursedhomeloansamountingtoINR540millionin14months
• AchievedhighestULIPsalesintheNCRRegion-INR1.2million
Shaun Nicholas Lobo
English, Hindi, Bengali
B.E. (Mechanical), PES Institute of Technology, VisvesvarayaTechnologicalUniversity
2 years 8 months of experience in Engineering industry.
Larsen & Toubro Ltd.: Senior Engineer - Sales
• Salesofconstructionandminingequipmentto Kolkata based customers
• Interfacewithfinancingcompaniesforsalesaidfinancingandmarketinformation
• AchievedsalesofINR120millionover20months
• Preparedfleetrecommendationprocessforcustomerswhichhassincebeen accepted by other territories
• ConductedmarketandproductstudiesfortheEasternregion
Sheshadri Mookherjee
![Page 57: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/57.jpg)
112 113
English, Hindi
B.E. (Information Technology), Netaji Subhas Institute of Technology, University of Delhi
2 years 9 months of experience in Consulting industry.
GRAIL Research: Associate
• Supportedmonitorconsultantsonvariousassignments that included market entry strategy, product positioning, and market segmentation
• Setupandoperatedanewcollaborativeteamstructuretoassistmonitor consultants, developed an effective online interface for client interaction during such assignments
• Managedteamsonthreeretaineraccountsthatwererecognisedforoutstanding client service
• Trainednewemployeesforanalystroles
Shikha Gupta
English, Hindi
B.Com. (Hons.), SRCC, University of Delhi
2 years 9 months of experience in Consulting industry.
Inductis (India) Pvt. Ltd.: Senior Financial Analyst
• Providedinvestmentrecommendationsbyconducting industry and company diligence
• Integralpartofbusinessdevelopment,formulatedstrategyforpitchingtonewclients
• Instrumentalinsteeringaprivateequityclientaccounttostablephase
• Mentored2newlyhiredseniorteam-membersonanindustryanalysisassignment
• CommendedbytheCEOofEXLforbuildingamarketingpitchforinsurance companies
Shikha Sharma
English, Hindi
BS (Computer Science), Texas A&M University
2 years 10 months of experience in IT (Products) industry.
Microsoft Corporation: Programme Manager II
• Ledthedesign,planning,developmentandreleaseof Microsoft Office Live’s first personalisation platform
• Integrated3rdpartyemailserviceprovider-receivedtheintegrationawardfrom email service provider
• Ownershipofsign-upforacompleterelease,andincreasedcustomerconversion by 30%
• Intop6%ofMicrosoftbusinessdivision-invitedtotechnicalleadership development programme
• Internprogrammeco-ordinatorandmentorforMicorosoftOfficeLive
Shilpa Shah
English, Hindi
B.A. (Economics), Ferguson College, University of Pune
2 years 9 months of experience in Internet Development Services industry.
Google India Pvt. Ltd.: AdWords Senior Representative
• OptimisedAdWordsaccountsforbetterrevenue recognition and improved RoI for clients
• Interfacedwithadvertiserstooffersolutionsfortheironlineadvertisingcampaigns
• AccomplishedaninternationalprojectatSiliconValley,undertakentoimprovereal- time client interaction and facilitate retention
• Nominatedandservedasa‘Productivitymentor’basedonhighproductivity
• Basedonqualityofwork,selectedtomentorpeersonacoreprocess
Shivani Sharma
English, Hindi, Bengali
B.Sc. (Computer Science), St. Xavier’s College, University of Calcutta
3 years 9 months of experience in Marketing & Advertising industry.
Google India Pvt. Ltd.: Account Associate
• ManagedGoogleAdWordsclientsinNorthAmerican retail and agency clients
• ManagedclientportfoliosthatgeneratedrevenueoverUSD11million
• Workedwithhighpotentialunresponsiveclientsduringrecessionwhichimproved their campaign RoI by 12%
Google India Pvt. Ltd.: Senior Representative
• WorkedonoptimisingAdWordcampaigns,improvedadqualityandproviding cutomer support
• LedaprojectthatimprovedGoogleAdWords’globalcustomersatisfactionby13%
Shubhadipa Sarkar
English, Hindi, Bengali
B.Tech. (Hons.), (Manufacturing Science and Engineering), IIT Kharagpur
2 years 9 months of experience in Energy industry.
Shell Technology India & Shell Global Solutions International, Netherlands (Royal Dutch Shell): Senior Associate Engineer - Mechanical and Lead Coordinator - Logistics Management & Sourcing
• InAmsterdam,supervisedEPCteams,performedefficiencyoptimisationandonsite commissioning exercises for key client refineries across Europe and Asia-Pacific
• Designedandimplementedthegloballogisticsandsupplychainforchemicalfeeds and capital equipments for Bangalore pilot plants, ensuring compliance with EXIM policies and EOU SEZ regulations
• Co-ordinatedwith10cross-functionalbusinessgroupsinShelltoexecutesourcing and maintenance contracts with major vendors
Shubhasish Chattoraj
English, Hindi, Kannada
B.E.(Telecommunication),RVCollegeofEngineering,VisvesvarayaTechnologicalUniversity
3 years 5 months of experience in Hospitality and IT (Services) industry.
ITC Ltd.: Lobby Manager
• Responsibleformanagingfrontofficeoperationsfor ITC Windsor
• IncreasedroomrevenuebyINR0.5millionthroughrelationshipmanagement
• Enhancedcustomerretentionandloyaltybyproactivelyseekingcustomerfeedback
• ImplementedbrandstandardsoftheITCWelcomgroupthroughrigoroustrainingof team members
Cognizant Technology Solutions: Programmer Analyst
• Coreteammemberofthepilotprojectthatacquiredanonlineretaileraccount
• Developedcodeandtestplansforanonlineretailapplication
Shuchita Pai
English, Hindi, Tamil
B.E.(ElectricalEngineering),VJTI,UniversityofMumbai
3 years 10 months of experience in IT (Products) & Investment Banking industry.
Nomura India Services Pvt. Ltd.: Analyst
• Ledthedesignanddevelopmentofthemargin reporting application gateway for Nomura’s prime
brokerage business
• Interactedwithglobalsystemownerstomanagerequirements,developmentand testing
• Nominatedtocompany’scorporatesocialresponsibilitycommittee
IBM India Pvt. Ltd.: Associate System Engineer
• Analyzedbusinessrequirementstodesignusecasesanddatamodels
• Implementedproof-of-conceptinterfacesinvariousproductdevelopmenttools
• Conductedtechnicalworkshopsforteammembers,whichsavedUSD20,000in training costs
Shyam Sunder Subramanian M
English, Hindi, Punjabi, Marathi
BMS,JaiHindCollegeofCommerce,UniversityofMumbai
2 years 10 months of experience in Financial Services industry.
TresVistaFinancialServices:SeniorAnalyst,BusinessDevelopment
• HeadedbusinessdevelopmenteffortsinMiddleEast,SouthAsiaandNorthAmerica
• WorkedonformulatingthebusinessplanforthecompanyforraisingroundA funding
• Financialanalystfor2years,executingfinancialconsulting,valuationandresearch assignments
• WorkedwithPEs,IBsandentrepreneursinTMTandfinancialservicessectors
• Plannedandlaunchedcompany’sblog
Siddhartha Jain
English, Hindi
B.Tech. and M.Tech. (Chemical Engineering), IIT Kharagpur
2 years 7 months of experience in Consulting industry.
ANB Consulting: Consultant
• Helpedatelecominfracompanysave3%ofoperating costs by streamlining project management
• HelpedTataTeleservicesdevelopproductprofitabilitymatrixtoassesprofitabilityof new products
• HelpedreduceoperatingexpensesofaBPObyquantifyingworkforcerequirements
Rio Tinto Alcan: Process Engineer
• WorkedinanaluminiummeltingplantinAustralia
• Achieved5%reductioninpertonmetalcostbyimplementingtemperaturecontrol strategy
• AchievedUSD30,000savingsthroughwastereduction
Sidhant Srivastava
English, Hindi
B.E. (Computer Science), Delhi College of Engineering, University of Delhi
3 years 10 months of experience in Electronics industry.
ST-Ericsson India Pvt. Ltd.: Senior System Software Engineer
• Led6memberinternationalteamforwirelesstelecommunicationprojectsworth USD 5 million in USA, China
• Youngestmember,worldwidesystemarchitectureteamthatdefinesST-Ericsson’s roadmap for mobile platforms
• RepresentedST-EricssoninaUSD120millionpartnershipwithSamsungMobilein Korea
• Founded‘InnovationGroup’inIndiaofficeandledinitiativestowardsbuilding intellectual property within the company
• LedUSD3.2millionSmartPhoneprojectforaEuropeantelecommunicationsmajor
Sidharth Malhotra
English, Hindi, Punjabi
B.E. (Electrical Engineering), Thapar Institute of Engineering and Technology, Thapar University
2 years 9 months of experience in Oil & Gas industry.
Fluor Daniel: Electrical Engineer
• Providedelectricaldesignsolutionsforthe construction of petrochemical refineries
• LedsubstationengineeringanddesignforaUSD1.9billionoilandgasproject
• LedmotorschematicsdesignforaUSD585millionpolysiliconproductionfacility
• Youngestengineerfromthedepartmenttobechosenforastrategictalent development initiative for Fluor employees worldwide
Smita Singla
![Page 58: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/58.jpg)
114 115
English, Hindi, Bengali
M.Sc. (Physics), IIT Kanpur
B.Sc. (Hons.), (Physics), Presidency College, University of Calcutta
2 years 9 months of experience in Insurance industry.
ICICI Prudential Life Insurance Ltd.: Manager-Business Intelligence Unit
• Forecastboardkeyperformanceindicatorsonpolicyholderpersistencythrough predictive modelling
• Aidstrategicdecisionmakingthroughquantitativemeasuresandanalysisofimpact on enterprise value
• Reportnewbusinessprofitabilitytoshareholders
• Quantifyreasonsforvarianceinmarginandinitialcapitalrequirementandpresentto top management
• Sensitivityanalysistodeterminerelevanceofactuarialassumptions
• Develop/modifyretentioncampaignstomeetinternalpersistencymetrics
Sombit Bhattacharyya
English, Hindi
CFA, Cleared Level III, CFA Institute, USA
B.Tech. (Textile Technology), IIT Delhi
3 years 10 months of experience in Investment Banking industry.
Nomura Structured Finance Services Pvt. Ltd.: Associate
• Workedwithcommoditiesindextradingteamto develop a third generation commodity index
• Developedmodelstoconducttechnicalandfundamentalanalysisofthecommodites
• WorkedwithequitystructuredproductsdesktradingwithEuropeanandAsianclients
• Pricedderivativestructurebasedonequities,indicesandcommodities
• Managedandhedgedtradingbookbasedoncommodities
Qwest Telecom Software Services Pvt. Ltd.: Software Engineer
• Softwaredevelopment
• Ledateamofsixpeople
Sonal Dubey
English, Hindi, Oriya
B.Tech. (Mechanical Engineering), NIT Warangal
3 years 5 months of experience in IT (Services) industry.
Capgemini Fssbu India: Associate Consultant
• Handledamulti-milliondebtrestructuringproject
• Recommendedmodificationstoloanrejection/ intimation project and successfully completed the project realising sixteen man month revenue
• Convertedhighcostdatabasestoragetolowcostfilestorageresultinginsavingsof USD 50,000 on annualised basis
• Receivedbestmentorandfacilitatorawardforinductingsixtynewjoinees
Sourav Sekhar
English, Hindi, Tamil
BachelorofMassMedia,JaiHindCollege,UniversityofMumbai
3 years 7 months of experience in Marketing & Advertising industry.
Cartwheel Creative Consultants Pvt. Ltd.: Copywriter and Content Developer
• WorkedonadvertisingandcreativestrategiesforRelianceCommunicationsand UTVinewschannel
• Co-initiatedacricketR&Dlabtodevelopnewtoolstocovercricketforprint,online and television
• InvitedbytheICCtopresentapaperonrankingplayers
• Ranacricketwebsiteholdingwilley.com
Nobby Brand Architects: Associate
• Workedonproductplanningandmarketingstrategies
Sreeram Ramachandran
English, Hindi, Tamil, Marathi, French
B.E.(ElectricalEngineerging),VJTI,UniversityofMumbai
3 years 7 months of experience in Consulting industry.
Deloitte Consulting India Pvt. Ltd.: Consultant
• ProvidedCRMconsultingservicesforFortune100 companies
• LedateamofconsultantsinUSAtoprovideamarketingsolutionforAmerica’s leading healthcare organisation
• ‘OutstandingTeamContribution’awardonaservicetransformationprojectin Singapore/ USA for global telecom company
• TopperformanceratingsonCRMimplementationprojectsininsurance,bio-medical sectors
• Promotedtoconsultantonfasttrack(FY09)
• AppreciationAward(FY07)fromMD,DeloitteConsulting
Sridhar Vishwanathan
English, Hindi, Tamil, Sanskrit
B.E., (Computer Science), Crescent Engineering College, Anna University
3 years 6 months of experience in IT (Products) industry.
Expicient Inc.: Business Consultant
• Ledasoftwareengineeringteamthatlicensed ‘iPhone’ application for a Fortune 500 retail client
• Co-negotiatedaUSD1millionservicecontractthroughcost-benefitstrategiesand presentations
Oracle India Pvt. Ltd.: Applications Engineer
• BuiltkeyintegrationsforOracle’sCRMsoftwareofferingsthatsupportedaUSD83 billion FMCG account
• DeliveredOracleCRMwithsection501compliance,buildingsoftwareenhancements for visually challenged software users
• SetupteamsofsoftwareengineersforIndiaoperations
Sriraman Pattabiraman
English, Hindi
Bachelor of Mass Media, St. Xavier’s College, University of Mumbai
2 years 10 months of experience in Marketing & Advertising industry.
KPMG: Executive
• Mapdevelopmentsandthefirm’sactivityintheICE sector to identify areas for expansion
• Assistedpartnersinformulatingandimplementingabusinessexpansionstrategyin ICE LoB
India Today Group: Senior Executive
• ConductedbusinessdevelopmentforHBRandBusinessToday
• LaunchedandledtheteamforIndiaTodayWomanmagazine
• Achieved108%ofmy2008-09advertisingtarget
• Awardedthe‘MostInnovativeEmployeeoftheyear’attheannualconference 2007-08
Srishti Bakshi
English, Hindi, Telugu
MS (Electrical Engineering), University of Texas - Arlington
B.Tech.(Electrical&Electronics),GayatriVidyaParishadCollegeofEngineering&Technology,JNTU
3 years 6 months of experience in Engineering industry.
Eaton Corporation: Engineer (Aerospace Division)
• Developednewconceptstoprovidecontroltechnologysolutionstoengineering problems faced by customers
• Developedproofofconceptthroughrapidprototypingandmodelbaseddesignfor aerospace and automobile divisions
• Workedinateamof6tolaunchanewdriverwarningsystemintheUSautomobile market
• AwardedE-starforinnovationin2008
Srividya Varanasi
English, Hindi, Tamil, Indonesian
BS (Finance & Marketing), Kelley School of Business, Indiana University Bloomington
3 years 10 months of experience in Consulting industry.
Deloitte Consulting (USA): Consultant - Strategy & Operations
• RealisedUSD2millioninannualsavingsforanautofinancecompanythroughIT offshoring strategy
• AdvisedCXOsofacommercialbanktoimplementprofitableITinvestmentstrategy
• Redesignedsupplychainnetworkforacoffeeproducerincorporatingdistribution channel feedback
DeloitteConsultingIndiaPvt.Ltd.:Consultant(promotedJune2008)
• Developedclaimsprocessingstrategyforapropertyandcasualtyinsurancefirm
• Introducedaninvestmentbank(HongKong)tooffshoring,saving20%inannual costs
Subhashini Prasad
English, Hindi, Telugu
BBA (Hons.), University of Windsor, Canada
3 years of experience in Marketing & Advertising industry.
Wipro Technologies: Senior Marketing Communications Specialist
• Wontwoinnovationawards
• Migratedapilotprocessoffshore
• Deliveredstrategicprojectsthatservedasbenchmarks
Deloitte Consulting: Analyst, Communications
• Introducedtangibleimprovementstothenewsletter
• Rancampaignsforhigh-profile,firm-wideinitiatives
• Launchedfourinternalwebsites
• WonaCSRAward
Deloitte Support Services: Associate Analyst, Marketing and BD
• Establishedanewresearchdeliverable
• Promotedandawarded‘DeloitteWomanoftheYear2008’
• Top5ideafinalistinDeloitteUS-wideInnovationQuest
JWTmindset:AccountExecutive
• Managedkeycorporateaccounts
Suchita Rao Ketineni
English, Bengali
B.E.(ElectricalEngineering),JadavpurUniversity,Kolkata
3 years 8 months of experience in Consulting industry.
PricewaterhouseCoopers: Consultant
• TeamleadexperienceinSAPconsultingprojects across diverse industry sectors
• Implementedmethodologiesresultinginsignificantimprovementinproduction efficiency, cost reduction and profitability of clients
• Assistedinfirm’sbusinessdevelopmenteffortsgenerating20%ofplannedbilling targets in the region
• Ledinitiativesforcapabilitydevelopmentofteamsanddevelopingnewvalue propositions
• Youngestteamleadinbatchof2006
Sukanya Chakraborty
English, Hindi
MS (Biomedical Engineering), University of California, Los Angeles
B.Tech. and M.Tech. (Biochemical Engineering & Biotechnology), IIT New Delhi
2 years 6 months of experience in Consulting industry.
Kinapse Inc.: Senior Analyst
• Managedadata-collectionprojectcoveringover50countriesfor9majormarketed drugs
• Executedalarge-scaleBDprojectspanning200smallandmid-tierpharma companies across Pennsylvania
• Helpedassessandredesignalegacyfinancialdisclosureprocessforatop-10big pharma
• Enhancedtheclient’sEMEAcompliancethroughidentificationofdeviationsfrom EMEA guidelines
• DevelopedawhitepaperhighlightinglinksinFDAsubmissionsandperformancein device sector
Sumit Kumar
![Page 59: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/59.jpg)
116 117
English, Hindi, Telugu, Kannada
PGP, Hospital Management/ Hospital Administration, IHMR, Bangalore
BDS, M S Ramaiah Dental College, Rajiv Gandhi University of Health Sciences
3 years 6 months of experience in Healthcare industry.
Columbia Asia Hospitals Pvt. Ltd.: Customercare Executive
• ImplementedLEANmethodologyindischargeprocess,toreducedischargetimeby almost 50%
• Automatedpatientfeedbackmanagement
• Manageddailyoperations,financeandinsurance
• Preparedhospitalformid-termassessmentofNationalAccreditationBoardfor Healthcare Organisations
• UtilisationstudyofOPDledtoefficientmanagementofpeakhours
• Preparedmedicalqualityindicatorsreportforhospital
Impressions Multi-speciality Dental Care: Private Practitioner
• Introducedfamilycardfordentalcare,whichincreasedpatientsatisfaction
Sundeep Reddivari
English, Hindi, Bengali
M.A. (Economics), Delhi School of Economics, University of Delhi
B.A. (Economics), St. Stephen’s College, University of Delhi
3 years 11 months of experience in Printing & Publishing and Research industry.
India Infrastructure Publishing Pvt. Ltd.: Research Analyst
• Wrotearticlesfor3B2Bmagazines
• Wrote200to300pagesectorreportson‘InternetandBroadbandinIndia’, and ‘Investment Opportunities in Infrastructure in India’
• OversawcontentforB2Bwebsiteonglobalurbantransportationsystems
• Workedinateamtocarryoutcompany’sfirstsyndicatedresearchonenterprise telecom segment
• Organisedconferencesoninfrastructuresectorforindustry
Suparna Dasgupta
English, Hindi
B.E. (Hons.) (Computer Science), Lingaya’s Institute of Management & Technology, Maharshi Dayanand University
3 years 10 months of experience in IT (Products and Services) industry.
Amdocs (India) Pvt. Ltd.: Senior Subject Matter Expert (Tandem Technologies)
• Resourcescheduling,capacityplanning,estimationstudiesforAT&Tprojects
• Implementedautilitytosearchaccount,increasingsearchspeedby50%
• Specialbonusfortransitioningcarrierinterfacesystemsfromacquiredcompanyto AT&T
• Completedinitialsystemtrainingwithin50%ofallocatedtime
Infosys Technologies Ltd.: Senior Software Engineer (Healthcare)
• Developedacapacityplanningproductforhospitals
• Deliveredsolutionsforhealthinsuranceclients(billingandclaimprocessingareas)
• Defectpreventionandknowledgemanagementanchor
Suryanka Jatain
English, Hindi
B.Tech. (Civil), NIT Warangal
2 years 9 months of experience in IT (Products) industry.
Oracle India Pvt. Ltd.: Applications Engineer
• Enhancethevalueoftheexistingenterprise applications by seamless flow of business processes using integration framework and technology
• Conceptualisedanddevelopedproductivityenhancementtoolsforkeycustomers and developers
• Definedrealworldscenariosfortheusageofproductandaccessedthequalityofthe product
• Mentoredthenewteammembers
Sushama
English, Hindi, Punjabi
Bachelor of Software Engineering, Ottawa, Carleton University
2 years 4 months of experience in Manufacturing and IT Consulting industry.
Cast Profiles Pvt. Ltd.: Executive Director
• SettingupofITinfrastructure
• Decreasedworkerattritionby10%,throughimprovedrelationsbetweenworkersand management
• InvolvedinsettinguptwoprojectsworthUSD4million
Thinkwrap Inc., Canada: Software Consultant
• ResponsibleforthesupportanddevelopmentofDepartmentofForeignAffairsand International Trade’s online portal for businesses
• Trainedandmentorednewrecruitsintheorganisation
Swaraj Shergill
English, Kannada, French
B.E.(IndustrialEngineering),RVCollegeofEngineering,VisvesvarayaTechnologicalUniversity
2 years 6 months of experience in Manufacturing and Service industry.
Industries Chimiques du Senegal: Procurement Engineer
• Managedprocurementprocessformechanicaland electrical spares
• Identificationofnewsuppliers
• RegistrationandrelevantproceduresfornewofficeestablishmentinBrussels
• CommunicationfacilitationamongFrench,BelgianandEnglishsuppliersand colleagues
Achindra Online Marketing Pvt. Ltd. - Hungryzone.com: Business Development Manager
• Workedononlineandofflinemarketingcampaigns
• Corporaterelationshipdevelopment
Miebach Consulting - India (Supply Chain Engineering): Associate Consultant
• Physicalwarehouseplanninganddesign
• Providednetworkanalysisservices
• Completed5projectsmovingseamlesslybetweenengineeringandsupplychain strategy
Swathi Parthasarathi
English, Hindi, Tamil
B.E. (Computer Science), BIT Mesra
2 years 7 months of experience in IT (Products) industry.
Microsoft R&D Pvt. Ltd.: Software Design Engineer in Test
• Ledthedesignandqualitycontrolofmultiplefeatures from inception through the full product ship cycle for
Windows 7
• AsproductsecurityownerforcorefeaturesofWindows7XPmode,conducted systematic verifications to find critical security issues
• Designedautomationsystemsthatreducedvalidationeffortby90%
• Collaboratedwithaglobalteamandexternalpartnerstoensurehighqualityand timely delivery
Swetha Balasubramanian
English, Hindi, Spanish
B.Tech. (Hons.) (Electronics and Communication), NIT Kurukshetra
2 years 9 months of experience in Telecommunications industry.
Amdocs (India) Pvt. Ltd.: Senior Subject Matter Expert
• Offshorebusinessanalystforrequirementsanalysis for telecom billing application
• Ledclientsupportteamtoensuresmoothdeploymentofdeliverables
• Technicalarchitectandprojectco-ordinatorthroughoutapplicationdevelopment
• Appreciationawardfromclientforimplementationof4majorreleases
• Managedmultipleaccountsasacorememberoftheimplementationteam
• Onsiteco-ordinatorfor6monthsatclientproductionsite,inUSA
Tanvi Kapoor
English, Hindi, Punjabi
B.A. (Hons.) (Economics), St. Stephen’s College, University of Delhi
2 years 9 months of experience in Marketing & Advertising industry.
Hindustan Unilever Ltd.: Brand Manager
• ResponsibleforlaunchingCif(Unilever’sbiggest household care brand), first national brand launch in 3 years, Cif gained 160 bps in 6 months
• WorkedtowardsmakingVimliquidaUSD10millionbrand
• SolelyresponsibleformanagingRexona-theUSD40millionbrandwithanA&P budget of USD 6 million
• CompletedthebusinessleadershiptrainingprogrammeatHULfor15months acquiring cross-fuctional experience
Tanya Gupta
English, Hindi
B.Tech. (Electrical Engineering), Banaras Hindu University
2 years 7 months of experience in Investment Banking industry.
Morgan Stanley Advantage Services Pvt. Ltd.: Manager
• Managerforclientrelationshipteamforprime brokerage business
• Businessprocessanalysis,re-engineeringtoachieveoperationalefficienciesand savings
• Strategicplanning,buildingprojectroadmaps,trainingendusersanddocumentation
• Streamlinedandautomatedlegalclientinteractionswiththefirm,enhancingclient relationships
• Builtanexceptionmanagementsystem,contributingmillionsofdollarstorevenues
• Builtaclientanalyticstooltohelptakestrategicdecisionsbasedontrends
Taru Bazaj
English, Hindi, Punjabi
M.Tech. (Structural Engineering), IIT Kharagpur
2 years 4 months of experience in Manufacturing industry.
ITC Ltd.: Assistant Manager, Process Improvement and Innovations
• Conceived,designedandlaunchedITD’sfirst innovation centre
• Managed60innovationprojectsand20leanSixSigmainitiatives
• AchievedcostsavingsofINR20millionandinitiatedadditionalprojectswithpotential of additional INR 30 million
• Developedin-housestructuredproblemsolvingtrainingmodule
ITC Ltd.: Assistant Manager, Quality
• Achievedlowestmarketcomplaintlevel:1inayear
• Rated‘outstanding’forimprovingqualityscoresacross10brandsoftheunit
Tarun Bhambra
English, Hindi, Tamil, Kannada
M.Tech. (Metallurgy and Material Science), IIT Madras
B.E. (Metallurgical Engineering), Government College of Engineering, Salem, Periyar University
3 years 9 months of experience in IT (Services) industry.
IBM Global Business Services (GBS): Segment Analyst
• Waspartoftheinternalconsultingteamthatbuiltapricingandprofitabilityanalysis framework for IBM’s hardware business
• Customersegment,competitionandindustryanalysistoaidIBM’smarketingstrategy
• QualitativeandquantitativemarketresearchpertainingtoaidIBM’sconsultingand system integration business
• Workedonmicro-verticalentrystrategyintotheIndiandairymarketforITservices
• Wonthe‘IBMBravoAward’foroutstandingperformance
Thilak Ramanathan Subramanian
![Page 60: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/60.jpg)
118 119
English, Hindi, Punjabi
B.Tech. (Chemical), IIT Delhi
2 years 10 months of experience in FMCG industry.
ITC Ltd.: Assistant Manager, Purchasing (Tobacco division)
• HandledUSD14millionbuyforpackagingmaterials
• LedaSixSigmaprojecttoachieveUSD110,000(2%) savings in metallised paper cost
• Re-engineeredbusinessprocessesformerchandiseprocurement
• Developedpackagingandsourcingstrategyforanewproductcategory
• Aslogisticsmanager,Kidderpore,developedKPIsfordemandfulfillmentprocess; reduced stock-outs by 25%
• Negotiatedlong-termagreementwithunion.Improvedmanpowerproductivityby20%
Toshit Bharara
English, Hindi, Malayalam
B.A. (Hons.) (Economics), St. Stephen’s College, University of Delhi
2 years 9 months of experience in Consulting industry.
PricewaterhouseCoopers: Analyst
• Corporatefinance-researchandanalysisforM&A transactions
• Involvedinprojectswithclientinteractionandnegotiation
• Businessdevelopmentforfinancialadvisoryservices
• Partofthemarketsandindustriesvertical
• Co-authoredastudyontheIndianretailsectorwhichwaspresentedattheRAIRetail LeadershipSummitinJanuary2010
• LaunchedathoughtleadershipstudyontheIndianaerospaceindustryatAero India Show 2009
Treasa Tomy
English, Hindi, Malayalam
B.E.(ElectricalEngineering),VJTI,UniversityofMumbai
2 years 9 months of experience in Manufacturing industry.
Siemens Ltd.: Executive - Marketing
• Responsibleforproductpositioningandproductgap analysis
• LaunchedproductfromChinaintoIndia,aimedatpricesensitivemarket
• Analysisoforderslosttocompetition,withstrategiestorecoverlostcustomers
• Developedandconductedproducttrainingsforchannelpartnersandsalesteam across India
• Supportedsalesteamsandchannelpartnerswithpromotionalactivitiesforproducts
• Matchedproductwithvaryingcustomerrequirements
Tressa Joy
English, Hindi, Bangla
B.Tech. (Pulp and Paper Engineering), IIT Roorkee
3 years 10 months of experience in IT (Services) industry.
Infosys Technologies Ltd.: Associate Consultant
• Co-ordinatedtheexecutionofHRreorganisation projectatInfosysin2009for70,000+developersin
the organisation
• Ledaprocessconsultingassignmentforalargedistributionclientresultingan annual saving of USD 1.43 million for the client, and reduction in total cost of ownership of IT systems by USD 504,000
• FounderchairpersonofInfosysGreenCorridorinitiativeforengagementwithrural population in India
Udayan Dasgupta
English, Hindi
B.E.(ProductionEngineering),SardarVallabhbhaiNationalInstitute of Technology, Surat
3 years 3 months of experience in Non-Profit & NGOs.
Samanvay Pariwar Trust: Project Coordinator
• Createdinfrastructureforfinancialrehabilitationof400- 500 disabled persons
• GotSamanvay’spropertytaxreducedby70%(areductionofINR1million approximately)
Patni Computer Systems Ltd.: Software Engineer
• Workedonweb-basedsolutionsforassetmanagementapplicationsforGEAsset Management
• DreamTeamAward2007
Ujjaval Gupta
English, Hindi, Bengali
B.Tech. (Ocean Engineering & Naval Architecture), IIT Kharagpur
3 years 8 months of experience in Maritime industry.
Axsys Technologies Ltd.: Team Lead (Marine Engineering & Design)
• Led40%ofdesignprojectswithcompany,which included a container, coal barge and offshore supply vessel
• Helpedacquireinternationalclients,increasingongoingprojectvalueby25%
• Redesignedqualitymanagementsystem,toreducedesigndeliverytime
Indian Register of Shipping: Assistant Surveyor
• Inspectionandcertificationofstructuraldesignsofnewvessels
• Assessmentofloadlineconditionsandissuanceofloadlinecertificates
• WorkedwithnationalandinternationalclientsonprojectsworthINR20million
Umesh Shankar Saha
English, Hindi, Malayalam
B.Tech. (Mechanical Engineering), NIT Calicut
3 years 8 months of experience in Automotive industry.
Ashok Leyland Ltd.: Deputy Manager - Product Management Group
• Responsibleforidentifyingemergingopportunitiesin the road-based mass transportation through market studies and conceptualising solutions
• Responsiblefornewproductdevelopmentprocessimplementationandtraining
Ashok Leyland Ltd.: Deputy Manager - Sales and After-sales Support
• After-salesserviceco-ordinatorforkeycustomersanddealermanagement
• Developedandimplementedasalesprocessforincreasinginstitutionalsales
• WinnerofAshokLeylandImproveAwardandBestProjectbygraduateengineer06-07
Unni V
English, Hindi
B.Tech. and M.Tech. (Computer Science), IIT Kanpur
2 years 9 months of experience in IT (Products) industry.
University of Applied Sciences Northwestern Switzerland, School of Business: Software Development Researcher
• WorkedonEUfundedcloudcomputingproject; submitted two proposals since subsequently approved
Amazon India Development Centre: Software Development Engineer
• Buildingadvertisingsolutionsforaffiliatesteam
• Building,deployingandmonitoringdistributedsystemset-upusedforservingoutthe advertisement
• Becameownerofcorefront-endcomponentinjustoveroneyearofstartingthejob
• Cameupwithabusinessideainvolvingsocialnetworkingsites,partofwhichwas implemented and launched by Amazon
Uttam Kumar Tripathi
English, Hindi
CFA, Cleared Level III, CFA Institute, USA
CA, ICAI
B.Com.,ShriVaishnavCollegeofCommerce,DeviAhilyaVishwavidyalaya,Indore
3 years 6 months of experience in Private Equity and Investment Banking industry.
Bain Capital Private Equity: Analyst
• Industry/CompanyDiligence/Modeling/Valuation
• Dealingwithadvisors
• ExecutedUSD100millioninvestmentinHimadriChemicals
• EvaluatedUSD200millioninvestmentinleadingretailcompany
• EvaluatedUSD420milliondealinIndianautoindustry
• EvaluatedUSD170millionbuyoutofIndianBPOcompanyandinvestmentincrop protection chemical company
Morgan Stanley Advantage Services Pvt. Ltd.: Associate
• Workedonprovidence/permiraUSD2billionbidforEMAPB2B
• AdvisingprivateequityfirmonbuyingstakeinPyramidSaimiraTheaters
Vaibhav Badjatya
English, Hindi, French
B.Sc. (Industrial Engineering), Georgia Institute of Technology
2 years 6 months of experience in Consulting industry.
A.T. Kearney: Senior Business Analyst
• Conductedtheduediligenceandvaluationofan acquisition target for a segment-leading US-based juice-drinks company
• Developedagrowthstrategyandlong-termbusinessplanforaleadingIndianmulti- brand apparel retailer
• Conductedaglobalcostreductionassessmentandcontractnegotiationsfora European brewery
• ForaleadingIndiantelecomoperator,developedaglobaltelecombusinessevolution roadmap and designed an enterprise-wide capex management process
Vaibhav Shah
English, Hindi
B.E.(ElectricalEngineering),VaishCollegeofEngineering,Maharshi Dayanand University
3 years 8 months of experience in Engineering industry.
Korus Engineering Solutions Pvt. Ltd.: Senior Design Engineer
• LedteamonprojectswithtotalinvestmentofINR7billionforkeyclients
• Actedasaninterfacefornegotiationsbetweenclientandvendors
• Developedcalculatorforpowerfactorimprovementthatreducederrorsand execution time by almost 60%
• Increasedteam’sproductivityby20%
• Createdinductionandtrainingmodulefornewemployees,whichincludedthe operational processes and domain knowledge
Vani Malik
English, Hindi
B.A. (Political Science), Duke University
3 years 9 months of experience in Investment Management industry.
RaymondJames&Associates,Inc.:ResearchAssociate
• Researchcommunicationssoftwaresectorcompanies and stocks
• Initiatedcoverageofaseparateindustry(e-commerce)tocreateincrementalrevenue opportunities
• Increasedclientbasebyinitiatingcoverageofover10companies
• Alsoworkedwithtelecomandsoftwareindustrygroups
• Interactedwithclientstomakestockrecommendationsthatfacilitateinformed investments
Varun Chadha
![Page 61: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/61.jpg)
120 121
English, Hindi
BS (Hons.) (Finance & Accounting) and B.A. (Hons.) (Economics), Wharton School, University of Pennsylvania
2 years 10 months of experience in Consulting industry.
African Timber & Farming Corporation, Mozambique: Managing Director and CEO
• SetupJVwithSouthAfricanpapercompany,Sappifor30,000hectaresof Eucalyptus
• ObtainedUSD2millionVCfundingfromMirabaudBank
Cha De Magoma, Mozambique: Managing Director
• ModernisedteafactoryadheringISOandfair-tradestandards
• Marketedandsold2millionkgs/yearofteatoUnilever,Starbucksetc.
Oliver Wyman: Consultant
• RestructuredPMSofamulti-nationalbankleadingto17%increaseinsales
• MappedoutgrowthrouteandentrystrategyforaUSbankenteringIndia
RaigarhJute&TextileMillsPvt.Ltd.:Director
Varun Jalan
English, Hindi, Telugu
B.E. (Hons.) (Electrical and Electronics Engineering), BITS Pilani
2 years 9 months of experience in Non-Profit & NGOs.
Dastkar Andhra: Head - Promotions
• BuiltaCRMatretailstoresformarketingcampaigns, improved sales to achieve break-even
• Preparedcontentanddeliveredstafftrainingsoncustomerservice,product knowledge and staff motivation
• Preparedco-operativeanddistrictleveldatabaseonweaversinAP
Infosys Technologies Ltd.: Software Engineer
• Introducedtoolsandmethodologiesandensuredtheiruseduringthecourseof projects
• SecuredaCGPAof4.9/5inFinacle(bankingsolution),rankedamongtoppersto lead teams
Veena Kondaveeti
English, Hindi, Marathi, Tamil
M.A. (Economics and Development), The University of Leeds
B.A. (Economics), St. Xavier’s College, University of Mumbai
3 years 1 month of experience in Financial Services industry.
Credit Analysis and Research Ltd.: Manager
• Sub-sovereign,sovereign,publicsector,infrastructureandmunicipalcreditrating
• Economicresearchandanalysis,forecasting,modeldevelopment
• Referencequantitativemodelling
• In-chargeofprestigiousGoImegaratingassignmentunderJNNURM
• Teamleaderinimportantstrategicprojects
Business Standard Ltd.: Staff Correspondent
• Featurewrite-upsonequityanalysisandresearch
• Articlesonpolicy,M&A,capitalmarkets
• Coverageofautomobile,power,industrialappliancesandinfrastructuresectors
• Partofsmartinvestorteam
Venkatesh Rangan
English, Hindi
B.A. (Hons.) (Economics), Miranda House, University of Delhi
2 years 9 months of experience in Marketing & Advertising industry.
Google India Pvt. Ltd.: AdWords Account Associate
• WorkedonGoogleAdWordclients,managedportfolio valued at USD 3 million
• WorkedonkeyfashionandapparelclientslikeTommyHilfiger,ElizabethArden, Wolverine World Wide for managing their online business
• Specialisedinsearchenginemarketing,adcontentanddisplayadvertising
• WorkedonpipingadstosocialnetworkingmediasuchasFacebook,Youtubeetc.
• RepresentationinGoogle’sglobalsalesandoperationsconference
Vibha Adlakha
English, Hindi
B.Arch., IIT Roorkee
3 years 9 months of experience in IT (Services) industry.
Wipro Technologies: Project Engineer
• Selectedfor‘PerformanceRewardProgramme’for contribution to the success of the client account and
business unit
• PartofLEANimplementationforclient,thatledtoimprovementsinutilisationof manpower
• Singlepointofcontactforprojectmodule,atclientlocationinUK
• Involvedininception,design,development,testingandsupportofbusinesscritical applications in UK and India
Vibha Naryan
English, Hindi
B.Tech. and M.Tech. (Biochemical Engineering and Biotechnology), IIT Delhi
3 years of experience in Consulting industry.
Kinapse: Consultant
• Advisedtop10pharmaceutical,biotech,consumer healthcare and specialty clients
• Preparedbusinessplan,executeddemergingstrategyandrefinedvalueproposition for a Norwegian biotech to support USD 11.9 million IPO launch on Oslo Exchange
• Developeddiversificationstrategyforaglobalpharmaceuticalinto‘RareDiseases’ segment to tap the USD 82 billion potential market
• FormulatedtheresourcemanagementmodelfortheEuro10.6billionpost-merger integration of European biotech majors
NDG Global: Analyst
Vibhuti Gupta
English, Hindi, Telugu, German
B.Tech. (Engineering Physics), IIT Bombay
3 years 5 months of experience in IT (Products) industry.
Sap Lab (India) Pvt. Ltd.: Senior Software Engineer
• Designteammemberofbusinessrulesmanagement, responsible for conceptualisation and development of
new features
• UsabilityexpertforNetWeaverBRM,focusingonenhancingtheenduserproduct experience
• Recognisedas‘HighPotential’and‘TopTalent’,awardedtolessthan1%ofthe global work force
Yasu Technologies Pvt. Ltd.: Developer - Grade 1
• DesignedtheuserinterfaceforQuickRulesAnalytics
Vikas Garikipati
English, Hindi, Gujarati
BBS, College of Business Studies, University of Delhi
3 years 5 months of experience in Consulting industry.
Ernst & Young, Global Shared Services: Research Analyst (Power sector)
• Knowledgesupporttopower(focusonrenewables) and metals sector
• PresentedwhitepapertoCIIonpowertransmission&distributionandrenewable energy
• Receivedmultiple‘EYExtraMiler’awards
RocSearchIndiaPvt.Ltd.:JuniorResearchAnalyst
• Preparedcustomisedresearchreportforclientsacrossdomains
• Teamlead(6members)forcountryreportsonminingandmetalssector
• Involvedinbusinessdevelopment-workedonpilotprojectforacquiringKPMG account
Vikas Shah
English, Hindi
BS (Mechanical Engineering), University of Illinois, Urbana-Champaign
2 years 8 months of experience in Manufacturing industry.
Beri Udyog Pvt. Ltd.: Director - Marketing
• Grewdomesticmarketby33%andinternational market by 75% in West Africa and North America
• Forgedstrategictie-upswithleadingtractormanufacturingcompanieslikeJohn Deere and Escorts, retail chains like Hariyali
• Segmentedoperationsinto3focusedbusinessunitsleadingtooperationalefficiency and enhanced market presence
Deloitte Consulting: Business Technology Analyst
• ProcurementstrategyforafirstofitskindlogisticssolutionforaForbes100 manufacturer
Vikram Beri
English, Hindi, Telugu, Tamil, Kannada
B.E.(ElectronicsandCommunications),RVCollegeofEngineering,VisvesvarayaTechnologicalUniversity
3 years 7 months of experience in High Technology/Electronics industry.
Texas Instruments (India) Pvt. Ltd.: Design Engineer
• Improvedthetest-coveragefordigitalcircuitsby20% with automation
• Receivedaninnovatorawardfordesigninganewlevel-shiftercircuitwithpatent application
• Workedonpowermanagementtechniquesandanalysisforyieldatcircuitlevel
• Presentedapaperonchallengesin45millioncircuitdesignatcompanyconference
• WorkedwithclientsincludingCiscoacrossIndia,USA,UKandFrance
Vikram Pradeepkumar Bagepalli
English, Hindi
B.E. (Electronics), Netaji Subhas Institute of Technology, University of Delhi
2 years 8 months of experience in Sales and Trading industry.
Noble Resources and Trading India Pvt. Ltd.: Associate ResearchAnalyst,VegOils
• Tradedgrains(soybeancomplex)andvegetableoilsonNationalCommodities Exchange (NCDEX) and Multi-Commodities Exchange (MCX)
• Headeddemand-sideresearchinIndiafor3commodities
• RepresentedIndiaofficeinglobalanalystmeets
Evalueserve.Com Pvt. Ltd.: Group Representative - Macros and Business Analyst
• Researchforfinancialconsultanciesforcommodities
• WhitepaperonNSEindexanalysisselectedfor‘KnowledgeOlympics’
Futures First Info Services Pvt. Ltd.: Derivatives Trader
• TradedsoftcommoditiesonLIFFEandNYBOT
• NetAUM-USD600,000;netprofit-GBP35,000
Vinayak Kaushal Thakur
English, Hindi
CFA, Cleared Level III, CFA Institute, USA
BBS, College of Business Studies, University of Delhi
2 years 11 months of experience in Financial Services industry.
Inductis (India) Pvt. Ltd.: Senior Financial Analyst
• Financialmodeling,equityresearch,industry assessment and credit research for hedge funds, private equity and commercial banking clients
• ConductedcompletebusinessreviewofaQatarbasedrealestatedeveloperforan emerging markets focused hedge fund
• Designedarigorouscounterpartycreditriskassessmentmodelforinstitutionallender in the USA
Ameriprise Financial India Pvt. Ltd.: Analyst
• DrivingpreparationoffinancialreportsandmetricsshowingAmeriprise’sfinancial results
Vishal Chadha
![Page 62: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/62.jpg)
122 123
English, Hindi, Tamil, Telugu
B.Tech. (Hons.) (Instrumentation Engineering), IIT Kharagpur
3 years 9 months of experience in Consumer Products industry.
Procter&Gamble(India):VendorManager
• ManagecapitalsourcingfromIndia(USD2million)for P&G global needs
• Identificationofnewequipmentneeds,definedtechnicalandoperationalspecifications to most qualified vendor and monitored fabrication process
• Buildvendorcapabilityinprojectmanagementandqualitycompliance
• DeliveredIndia’sfirstskincaremodularproductionplant
• Received‘SpecialAppreciationAward’fromP&GIndiaCEOatNationalMeet‘08
• SPOCforenergyutilisationimprovementsintheplant
Yamini Chandrashekhar Yavarna
English, Hindi
B.A. (Hons.), Lady Shri Ram College, University of Delhi
2 years 6 months of experience in Marketing & Advertising industry.
Euro RSCG Advertising Pvt. Ltd.: Strategic Planner
• Developedbrandcommunicationstrategyinthe FMCG, travel and telecom industries
• Studiedconsumerbehaviourandindustrytrends
• Developedcommunicationstrategywhichincreasedmarketshare(soapbrand)
• Developedproposalsforaglobalmarketingmeet
• Partofbusinessdevelopmentteam
• Liaisedwithglobalteamtofacilitateknowledgesharingamongstoffices
TBWA (India): Management Trainee (Account Management)
• Partofteamresponsiblefor4keyaccounts
• Evaluatedcreativeworktoensureeffectiveness,fitwithstrategy
Yamini Tandon
English, Hindi
Bachelor of Financial & Investment Analysis, College of Business Studies, University of Delhi
2 years 11 months of experience in Consulting industry.
McKinsey Knowledge Centre: Research Analyst
• SupportedMcKinsey’sIndiaofficeonbusinessissues that require research and analyses
• AwardedMcKinseyIndiacentreannualexcellenceawardfor‘DistinctiveClientImpact’
• Authoredtwointernalknowledgedocuments,‘LogisticsopportunityinIndia’and ‘Indian Aviation’
• Appointedleadfacultyfortrainingonmacroeconomicconceptsfornewjoinees
• Providedactivecoachingtojuniorcolleaguesandnewjoinees
Yash Kumar
English, Hindi, Marathi
M.Com. (Banking & Finance), Sydenham College of Commerce & Economics, Mumbai
BMS,JaiHindCollegeandBasantsinghInstituteofScienceandJTLalwaniCollegeofCommerce
2 years 9 months of experience in Sales & Trading and Logistics Industry.
DGRLogistiksPvt.Ltd.:VicePresident
• DGRprovidesspecialisedcomprehensivelogisticssolutionsforlargeprojects- turnover INR 125 million
• Managedthelogisticsneedsofalargegreenfieldmanufacturingunit,foralarge primary metals major
EdelweissCapital:JuniorAssociate
• Salestraderforglobalinvestmentbanks
• AccountableforgeneratingannualturnoverandannualbrokerageofINR200billion and INR 50 million respectively
• Convertedglobalhedgefundsintorevenuegeneratingclients
Yomika Ghanshyam Agarwal
English, Hindi, Gujarati
B.Tech (Civil Engineering), IIT Bombay
3 years 9 months of experience in Energy industry.
Shell Technology India Pvt. Ltd.: Senior Associate Engineer
• ConceptdevelopmentanddesignofaUSD10million port expansion project for Algeria’s national oil company
• WonIDEASgamechangercompetitionfornoveltyin‘SmartLNGTunnels’
Nigeria LNG Ltd.: Technical Assurance Engineer (On secondment)
• TechnicalassuranceforaUSD3millionsitedevelopmentwork
• Receivedspecialrecognitionawardforefficientdelivery
Hazira Port Pvt. Ltd. (HPPL): Project Civil Engineer (On secondment)
• ManagedonsiteprojectsworthUSD0.5millionclocking25,000injuryfreemanhours
• Involvedinbusinessdevelopment,representedHPPLincommercialbidnegotiations
Zubin Gokhroo
AVijayKumar 10 4 18AarasPradeepVasa 8 8 18Aarthi Rao 3 3 82AbhijeetAnantJoshi 4 3 44Abhinav Bhatia 2 9 82Abhinav Garg 3 9 82AbhinavJain 3 8 82Abhinav Kala 5 6 44Abhinav Khare 3 9 82Abhineet Bhardwaj 3 10 82Abhiram Alamuru 3 8 83Abhishek Bisht 9 6 18Abhishek Chitlangia 6 2 28Abhishek Kapilaansha Mohunta 6 9 28Abhishek Modi 3 9 83Abhishek Nag 4 9 44Abhishek Satishkumar Rathi 4 1 44Abhishek Srivastava 2 0 83Achal Gupta 4 10 44AdarshKumarJain 10 6 18Aditya Atreya 4 8 44Aditya Bakshi 4 9 45AdityaJha 2 9 83Aditya Patil 6 1 28Aditya Shailesh Shah 4 2 45Aditya Sharma 6 8 28Aditya Sohony 4 3 45Aditya Wasudeo 4 9 45Adwitia Chakraborty 6 10 28Aishwarya Singh 5 9 45AjayJain 6 0 28Akash Maheshwari 4 11 45AkilaJayaraman 3 8 83Akshat Kshetrapal 2 9 83Akshay Bawa 3 2 84Akshay Ashok Bhandarkar 7 0 29Akshay Chopra 3 6 84Akshay Satish Gupta 3 10 84Akshay Rajagopalan 2 9 84Al Ameen Sherfuddeen 4 9 46AlokJain 5 2 46Aman Gupta 7 1 29Aman Raza Khan 4 7 46Amit Dhingra 4 9 46Amit Kekare 6 6 29Amit Kumar 6 8 29Amit Ojha 3 9 84Amit Raju 6 9 29Amit Singla 3 9 84Anal Ghosh 3 9 85Anand Ananthapadmanabhan 3 10 85Anand Krishnakumar 4 2 46Anand Ramani 4 9 46AnantVeerHarlalka 2 11 85Ananya Ukil 2 7 85Anil Ananth Prabhu 5 4 47Anila Narla 3 11 85Anindita Mukherjee 3 10 85AnishJain 6 10 29AnishJain 3 9 86Anisha Krishnan 4 6 47Anjali Rajendra Datar 3 3 86Anjani Bansal 5 9 47Ankit Bharat Patel 5 2 47Ankit Gupta 4 6 47Ankit Kumar Garg 3 10 86Ankit Kumar Mehra 4 7 47Ankur Gulati 4 10 48Ankur Gupta 4 9 48Ankur Sharma 3 7 86AnmolJoneja 3 9 86Anoop Gopikumar 4 7 48
Anshul Sachdev 4 9 48Anugrah Aggarwal 3 9 86Anupama Pande 3 6 87Anuradha Agrawal 3 9 87Anurag Sambyal 5 6 48Anurag Sharma 2 9 87Anusha Pai 2 8 87Anusha Ramakrishnan 2 9 87Anveshan Chaudhary 4 9 48Anwesh Das 3 9 87Apoorva Kakkeri 4 5 49Apurva Prakash . 2 9 88Archana Ramana 2 6 88Arindam Mohanta 7 9 30Arjun Krishna Bhatt 2 11 88Arjun Hegde 11 7 18Arjun Singh 2 8 88Arnab Kumar 4 9 49Arpit Goyal 4 7 49Arpit Patni 3 8 88Arpita Ghosal 6 10 30Arun Kawatra 4 9 49Arun Panta 3 5 88Arun Sharma 10 7 18Aseem Kohli 7 6 30Ashiqul Hameed Rawther 4 8 49Ashish Gupta 3 8 89Ashutosh Pratap Singh 5 6 49Ashutosh Singh 5 2 50Ashwin Gopala Krishna Shetty 4 9 50Ashwinder Singh Sethi 3 10 89Atma Shivalanka 6 8 30Augustya Keshav Somani 4 4 50Aurelio Gutierrez Perez 3 3 89Avinash Kumar 4 9 50Avishek Chandra 4 5 50Ayush Ahuja 2 4 89Ayush Mathur 2 9 89Bart Korteweg 17 4 19Bhairav Rajnikant Shah 3 9 89Bharat Mehra 6 9 30Bharath Bevinahally Raghunath 2 9 90Bharath Bhushan Aitha 4 2 50BhargaviV 4 3 51Carlos Albert 4 3 51Chaitanya Pandey 6 5 30ChaitraliSujayJoshi 2 7 90Chandini Hundalani 4 1 51ChandraPrakashJoshi 6 8 31Chandrasekhar Samiappan 4 5 51Charulata Singal 5 5 51ChinmayJoshi 4 11 51Chirag Rakshit 4 6 52Chitra Gurnani 3 11 90Christopher Devon Garnic 4 0 52Daljeet Kaur 6 1 31Daniel Gomez Diaz-Pines 3 9 90Deepa Kelkar 5 2 52Deepa Kodur 11 0 19DeepakGopalRaoVudathala 10 11 19DeepakJ.Parayanken 2 9 90Deepak Natarajan 6 0 31Deepak Subramanian 3 3 90Deepika Seth 2 6 91Deepshikha Yadav 3 3 91Deepti Gupta 5 8 52Deepti Sen 5 9 52Dhaval Shah 4 9 52DhruvVohra 2 9 91Dipra Mukhopadhyay 4 6 53Divya Gianchandani 4 6 53Divya Singh 6 9 31
Student Name Y M Page No. Student Name Y M Page No.
![Page 63: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/63.jpg)
124 125
Divyashree 3 9 91Durga Madhab Dash 3 9 91Dyuti Barma 2 9 91Eaishvarya Sharma 4 9 53Esha Agarwal 2 9 92Farshid Aspan Cooper 3 0 92Gaurabh Gulshan 5 3 53Gaurav Arora 3 10 92Gaurav Chaturvedi 4 0 53Gaurav Ganeriwal 7 5 31Gaurav Nayyar 4 0 53Gaurav P. Sajjanhar 3 7 92Gaurav Pasricha 3 6 92Gaurav Priyadarshi 3 6 92Gaurav Sheoran 10 2 19Gaurav Shukla 11 5 19Gaurav Taragi 3 8 93Gautam Narendra Dalmia 2 6 93Gautam Sharma 2 9 93Gautham Krishnan 3 8 93Gayatri Rajagopal Tampi 3 8 93Geetesh Ahuja 3 7 93Geetika Chhabra 3 11 94Girish Malik 8 9 19Goda Chandrasekhar 8 6 20Gurpreet Singh Bedi 5 2 54Hana Al Fahoum 3 8 94HareshVazirani 2 9 94Hari Krishna Chava 3 9 94HariharanVS 2 9 94Harpreet Kaur 4 8 54Harshika Sarbajna 5 6 54Henna Mehta 3 9 94Hozefa Abbas 4 10 54Ipshita Sinha 3 9 95Ipsita Das 3 9 95JagjeetHarode 3 9 95JaideepSinghChowdhary 5 11 54JainamBharatShah 2 5 95JanakiRamakrishnan 3 3 95JapunAhluwalia 2 9 95JasdeepSinghSoni 4 9 54JayalakshmiJanakiraman 4 6 55JinceJoy 3 8 96JinuPeyeti 4 0 55JuhiDang 2 8 96JulienLevrier 3 9 96Kaja Ahmed Nawaz Mohamed Yusoof 5 9 55Kanika Pandey 5 9 55Kapila Monga 4 9 55Karan Sabharwal 4 7 55Karan Sahni 2 9 96Karan Sood 3 9 96Karn Bhugra 2 8 96Karthik Bhat 4 10 56Karthik Lakshminarayanan 4 3 56Karthik P Kishore 3 9 97KartikeyaJoshi 7 3 31Kaushik Dasgupta 4 7 56Kavita Singh 10 6 20Keisuke Matsumoto 7 0 32Khilan Haria 2 10 97Kimberly Anderson Warriah 4 6 56Komal Gurnani 4 6 56KomalJalan 3 6 97Konpal Rae 7 8 32Kota Ravi Chandra 5 10 56Krishanu Sinha 3 9 97KrishnaVenkataNagaRaoDurbha 14 8 20Kriti 2 9 97Kumar Sunny Raja 5 3 57Kunal Kapur 2 8 97
Kunal Bansal 3 9 98Kunal Garga 2 9 98Kunal Sabharwal 3 0 98Lakshmi Srikanth Koduri 4 10 57Lakshminarayan Iyer 7 11 32Laxmipat Singhi 2 11 98Lekha Ojha 4 6 57Luxsho Logan 7 0 32Madhumita N 3 0 98Madhusudanan Narayanan 5 6 57Mahesh Sridharan 4 3 57Mallika Kodali 3 5 98Manas Sharad Lodhavia 4 8 57ManasviVedhera 4 11 58Manavendra Davar 3 9 99Mandeep 5 10 58Manik Chandra 4 2 58Manika Sahni 4 6 58Manish Kumar 8 0 20Manjari 3 9 99Manjot Kaur 6 1 32Manoj Nuthakki 6 6 32Mansi Khanna 4 9 58MaulekJ.Desai 6 2 33Mayank Agarwal 2 9 99Mayank Bharat 2 10 99Mayank Rajvaidya 6 9 33Mayank Sharma 2 9 99Meenakshi Ganesh 2 10 99Megha Yethadka 3 9 100Meha Raman Grover 4 11 58Mehul Choudhary 1 0 100Mihir Deepak Bhojwani 5 7 59Mihir Shailesh Kamdar 2 3 100Mili Kapoor 2 8 100Mitalee Mulpuru 2 10 100MithilenduKumarJha 3 9 100Mohit Mittal 8 0 20Mohit Soni 4 9 59Monil Rameshchandra Ruparel 4 9 59Mrinalini Sinha 3 6 101Mrityunjay Singh 4 3 59Mudita Chauhan 3 8 101Mukta Karandikar 8 0 20MushtaqJamal 6 2 33Nadeesh Ramachandran 6 7 33Nalin Kumar Sharma 5 9 59Namit Bhandari 4 5 59Namita Pant 6 9 33Namrata Kohli 2 8 101Namrata Mehra 8 6 21NamrathaJagadish 2 10 101Narendra Kumar 6 9 33Natasha Sood 3 0 101Navdeep Gupta 3 9 101Navendu P Dogra 3 9 102Navin Kasa 4 9 60NavneetJSharma 3 2 102Navniet Sekera 11 0 21Neeharika Chenna 2 9 102Neelakash Murty 6 4 34Neeti Mishra 3 7 102Neha 2 8 102Neha 2 9 102Neha Mansukhani 6 0 34Neha Wadhawan 4 7 60Neil Ashok Taskar 6 4 34Nidhi Batra 1 9 103Nidhi Trehan 7 8 34Nihar Thanawala 6 0 34Niharika Kishore 4 6 60Nikhil Alok Goenka 3 2 103
Student Name Y M Page No. Student Name Y M Page No.
Nikhil Gupta 3 10 103Nikhil Mehta 5 9 60NikhilVerma 4 9 60Nikita Pandey 2 11 103Niloy Sadhu 5 5 60Nirajana Mishra 6 5 34Nirav Shah 1 9 103Nischinth Keshav 6 11 35Nishant Gogia 6 3 35Nishchay Chadha 3 10 103Nitesh Batra 6 9 35Niteshkumar Lalji Dudhia 8 0 21Nithin B Ramachandra 6 9 35Nithin Srinivasan 4 9 61NitinHarishJethanandani 6 8 35Nitin Mohta 3 7 104Nitin Raj 7 8 35Nitin Umanath Dubey 6 7 36Nivesh Seth 3 9 104Padmasini Renga Bashyam 5 10 61Pallavi Gupta 5 8 61Pankhuri Sakhuja 2 10 104Parikshit Deshpande 5 8 61Parshav Mathur 4 9 61Parth Awasthi 4 9 61Parthsarthi . 7 9 36ParulJindal 2 9 104Parul Srivastava 8 10 21Pawan Kumar 5 2 62Payal Bhuptani 3 9 104PearlJain 3 9 104Piyush Deepak Nahar 5 9 62Piyush Singh 3 9 105Prabhu Ramadas 3 10 105Prachee Dubey 5 0 62Pramod Menon 4 10 62Pranav Rastogi 3 1 105Prasanna Tantri Laxminarayana 5 11 62PrasannaVigneshVGanesan 5 5 62Prasanthy Gurugubelli 2 9 105Prashant Singh Sankhla 5 8 63PrashanthVenkatesh 4 9 63Prasoon Pallav 6 6 36PratibhaVaishnavi 2 9 105Preeti Kumar 2 8 105Preeti Pateria 8 3 21Prerak Bhatia 3 9 106PrernaJain 5 10 63Prerna Singh 3 9 106Pritika Idnani 4 3 63Priyanka Baxi 3 2 106Priyanka Malik 2 10 106Priyanka Mishra 2 10 106Priyanko Basu 3 11 106Puneet Gupta 9 7 21PuneetJain 5 6 63Puneet Makkad 4 8 63Rachit Rungta 5 9 64Raghav Bahl 4 7 64Raghavendra D 4 9 64Raghuram Ananthasayana 3 9 107RaghuveerVeeramachaneni 2 9 107Rahul Arora 3 4 107RahulJain 3 9 107RahulJustin 5 6 64Rahul Malik 3 2 107Rahul Prasad 3 5 107Rahul Rajappa 5 6 64Rajat Agarwal 2 9 108Rajat Sehrawat 5 3 64Rajat Sud 7 8 36Rajesh Daruka 5 9 65
Rajiv Baheti 5 7 65Rajiv Bhargava 23 3 22Rajnish Kumar 8 1 22Rakesh Krishnan 2 9 108RamachandranAV 7 11 36Ravi Agnihotri 5 6 65Ravitej Sriram 2 9 108Ridhi Kumar 2 7 108Rishabh Chopra 4 2 65Rishi Gupta 1 0 108Rishi Raj Singh 14 3 22Rishi Suri 4 0 65Ritesh Kumar Sharma 5 9 65Rohaan Kapoor 4 6 66Rohan Dayal 6 9 36Rohit Bahadur 4 9 66Roopa Datla 7 8 37Roopan Aulakh 5 9 66Roshal Dsa 4 2 66RoshanVictorJosephD’Souza 5 6 66Saad Ahmed 5 3 66Saba Bhamidipati 9 0 22Sachin Kumar Somani 4 9 67SaiPrasadVishwanathan 2 7 108Sai Swaroop Thota 4 3 67Saket Giri 4 6 67Salil Das 4 7 67SambhavJain 3 10 109Sameer Mehta 5 9 67Samhita Das Sharma 3 9 109Samyajit Das 3 9 109Sandeep Goel 5 11 67Sandeep Gupta 3 9 109Sandeep Ramakrishnappa 5 8 68Sandeep Salunkhe 3 3 109SandhyaVenkateshBoyapati 2 4 109Sandip Chaudhuri 5 9 68Sangeeth Aloysius 4 9 68Sangeetha Narasimhan 8 8 22Sanjeev A Nichani 5 1 68Sanjeev Bhalla 5 9 68Sanjeev Sharma 6 5 37Sanjit Singh Paul 4 8 68Santhosh Shankar 5 8 69Santosh Narayanan Kutty 7 3 37Santosh Narasimhan Panambur 6 9 37Santosh Reddy Nigudagi 4 7 69Santosh S Kumar 4 8 69Sarabjit Singh Dua 4 8 69Sarath Chandran 4 9 69Satish Kumar Subramani 4 10 69Satyajit Mallick 3 8 110Saumya Chandra 2 9 110SaurabhJain 2 10 110SaurabhJhamb 4 7 70Saurabh Roy 3 8 110Saurabh Sood 6 5 37SaurabhVerma 4 11 70Saurav Atri 4 9 70Sawan Sethi 4 3 70Sayak Dey 4 8 70Shailendra Hegde 3 9 110ShailendraNathJha 3 9 110Shailesh Lohia 3 10 111Shally Gupta 4 7 70Shalu Birbal Bhanwariya 3 9 111Sharon Abraham 4 2 71Shashi Ketu 5 5 71Shashvat Rai 2 2 111Shashwat Nigam 3 10 111Shaun Nicholas Lobo 3 8 111Sheetal Singh 7 9 37
Student Name Y M Page No. Student Name Y M Page No.
![Page 64: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/64.jpg)
126 127
Sheshadri Mookherjee 2 8 111Shikha Gupta 2 9 112Shikha Sharma 2 9 112Shilpa Shah 2 10 112Shivam Gupta 4 6 71Shivang D Dave 5 7 71Shivani Sharma 2 9 112Shreyans Daga 5 8 71Shruti Purohit 4 9 71Shubhadipa Sarkar 3 9 112Shubhasish Chattoraj 2 9 112Shubhra Maji 5 8 72Shuchita Pai 3 5 113Shukti Das 4 9 72Shuvashish Chatterjee 4 8 72Shyam Sunder Subramanian M 3 10 113Siddharth Rajiv Nair 5 9 72Siddharth Raman Singh 4 11 72Siddhartha Chatterji 7 11 38SiddharthaJain 2 10 113Sidhant Srivastava 2 7 113Sidharth Malhotra 3 10 113Simerjeet Singh 7 8 38Simrandeep Singh Parmar 4 8 72SindhuVKakade 4 8 73Sireesha Dandu 4 9 73SivakumarVenkataPabolu 6 5 38Smita Singla 2 9 113SmithaVijendraPurohit 5 5 73Sombit Bhattacharyya 2 9 114Somi Rai 4 11 73Sonal Dubey 3 10 114Sourabh Kukreja 6 8 38Sourav Sekhar 3 5 114Sowmya Ramakrishnan 4 9 73Sreeram Ramachandran 3 7 114Sri Krishna Chaitanya Gujjar 4 9 73SridharVishwanathan 3 7 114Srikanth Chandrasekhar 10 0 22Srikiran Srinivasa Raghavan 11 0 23Srinath Gaddam 5 5 74Srinivas Goutham Ramkumar 7 0 38Sriraman Pattabiraman 3 6 114Srishti Bakshi 2 10 115SrividyaVaranasi 3 6 115Subhadip Majumder 11 6 23Subhash Harishchandra Sumithra 4 8 74Subhashini Prasad 3 10 115Suchita Rao Ketineni 3 0 115Sudarshan Dujari 7 6 38Sudeep Laad 4 8 74Sudhir Aray 7 1 39Sudhir Sharma 5 7 74Sudip Ajit Shah 5 6 74Suhas Khullar 4 4 74Sujata Ramachandran 8 1 23Sukanya Chakraborty 3 8 115Suman Mohanty 4 9 75Sumit Khurana 10 9 23Sumit Kumar 2 6 115Sumit Maheshwari 4 9 75Sumit Sachdeva 5 8 75Sundeep Reddivari 3 6 116Suparna Dasgupta 3 11 116Supriyo Mukhopadhyay 9 8 23Suraj Kamath 6 9 39Surbhi Sachin Sawant 6 1 39SuryankaJatain 3 10 116Sushama 2 9 116Sushmita Sharma 4 8 75Swaraj Shergill 2 4 116Swathi Brahma 8 2 23
Swathi Parthasarathi 2 6 116Swetha Balasubramanian 2 7 117TanushreeJana 6 2 39Tanvi Kapoor 2 9 117Tanya Gupta 2 9 117Tara Anand 6 6 39Taru Bazaj 2 7 117Tarun Bhambra 2 4 117Thilak Ramanathan Subramanian 3 9 117Toshit Bharara 2 10 118Treasa Tomy 2 9 118TressaJoy 2 9 118Tushar Agarwal 5 8 75Tushar Bhatia 4 11 75Uday Sanganeria 5 11 76Udayan Dasgupta 3 10 118Ujjaval Gupta 3 3 118Umesh Shankar Saha 3 8 118UnniV 3 8 119Uttam Kumar Tripathi 2 9 119VaibhavArren 4 7 76VaibhavBadjatya 3 6 119VaibhavShah 2 6 119VaniMalik 3 8 119VarunChadha 3 9 119VarunHanda 4 0 76VarunJalan 2 10 120VarunRaiBansal 4 8 76VedhavalliS 4 0 76VeenaKondaveeti 2 9 120VenkataKrishnanMukundarajan 4 6 76VenkateshChannaraj 6 9 39VenkateshRangan 3 1 120VibhaAdlakha 2 9 120VibhaNaryan 3 9 120VibhutiGupta 3 0 120VijayRao 5 8 77VikasGarikipati 3 5 121VikasSaroha 4 8 77VikasShah 3 5 121VikramBeri 2 8 121VikramPradeepkumarBagepalli 3 7 121VinayHukumchand 4 2 77VinayPamnani 4 6 77VinayakKaushalThakur 2 8 121VineethGururaj 5 8 77VinodChinni 5 0 77VinodSubramanianSundaram 5 7 78VipinGupta 8 1 24VishalChadha 2 11 121VishalMotwani 5 7 78VishalSharma 5 9 78VisheshSethi 4 5 78VisweswaranGowrisankaran 5 6 78VivekanandaChowdharyKolla 13 6 24VivekSekar 4 3 78VivekShrivastava 5 5 79VivekSingh 11 0 24VivekVikramSingh 5 5 79VivekVishal 5 9 79Yamini Chandrashekhar Yavarna 3 9 122Yamini Tandon 2 6 122Yash Kumar 2 11 122Yoganand Sundararajan 6 6 40Yomika Ghanshyam Agarwal 2 9 122Yuvraj Chadha 5 8 79Zubin Gokhroo 3 9 122
Student Name Y M Page No. Student Name Y M Page No.
![Page 65: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs](https://reader035.fdocuments.in/reader035/viewer/2022062921/5f03a0d07e708231d409fd4d/html5/thumbnails/65.jpg)
128
Governing Board
Indian School of Business, Gachibowli, Hyderabad - 500 032, IndiaPh:+914023007000,23187420,Fax:+9123007030,Email:[email protected],www.isb.edu/placement
Anil Ambani*Group Chairman and CEO Reliance Anil Dhirubhai Ambani Group
Bernard Arnault Chairman and CEO, LVMH
Rahul Bajaj* Chairman, Bajaj Auto Limited
Manvinder S Banga Operating Partner Clayton, Dubilier & Rice, LLC
Scott Bayman Former President and CEO, GE India
Riley Bechtel Chairman and CEO, Bechtel Group, Inc
Lloyd C Blankfein Chairman and CEO The Goldman Sachs Group, Inc
Sally Blount Dean, Kellogg School of Management
Ronnie Chan Chairman Hang Lung Development Company
Purnendu Chatterjee* Chairman, The Chatterjee Group
Keki Dadiseth* Chairman, Omnicom India
Michael S Dell Chairman of the Board, Dell Inc
Yogesh Deveshwar* Chairman, ITC Limited
Jurgen Fitschen Member of the Group Executive Committee Deutsche Bank AG
Adi Godrej* Chairman, The Godrej Group
Prabhu Goel Founder and Chairman, Signet Solar Inc
Rajat Gupta* Chairman, ISB; Senior Partner Emeritus McKinsey & Company, Inc
Vinita Gupta Founder, Quick Eagle Network
Vinod Gupta Founder and CEO, infoGROUP, Inc
Urs Hofmann Managing Director, Credit Suisse Group
Donald Jacobs Dean Emeritus Kellogg School of Management
Dipak Jain Former Dean, Kellogg School of Management
Uday Khemka Director, SUN Group of Companies
Vinod Khosla General Partner Kleiner Perkins Caufield & Byers
Chanda Kochhar* CEO, ICICI Bank Ltd
Bon-Moo Koo Chairman LG Chemical Ltd. / LG Electronics Inc.
Uday Kotak* Executive Vice Chairman and Managing Director Kotak Mahindra Bank Limited
Andrew Likierman Dean, London Business School
Arjun Malhotra Chairman and CEO, Headstrong Corporation
Harish Manwani* President, Asia & Africa Unilever Plc; Chairman, Hindustan Unilever Limited
Kiran Mazumdar Shaw* Chairman and Managing Director Biocon India Limited
Aman Mehta Former Chief Executive Officer, HSBC Limited
Heinz-Werner Meier Chairman of Management Board and Senior Vice President Sanofi - Aventis Deutschland GmbH
Victor Menezes Former Senior Vice Chairman, Citigroup
Lakshmi Mittal* President and CEO, ArcelorMittal
Rakesh Bharti Mittal* Vice Chairman, Bharti Enterprises
Sunil Bharti Mittal* Chairman and Managing Director Bharti Enterprises
Yoshihiko Miyauchi Chairman and CEO, Orix Corporation
Mark Moody-Stuart Director, HSBC Holdings Plc
James Murdoch Non-Executive Director and Chairman British Sky Broadcasting
Pawan Munjal* Managing Director and CEO Hero Honda Motors Limited
Sunil Kant Munjal* Managing Director Hero Corporate Services Limited
Shiv Nadar* Founder, HCL Technologies Limited
N R Narayana Murthy* Chief Mentor, Infosys Technologies Limited
Lakshmi Narayanan* Vice Chairman, Cognizant
Sanjay Nayar* CEO, KKR India
Vikram S Pandit Chief Executive Officer, Citigroup Inc
Deepak Parekh* Chairman, HDFC
Rajendra Pawar* Chairman, NIIT Limited
Teh Kok Peng President, GIC Special Investments Pte Limited
G V Prasad* Vice Chairman and Chief Executive Officer Dr Reddy’s Laboratories Ltd
N Prasad* Group Chairman, VANPIC
Atul Punj* Chairman, Punj Lloyd Limited
Srini Raju* Managing Director and Co-Founder Peepul Capital
Ajit Rangnekar Dean, Indian School of Business
Girish Reddy* Founder, Prisma Capital Partners LP
Syam Prasad Reddy* Chairman and Managing Director Indu Projects Ltd
Thomas Robertson Dean, The Wharton School
Arun Sarin Former Chief Executive Vodafone Group Plc
James Schiro Chief Executive Officer Zurich Financial Services
Ajay Shah Founder and CEO, Shah Capital Partners
Analjit Singh* Chairman and Managing Director Max India Limited
K P Singh* Chairman of the Board, DLF Limited
Pramath Raj Sinha* Founding Dean, Indian School of Business; Founder and Managing Director 9.9 Mediaworx Pvt Ltd
Charles Miller Smith Chairman of the Board, Scottish Power Plc
Martin Sorrell Chief Executive Officer, WPP Group Plc
Mallika Srinivasan* Vice Chairman Tractor and Farm Equipment Limited
Sanjay Subhedar General Partner, Storm Ventures
Rana Talwar Chairman, Sabre Capital Worldwide
Daniel Vasella Chairman of the Board Novartis International AG
Romesh Wadhwani CEO and Managing Partner Symphony Technology Group
Jacob Wallenberg Deputy Chairman Skandinaviska Enskilda Banken
Arshad Zakaria President and CEO New Vernon Capital LLC
Peter Zencke Executive Board Member, SAP AG
*Also member of the Executive Board