pBook 6

47
“It’s not the Destination. It’s the Adventure along the way” A Process Book of Design Ben Hart Visual Communication | School of Art & Art History | Fall Semester 2011

description

process book 6

Transcript of pBook 6

Page 1: pBook 6

“It’s not the Destination.It’s the Adventure along the way” A Process Book of Design

Ben Hart

Visual Communication | School of Art & Art History | Fall Semester 2011

Page 2: pBook 6
Page 3: pBook 6

Visual Communication | School of Art & Art History | Fall Semester 2011

“It’s not the Destination.It’s the Adventure along the way” A Process Book of Design

Ben Hart

Page 4: pBook 6

Introduction: (General Synopsis of Your Design Work this Semester)

I was always a very visual kid. The day I discovered the world

digital video editing in the 6th grade, I fell in love with the

ability to manipulate and create using technology. Spending

more time on the dvd cover art and opening credits sequence

than the body of the film led me to the conclusion that

creating videos has nothing to do with my interests. Through

this, I discovered Design.

Sub conciously everyone knows more goes into design than

what your eyes see and brain comprehends. Design is the art

of communicating.

I was always a very visual kid. The day I discovered the world

digital video editing in the 6th grade, I fell in love with the

ability to manipulate and create using technology. Spending

more time on the dvd cover art and opening credits sequence

than the body of the film led me to the conclusion that

creating videos has nothing to do with my interests. Through

this, I discovered Design.

Sub conciously everyone knows more goes into design than

what your eyes see and brain comprehends. Design is the art

of communicating.

I was always a very visual kid. The day I discovered the world

digital video editing in the 6th grade, I fell in love with the

ability to manipulate and create using technology. Spending

more time on the dvd cover art and opening credits sequence

than the body of the film led me to the conclusion that

creating videos has nothing to do with my interests. Through

this, I discovered Design.

Sub conciously everyone knows more goes into design than

what your eyes see and brain comprehends. Design is the art

of communicating.

I was always a very visual kid. The day I discovered the world

digital video editing in the 6th grade, I fell in love with the

ability to manipulate and create using technology. Spending

more time on the dvd cover art and opening credits sequence

than the body of the film led me to the conclusion that

creating videos has nothing to do with my interests. Through

this, I discovered Design.

Sub conciously everyone knows more goes into design than

what your eyes see and brain comprehends. Design is the art

of communicating.

I was always a very visual kid. The day I discovered the world

digital video editing in the 6th grade, I fell in love with the

ability to manipulate and create using technology. Spending

more time on the dvd cover art and opening credits sequence

than the body of the film led me to the conclusion that

creating videos has nothing to do with my interests. Through

this, I discovered Design.

Sub conciously everyone knows more goes into design than

what your eyes see and brain comprehends. Design is the art

of communicating.

Page 5: pBook 6

ART 2633Visual Communications 1

Line Studies

Color

Photography

Grid Series

Curve Lines

Shape Studies

Word Communication

Page 6: pBook 6

Line Interval:Concept Development (5x5)

In this project you will be interpreting sound visually. As you

develop your ideas it will be helpful to consider the components

of sound such as tempo, volume, duration, context, etc and

translate them into visual equivalents.

As you develop your ideas it will be helpful to consider the

components of sound such as tempo, volume, duration,

context, etc and translate them into visual equivalents.

Remember that the simpler compositions are generally the

most successful. In this project you will be interpreting sound

visually.

Top: 1a, 1b, 1c

Bottom: 2, 3, 4, 5

Page 7: pBook 6

Line Studies

Color

Photography

Grid Series

Curve Lines

Shape Studies

Word Communication

1

2

3

4

5

6

7

Project: Line Interval Studies5x5 Studies (8)

The Line Interval Studies is a series of vertical line layouts that demonstrate result the behavior among

different weighted lines and thier proximity to one another. We were instructed to not use a measuring

device and to manipulate the space completly based on the way it appears optically. After a few

critiques the reasoning behind not using a ruler to measure became more apparent. The is about the

communication of the visual interaction between the four white lines and five black lines, and counting

milimeters only created less of an understanding.

V1

Page 8: pBook 6
Page 9: pBook 6

Line Studies

Color

Photography

Grid Series

Curve Lines

Shape Studies

Word Communication

Project: Color Exploration10x10 Studies (7)

Color Exploration was the next step of our learning process. Seamlessly we advanced into the project

with help from our Line Interval Studies. Our random line studies were perfected and enlarged to the

14x17 mounted 10x10 format that would be used from this point on. The first set is the Value study

created soley with shades of grey. The two compositions were to contrast each other, one dark dominant

and the other light dominant. Second is the Monochromatic Study and Third is the Complementary Color

Study. Each of the two color sets are made up of two cntrasting dark/light compositions that match up to

the corresponding Value study.

1

2

3

4

5

6

7

V2

Page 10: pBook 6

Random Line StudyFinal 10x10 Composition

Type Me- don’t leave widows in your text.

Page 11: pBook 6

ValueContrasting Studies

Type Me- don’t leave widows in your text.

Page 12: pBook 6

MonochromaticContrasting Studies

Type Me- don’t leave widows in your text.

Page 13: pBook 6

ComplementaryContrasting Studies

Type Me- don’t leave widows in your text.

Page 14: pBook 6
Page 15: pBook 6

Line Studies

Color

Photography

Grid Series

Curve Lines

Shape Studies

Word Communication

Project: Photography Compositions8x8 Composition (2)

The first week of class the assignment was given to go out in and take pictures of line in nature and

the built enviroment. Looking through the cropped frame of a viewfinder focuses the eye on specific

variables of lines. Elements such as scale, number, weight, direction and color, as well as the context

of the line were among the things to be taken into consideration. The project was broken down into two

parts, both aimed at developing an awareness of visual elements as language. The second part of the

project was to make a quardrant composition with four images, and a composition that sits on a 16 quare

grid. As well as the adition of the grid, the compositions to also have a theme. The theme I chose was

simply light and the way light interacts with line, whether it is a backlit silloute or the light in and of itself.

The guidelines of part two forces the focus to be on the movement of line and the relationship between

the aranged images.

1

2

3

4

5

6

7

V3

Page 16: pBook 6

Grid Process Docs

Page 17: pBook 6

Line Studies

Color

Photography

Grid Series

Curve Lines

Shape Studies

Word Communication

Project: Gird Series10x10 Composition (3)

The Grid series is the three step progression demonstrating our chosen visual operation communicated

exponentially. To communicate this with our 10x10 square we have countless options when it comes to

exhausting tool options (xacto, black paper, markers etc), but whatever we do we must always “use the

grid”. The goal of the initial first Grid is to answer the question, what is the visual operation? Once this is

achieved we are to also ask a question. The progression from the first grid to the second and third expand

on this concept while taking it a step farther each time, but while still remaining cohesive to Grid 1.

1

2

3

4

5

6

7

V4

Page 18: pBook 6

1

2

Page 19: pBook 6

3

Page 20: pBook 6

Curve Process Docs

Page 21: pBook 6

Line Studies

Color

Photography

Grid Series

Curve Lines

Shape Studies

Word Communication

Project: Curve Lines10x10 Composition (2)

This project involved studying the way lines curve, bend, and pivot. The study was a progression that

began with a simple bend first, and a bend that doubles back the other direction second. The third line

study began to manipulate the space in a more controlled manner with a greater number of sharper

curves. With the fourth and last curve we were to not only manipulate the surrounding space but also

to use the idea of figure/ground relationships to create illusion of a shape. After creating the initial

four curves they get aranged in a 10x10 sqaure. Within the arrangment of lines no seperating distance

along the top and bottom can be the same. Along with a simple line arrangement we also completed

a compsition using three fills. The two inside negative areas created shapes that must contrast in

dominance.

1

2

3

4

5

6

7

V5

Page 22: pBook 6
Page 23: pBook 6
Page 24: pBook 6

(Process Docs)

Page 25: pBook 6

Line Studies

Color

Photography

Grid Series

Curve Lines

Shape Studies

Word Communication

Project: Shape StudiesProgressing Studies (3)

The Shape Studies were very similar to the curved line compositions. However, unlike curves, the

finished curves were communicated soley with the use of fills. The first shape communication is

fold. The design came from the actual folding of a 2x11 strip ob black construction paper. Second

communicates as a simple unbiased flat shape, but while still having three changes in direction. Shape

number three is a complex ambiguous shape. It commuicates detailed form, while still coming across as

a random figure ground shape with no top or bottom.

1

2

3

4

5

6

7

V6

Page 26: pBook 6
Page 27: pBook 6

(Process Docs)

Page 28: pBook 6

Group 1Word Communication

Group 2Word Communication

Page 29: pBook 6

Line Studies

Color

Photography

Grid Series

Curve Lines

Shape Studies

Word Communication

Project: Word Communication8x8 Composition (20)

The Word Communication project expands a single word and communicating it visually through form,

pacement and color. This project was broken in to three groups of words, and seasons for the fourth. The

first group must only be communicated with black one inch squares. The second is the same, but with

the freedom applying color to each square. Both groups three and four allow the same freedom of color,

but with the addition of simple illustrations replacing the one inch cubes. This assignment questions the

reasoning of our decisions. What this does is it ensures that when we design, we are using what we

have learned this semester to create both smart and succesful design.

1

2

3

4

5

6

7

V7

Page 30: pBook 6

Group 3Word Communication

Page 31: pBook 6

Group 4Word Communication

Page 32: pBook 6

Introduction: (General Synopsis of Your Design Work this Semester)

I was always a very visual kid. The day I discovered the world

digital video editing in the 6th grade, I fell in love with the

ability to manipulate and create using technology. Spending

more time on the dvd cover art and opening credits sequence

than the body of the film led me to the conclusion that

creating videos has nothing to do with my interests. Through

this, I discovered Design.

Sub conciously everyone knows more goes into design than

what your eyes see and brain comprehends. Design is the art

of communicating.

I was always a very visual kid. The day I discovered the world

digital video editing in the 6th grade, I fell in love with the

ability to manipulate and create using technology. Spending

more time on the dvd cover art and opening credits sequence

than the body of the film led me to the conclusion that

creating videos has nothing to do with my interests. Through

this, I discovered Design.

Sub conciously everyone knows more goes into design than

what your eyes see and brain comprehends. Design is the art

of communicating.

I was always a very visual kid. The day I discovered the world

digital video editing in the 6th grade, I fell in love with the

ability to manipulate and create using technology. Spending

more time on the dvd cover art and opening credits sequence

than the body of the film led me to the conclusion that

creating videos has nothing to do with my interests. Through

this, I discovered Design.

Sub conciously everyone knows more goes into design than

what your eyes see and brain comprehends. Design is the art

of communicating.

I was always a very visual kid. The day I discovered the world

digital video editing in the 6th grade, I fell in love with the

ability to manipulate and create using technology. Spending

more time on the dvd cover art and opening credits sequence

than the body of the film led me to the conclusion that

creating videos has nothing to do with my interests. Through

this, I discovered Design.

Sub conciously everyone knows more goes into design than

what your eyes see and brain comprehends. Design is the art

of communicating.

I was always a very visual kid. The day I discovered the world

digital video editing in the 6th grade, I fell in love with the

ability to manipulate and create using technology. Spending

more time on the dvd cover art and opening credits sequence

than the body of the film led me to the conclusion that

creating videos has nothing to do with my interests. Through

this, I discovered Design.

Sub conciously everyone knows more goes into design than

what your eyes see and brain comprehends. Design is the art

of communicating.

Page 33: pBook 6

ART 2643Design Technology

Self Portrait

Instructional Diagram

Calendar

Process Book

Page 34: pBook 6
Page 35: pBook 6

Typographic Self-Portrait

Instructional Diagram

Visual Poetry Calendar

Project: Typographic Self-Portrait11x17 - Adobe Illustrator

The typographic self-portrait is an image of ourselves created completly with text. Type may be used

to create lines, fill areas, and any other way seen fit as long as the type is not distorted in any way. One

emphasis of this project was to use individual letters as form. The idea was to use letterforms as shape,

and thus renforcing the use of the elements of design being practiced in Visual Communications 1.

1

2

3

D1

Page 36: pBook 6
Page 37: pBook 6

Rap Count

ryRockDubstepWOMP

Chacos. Ultimate Disc. Sun.

“I re

ad s

omew

here

... h

ow im

port

ant i

t is i

n lif

e not necessarily

to b

e stro

ng... but to

feel

The

core

of m

ans'

spiri

t comes fro

m

new experiences.

Everyone needs a change in p a c e S o m e t i m e s

No

res

t for the wicked

Swim

Ultim

ate

Fris

bee

Run

Bike

Camp

Hike

SailClimb

If I wanted to

paddle down the river, w

here's the

best place to launch o

ut of?

“Tw

enty

years

fro

m n

ow

you w

ill b

e m

ore

dis

apo

inte

d b

y t

he t

hin

gs

you d

idn’t

do

than b

y t

he o

nes

you d

id.”

- M

ark

Tw

ain

you

're staring

at the

sun you're standing in the sea your mouth is open wide yo

u're trying

hard

to breath

e th

e water's at y o

ur n

ec k

T h i s is a song T h i s

is a song T h i s

for those who is a song

for those who is a song

lost their hope a for those who lost their hope a for those who

long a long time agolost their hope a long a long time agolost their hope a

I know someday that you long a long time agoI know someday that you long a long time ago

will find it somehow I know someday that you will find it somehow I know someday that you

Because you're not too oldwill find it somehow Because you're not too oldwill find it somehow

to accomplish goals and all the Because you're not too oldto accomplish goals and all the Because you're not too old

answers are within your soul its up to to accomplish goals and all the answers are within your soul its up to to accomplish goals and all the

you, you gotta figure it out Uh huhanswers are within your soul its up to you, you gotta figure it out Uh huhanswers are within your soul its up to

Whether you want love or money Good you, you gotta figure it out Uh huhWhether you want love or money Good you, you gotta figure it out Uh huh

fortune or fame You want a brand new card Whether you want love or money Good fortune or fame You want a brand new card Whether you want love or money Good

You want the world to change You better take fortune or fame You want a brand new card You want the world to change You better take fortune or fame You want a brand new card

some action right now, oh yes Because there's You want the world to change You better take some action right now, oh yes Because there's You want the world to change You better take

nothing in the world that you can't get So don't fill some action right now, oh yes Because there's nothing in the world that you can't get So don't fill some action right now, oh yes Because there's

your life with confusion and regret You better take nothing in the world that you can't get So don't fill your life with confusion and regret You better take nothing in the world that you can't get So don't fill

some chances right nowyour life with confusion and regret You better take some chances right nowyour life with confusion and regret You better take

Well you can gain the world but for the price of your soul some chances right nowWell you can gain the world but for the price of your soul some chances right now

yes I know, well I know, yes I know you can gain the world for Well you can gain the world but for the price of your soul yes I know, well I know, yes I know you can gain the world for Well you can gain the world but for the price of your soul the price of your soul but I hope you take the road less traveled yes I know, well I know, yes I know you can gain the world for the price of your soul but I hope you take the road less traveled yes I know, well I know, yes I know you can gain the world for and I hope you find the courage to grow well I hope you find the the price of your soul but I hope you take the road less traveled and I hope you find the courage to grow well I hope you find the the price of your soul but I hope you take the road less traveled courage to grow and I hope you find the courage to grow well I hope you find the courage to grow and I hope you find the courage to grow well I hope you find the

So now you're 45 and you realize just what you

b

So now you're 45 and you realize just what you

b

and I hope you find the courage to grow well I hope you find the So now you're 45 and you realize just what you

and I hope you find the courage to grow well I hope you find the wanna do with your life just took some time for you to figure it courage to grow wanna do with your life just took some time for you to figure it courage to grow So now you're 45 and you realize just what you wanna do with your life just took some time for you to figure it

So now you're 45 and you realize just what you

out Cause everyone one of us Has a purpose here Sometimes its wanna do with your life just took some time for you to figure it out Cause everyone one of us Has a purpose here Sometimes its wanna do with your life just took some time for you to figure it

hidden underneath your fear Just takes some time for the truth to

t

hidden underneath your fear Just takes some time for the truth to

t

out Cause everyone one of us Has a purpose here Sometimes its hidden underneath your fear Just takes some time for the truth to out Cause everyone one of us Has a purpose here Sometimes its

come out So whether you want love or money Good fortune or fame hidden underneath your fear Just takes some time for the truth to come out So whether you want love or money Good fortune or fame hidden underneath your fear Just takes some time for the truth to

You want a brand new card You want the world to change You better come out So whether you want love or money Good fortune or fame You want a brand new card You want the world to change You better come out So whether you want love or money Good fortune or fame

take some action right now, oh yes Because there's nothing in the

l

take some action right now, oh yes Because there's nothing in the

l

You want a brand new card You want the world to change You better take some action right now, oh yes Because there's nothing in the You want a brand new card You want the world to change You better

world that you can't get So don't fill your life with confusion and regret take some action right now, oh yes Because there's nothing in the world that you can't get So don't fill your life with confusion and regret take some action right now, oh yes Because there's nothing in the

You better take some chances right nowworld that you can't get So don't fill your life with confusion and regret You better take some chances right nowworld that you can't get So don't fill your life with confusion and regret

Well you can gain the world but for the price of your soul yes I know, well I know, You better take some chances right now

Well you can gain the world but for the price of your soul yes I know, well I know, You better take some chances right now

yes I know you can gain the Well you can gain the world but for the price of your soul yes I know, well I know,

yes I know you can gain the Well you can gain the world but for the price of your soul yes I know, well I know,

world for the price of your soul but I Well you can gain the world but for the price of your soul yes I know, well I know,

world for the price of your soul but I Well you can gain the world but for the price of your soul yes I know, well I know,

hope you take the yes I know you can gain the

hope you take the yes I know you can gain the

road less traveled and I hope you

c

road less traveled and I hope you

c

croad less traveled and I hope you chroad less traveled and I hope you hworld for the price of your soul but I

road less traveled and I hope you world for the price of your soul but I

find the hope you take the

find the hope you take the

courage to grow well I road less traveled and I hope you

courage to grow well I road less traveled and I hope you

hope you find the

hope you find the

find the courage to courage to grow well I

find the courage to courage to grow well I

grow find the courage to

grow find the courage to

courage to find the courage to

courage to find the courage to

grow courage to grow find the courage to

grow find the courage to

courage to find the courage to

grow find the courage to

growcourage to growcourage to -Rebelution

grow-Rebelution

grow

Columbia

W e a r

w h a t

makes you

feel like you.

Comfort and Style.

Jean Fridays. Rep your

team. Music Tees. What�s an

tteam. Music Tees. What�s an

tIron. Outlet. SEVENTY DEGREES

FARENHEIT. t FARENHEIT. t Wear what makes you feel

tmakes you feel

tlike you. Comfort

hlike you. Comfort

hand Style. Jean

Fridays. Rep your team. Music Tees.

What�s an Iron. Outlet. SEVENTY

D E G R E E S n D E G R E E S nF A R E N H E I T . W e a r

what makes y what makes y y o u feel like you. y feel like you. y

Comfort and S t y l e . Jean Fridays. Rep y o u r

team. Music Tees. What�s an Iron. ' What�s an Iron. ' team. Music Tees. What�s an Iron.

team. Music Tees.

Outlet. SEVENTY DEGREES FARENHEIT. Wear w h a t

makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.

SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s

an Iron. Outlet. SEVENTY DEGREES FARENHEIT. W e a r Music Tees. What�s

W e a r Music Tees. What�s

what makes you feel like an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

what makes you feel like an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

y o u . W e a r

y o u . W e a r

Comfort and Style. Jean what makes you feel like

Comfort and Style. Jean what makes you feel like

Fridays. Rep y o u .

Fridays. Rep y o u .

your team. Music Tees. What�s Comfort and Style. Jean

your team. Music Tees. What�s Comfort and Style. Jean

an Iron. Outlet. Fridays. Rep

an Iron. Outlet. Fridays. Rep

SEVENTY DEGREES FARENHEIT. your team. Music Tees. What�s

SEVENTY DEGREES FARENHEIT. your team. Music Tees. What�s

Wear what Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes hWear what makes hmakes you feel like you. Comfort and Style. Jean Wear what makes makes you feel like you. Comfort and Style. Jean hmakes you feel like you. Comfort and Style. Jean hWear what makes hmakes you feel like you. Comfort and Style. Jean h

you feel like you. Comfort and Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. you feel like you. Comfort and Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Style. Jean Fridays. Rep tStyle. Jean Fridays. Rep tWear what makes Style. Jean Fridays. Rep Wear what makes tWear what makes tStyle. Jean Fridays. Rep tWear what makes t

your team. Music Tees. What�s an you feel like you. Comfort and your team. Music Tees. What�s an you feel like you. Comfort and Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. you feel like you. Comfort and Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

your team. Music Tees. What�s an Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. you feel like you. Comfort and Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

Iron. Outlet. SEVENTY

t

Iron. Outlet. SEVENTY

tStyle. Jean Fridays. Rep Iron. Outlet. SEVENTY Style. Jean Fridays. Rep tStyle. Jean Fridays. Rep t

Iron. Outlet. SEVENTY

tStyle. Jean Fridays. Rep t

DEGREES FARENHEIT. your team. Music Tees. What�s an DEGREES FARENHEIT. your team. Music Tees. What�s an Wear what makes you feel

your team. Music Tees. What�s an Wear what makes you feel

your team. Music Tees. What�s an like you. Comfort and Style. Jean Fridays.

Iron. Outlet. SEVENTY like you. Comfort and Style. Jean Fridays.

Iron. Outlet. SEVENTY Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES

DEGREES FARENHEIT. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES

DEGREES FARENHEIT. Wear what makes you feel Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES

Wear what makes you feel FARENHEIT.

like you. Comfort and Style. Jean Fridays. FARENHEIT.

like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. bWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. bMusic Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. bWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. btWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. t

Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. bMusic Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. bWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. bMusic Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. b

SEVENTY DEGREES FARENHEIT. hSEVENTY DEGREES FARENHEIT. hWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.

Wear what Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.

Wear what Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.

makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes h makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes hemakes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes eSEVENTY DEGREES FARENHEIT.

makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes SEVENTY DEGREES FARENHEIT. hSEVENTY DEGREES FARENHEIT. h makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes hSEVENTY DEGREES FARENHEIT. h Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what

makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes Wear what

you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you e you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you emakes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you

makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. sfeel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. syou feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Is you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iseyou feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iefeel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Ifeel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. ron. Outlefeel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. ron. Outlefeel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t. SEVENTY DEGREES ht. SEVENTY DEGREES h

feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t. SEVENTY DEGREES feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes t. SEVENTY DEGREES Wear what makes FARENHEIT. e FARENHEIT. eaFARENHEIT. a

you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an IFARENHEIT. you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an IWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY hWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY hWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY

you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an IWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY

you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. OutleWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY

ron. Outlet. SEVENTY DEGREES Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY

t. SEVENTY DEGREES ht. SEVENTY DEGREES hWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY ht. SEVENTY DEGREES hDEGREES a DEGREES aFARENHEIT. DEGREES

FARENHEIT. FARENHE

FARENHEIT. FARENHE

FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY FARENHE

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY IT.

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an I

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an I

Wear what makes you feel like you. Comfort and Style. Jean Fridays. you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an I

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outle

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY ron. Outle

Wear what makes you feel like you. Comfort and Style. Jean Fridays. ron. Outle

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY ron. Outlet. SEVENTY DEGREES

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY t. SEVENTY DEGREES

Wear what makes you feel like you. Comfort and Style. Jean Fridays. t. SEVENTY DEGREES

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY t. SEVENTY DEGREES

Rep your team. Music Tees. yRep your team. Music Tees. yFARENHEIT.

Rep your team. Music Tees. FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY

Rep your team. Music Tees. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY

DEGREES Rep your team. Music Tees. DEGREES FARENHEIT.

DEGREES FARENHEIT.

Rep your team. Music Tees. FARENHEIT.

DEGREES FARENHEIT.

FARENHERep your team. Music Tees. FARENHEFARENHEIT.

FARENHEFARENHEIT.

Rep your team. Music Tees. FARENHEIT.

FARENHEFARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY

FARENHEWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY

Rep your team. Music Tees. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY

FARENHEWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY

IT. Rep your team. Music Tees. IT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY

IT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY

Rep your team. Music Tees. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY

IT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY

Rep your team. Music Tees. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY

WhaWear what makes you feel like you. Comfort and Style. Jean Fridays. WhaWear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wha

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. WhaWear what makes you feel like you. Comfort and Style. Jean Fridays. WhaWear what makes you feel like you. Comfort and Style. Jean Fridays. t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. WhaWear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wha

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wha

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your oWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your oRep your team. Music Tees.

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your Rep your team. Music Tees. Wha

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wha

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wha

team. Music Tees.t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

team. Music Tees.t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

What�s an Iron. Outlet. SEVENTY DEGREES t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

What�s an Iron. Outlet. SEVENTY DEGREES t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your

FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Wear what makes

What�s an Iron. Outlet. SEVENTY DEGREES Wear what makes

What�s an Iron. Outlet. SEVENTY DEGREES an Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes an Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.

you feel likFARENHEIT.

you feel likFARENHEIT. Wear what makes y

you feel likWear what makes you feel like you. Comfort and Style. Je

you feel likou feel like you. Comfort and Style. Je

What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.you feel likWhat�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.e you. Comfort and Style. Jean Fridays. Rep your team. Music ou feel like you. Comfort and Style. Je

e you. Comfort and Style. Jean Fridays. Rep your team. Music ou feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.

e you. Comfort and Style. Jean Fridays. Rep your team. Music an Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.

What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.e you. Comfort and Style. Jean Fridays. Rep your team. Music What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your teame you. Comfort and Style. Jean Fridays. Rep your team. Music Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. e you. Comfort and Style. Jean Fridays. Rep your team. Music . Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes e you. Comfort and Style. Jean Fridays. Rep your team. Music Wear what makes an Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes an Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.

e you. Comfort and Style. Jean Fridays. Rep your team. Music an Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes an Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.

Tees. What�s an Iron. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.

Tees. What�s an Iron. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.you feel likTees. What�s an Iron. you feel likWhat�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.you feel likWhat�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.

Tees. What�s an Iron. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.you feel likWhat�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.e you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. e you. Comfort and Style. Jean Fridays. Rep your team. Music What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.e you. Comfort and Style. Jean Fridays. Rep your team. Music What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.

Tees. What�s an Iron. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.e you. Comfort and Style. Jean Fridays. Rep your team. Music What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.

Outlet. SEVENTe you. Comfort and Style. Jean Fridays. Rep your team. Music Outlet. SEVENTe you. Comfort and Style. Jean Fridays. Rep your team. Music What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.e you. Comfort and Style. Jean Fridays. Rep your team. Music What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.

Outlet. SEVENTWhat�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.e you. Comfort and Style. Jean Fridays. Rep your team. Music What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your teame you. Comfort and Style. Jean Fridays. Rep your team. Music Jean Fridays. Rep your team

Outlet. SEVENT Jean Fridays. Rep your teame you. Comfort and Style. Jean Fridays. Rep your team. Music Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. e you. Comfort and Style. Jean Fridays. Rep your team. Music . Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

Outlet. SEVENT. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. e you. Comfort and Style. Jean Fridays. Rep your team. Music . Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

Y DEGREES FARENHEIT. Wear e you. Comfort and Style. Jean Fridays. Rep your team. Music Y DEGREES FARENHEIT. Wear e you. Comfort and Style. Jean Fridays. Rep your team. Music . Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. e you. Comfort and Style. Jean Fridays. Rep your team. Music . Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

Y DEGREES FARENHEIT. Wear . Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. e you. Comfort and Style. Jean Fridays. Rep your team. Music . Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes e you. Comfort and Style. Jean Fridays. Rep your team. Music Wear what makes

Y DEGREES FARENHEIT. Wear Wear what makes e you. Comfort and Style. Jean Fridays. Rep your team. Music Wear what makes

what e you. Comfort and Style. Jean Fridays. Rep your team. Music what e you. Comfort and Style. Jean Fridays. Rep your team. Music Wear what makes e you. Comfort and Style. Jean Fridays. Rep your team. Music Wear what makes what

Wear what makes e you. Comfort and Style. Jean Fridays. Rep your team. Music Wear what makes makes youTees. What�s an Iron. makes youTees. What�s an Iron. you feel likTees. What�s an Iron. you feel likmakes you

you feel likTees. What�s an Iron. you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. e you. Comfort and Style. Jean Fridays. Rep your team. Music makes you

e you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. e you. Comfort and Style. Jean Fridays. Rep your team. Music feel like you. Comfor

e you. Comfort and Style. Jean Fridays. Rep your team. Music feel like you. Comfor

e you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. feel like you. ComforTees. What�s an Iron. e you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. e you. Comfort and Style. Jean Fridays. Rep your team. Music feel like you. Comfor

e you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. e you. Comfort and Style. Jean Fridays. Rep your team. Music Outlet. SEVENT feel like you. ComforOutlet. SEVENTe you. Comfort and Style. Jean Fridays. Rep your team. Music Outlet. SEVENTe you. Comfort and Style. Jean Fridays. Rep your team. Music feel like you. Comfor

e you. Comfort and Style. Jean Fridays. Rep your team. Music Outlet. SEVENTe you. Comfort and Style. Jean Fridays. Rep your team. Music t and Style. Jean Fridays. Rep your team. Music Tees. Outlet. SEVENTt and Style. Jean Fridays. Rep your team. Music Tees. Outlet. SEVENTY DEGREES FARENHEIT. Wear t and Style. Jean Fridays. Rep your team. Music Tees. Y DEGREES FARENHEIT. Wear what t and Style. Jean Fridays. Rep your team. Music Tees. what

What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. makes youWhat�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. makes you feel like you. ComforWhat�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you.

Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES

d

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES

dFARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t Wear what makes you feel like you. dWear what makes you feel like you. d

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES Wear what makes you feel like you.

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES

Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. thComfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h

FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

Wear what makes you feel like you. Wear

what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h Wear what makes you feel Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear Wear what makes you feel Wear

like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. h like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. h like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. h what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes you feel What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. i What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. i like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes you feel

What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes you feel

Wear what makes you feel like like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.

Wear what makes you feel like like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.

you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES i you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES is you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES sWhat�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES

What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. i What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. i you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES i What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. i Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES

Wear what makes you feel like FARENHEIT. s FARENHEIT. s you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES Wear what you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES

makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music FARENHEIT. makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Wear what Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. o Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. o makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

Wear what makes you feel like you. Wear what

Wear what makes you feel like you. Wear what

Wear what makes you feel like you.

makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. p makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. p Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron.

Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron.

Wear what Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean e Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean emakes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean

makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear e Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear e Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear

Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.

Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.

Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes you feel like what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes you feel like what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s Wear what makes you feel like

an Iron. Outlet. SEVENTY DEGREES FARENHEIT. you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s Wear what makes you feel like you.

you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s Wear what makes you feel like you.

you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.

h

Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.

hiComfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. iComfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.

an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.

an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.

Wear what makes you feel like you. SEVENTY DEGREES FARENHEIT. d SEVENTY DEGREES FARENHEIT. d

Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. Wear what makes you feel like hWear what makes you feel like h

Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. Wear what makes you feel like Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

Wear what makes you feel like an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you.

Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. Wear what makes you feel like you.

Wear what makes you feel like Wear what makes you feel like you.

Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. Wear what makes you feel like you.

you. Comfort and Style. Jean Fridays. Rep your tyou. Comfort and Style. Jean Fridays. Rep your tyou. Comfort and Style. Jean Fridays. Rep your d you. Comfort and Style. Jean Fridays. Rep your d you. Comfort and Style. Jean Fridays. Rep your Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.

you. Comfort and Style. Jean Fridays. Rep your Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.

SEVENTY DEGREES FARENHEIT. you. Comfort and Style. Jean Fridays. Rep your SEVENTY DEGREES FARENHEIT. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.

SEVENTY DEGREES FARENHEIT. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.

you. Comfort and Style. Jean Fridays. Rep your Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.

SEVENTY DEGREES FARENHEIT. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your Wear what makes you feel like Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. Wear what makes you feel like Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.

you. Comfort and Style. Jean Fridays. Rep your Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. Wear what makes you feel like Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.

team. Music Tees. What�s an Iron. Outlet. you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. you. Comfort and Style. Jean Fridays. Rep your SEVENTY DEGREES FARENHEIT. you. Comfort and Style. Jean Fridays. Rep your SEVENTY DEGREES FARENHEIT. team. Music Tees. What�s an Iron. Outlet.

SEVENTY DEGREES FARENHEIT. you. Comfort and Style. Jean Fridays. Rep your SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your Wear what makes you feel like team. Music Tees. What�s an Iron. Outlet.

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your Wear what makes you feel like SEVENTY DEGREES FARENHEIT. team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. team. Music Tees. What�s an Iron. Outlet. you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. you. Comfort and Style. Jean Fridays. Rep your SEVENTY DEGREES FARENHEIT.

you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. you. Comfort and Style. Jean Fridays. Rep your Wear what makes you feel like

team. Music Tees. What�s an Iron. Outlet. Wear what makes you feel like

team. Music Tees. What�s an Iron. Outlet. you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an

SEVENTY DEGREES FARENHEIT. you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an

SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an

Wear what makes you feel like Iron. Outlet. SEVENTY DEGREES FARENHEIT.

you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep

your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you

Iron. Outlet. SEVENTY DEGREES FARENHEIT.Wear what makes you

Iron. Outlet. SEVENTY DEGREES FARENHEIT.Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep

Wear what makes you Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep

your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your Wear what makes you your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your

feel like you. Comfort and Style. Jean your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your

feel like you. Comfort and Style. Jean your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your

team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. feel like you. Comfort and Style. Jean team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Wear what makes you your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your Wear what makes you your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your

feel like you. Comfort and Style. Jean your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your Wear what makes you your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your

Fridays. Rep your team. Music Tees. feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. feel like you. Comfort and Style. Jean team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. feel like you. Comfort and Style. Jean team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

Fridays. Rep your team. Music Tees. team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. feel like you. Comfort and Style. Jean team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Wear what makes you

Fridays. Rep your team. Music Tees. Wear what makes you feel like you. Comfort and Style. Jean Wear what makes you

What�s an Iron. Outlet. SEVENTY DEGREES Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES Fridays. Rep your team. Music Tees. feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. feel like you. Comfort and Style. Jean What�s an Iron. Outlet. SEVENTY DEGREES

feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. feel like you. Comfort and Style. Jean FARENHEIT. Wear what makes you feel like bFARENHEIT. Wear what makes you feel like bFARENHEIT. Wear what makes you feel like What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like What�s an Iron. Outlet. SEVENTY DEGREES Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES Fridays. Rep your team. Music Tees. FARENHEIT. Wear what makes you feel like

Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES Fridays. Rep your team. Music Tees. you. ComforFARENHEIT. Wear what makes you feel like you. ComforFARENHEIT. Wear what makes you feel like What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like What�s an Iron. Outlet. SEVENTY DEGREES you. Comfor

What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like What�s an Iron. Outlet. SEVENTY DEGREES t and Style. Jean Fridays. Rep your team. bt and Style. Jean Fridays. Rep your team. bFARENHEIT. Wear what makes you feel like t and Style. Jean Fridays. Rep your team. FARENHEIT. Wear what makes you feel like bFARENHEIT. Wear what makes you feel like bt and Style. Jean Fridays. Rep your team. bFARENHEIT. Wear what makes you feel like bMusic Tees. What�s an Iron. Outlet. SEVENTY DEGREES you. ComforMusic Tees. What�s an Iron. Outlet. SEVENTY DEGREES you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES t and Style. Jean Fridays. Rep your team. bt and Style. Jean Fridays. Rep your team. bMusic Tees. What�s an Iron. Outlet. SEVENTY DEGREES bt and Style. Jean Fridays. Rep your team. b

FARENHEIT. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. dWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. ddOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s dOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s

an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel dWear what makes you feel dWear what makes you feel dWear what makes you feel dWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron.

Wear what makes you feel Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. dWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. dWear what makes you feel dWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. dOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s Wear what makes you feel Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s dOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s dWear what makes you feel dOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s dlike you. Comfort and Style. Jean

Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s

like you. Comfort and Style. Jean Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s

an Iron. Outlet. SEVENTY DEGREES FARENHEIT. like you. Comfort and Style. Jean an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Wear what makes you feel dWear what makes you feel dlike you. Comfort and Style. Jean dWear what makes you feel dOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s Wear what makes you feel Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s

like you. Comfort and Style. Jean Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s Wear what makes you feel Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s dOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s dWear what makes you feel dOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s dlike you. Comfort and Style. Jean dOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s dWear what makes you feel dOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s d

Fridays. Rep your team. Music Tees. tFridays. Rep your team. Music Tees. tFridays. Rep your team. Music Tees. like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. like you. Comfort and Style. Jean an Iron. Outlet. SEVENTY DEGREES FARENHEIT. like you. Comfort and Style. Jean an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

Fridays. Rep your team. Music Tees. an Iron. Outlet. SEVENTY DEGREES FARENHEIT. like you. Comfort and Style. Jean an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Wear what makes you feel

Fridays. Rep your team. Music Tees. Wear what makes you feel like you. Comfort and Style. Jean Wear what makes you feel

What�s an Iron. Outlet. SEVENTY tWhat�s an Iron. Outlet. SEVENTY tWhat�s an Iron. Outlet. SEVENTY Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Fridays. Rep your team. Music Tees. like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. like you. Comfort and Style. Jean What�s an Iron. Outlet. SEVENTY

like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. like you. Comfort and Style. Jean DEGREES FARENHEIT. Wear what i DEGREES FARENHEIT. Wear what i What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what What�s an Iron. Outlet. SEVENTY Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Fridays. Rep your team. Music Tees. DEGREES FARENHEIT. Wear what

Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Fridays. Rep your team. Music Tees. makes you feel like you. ComforDEGREES FARENHEIT. Wear what makes you feel like you. ComforDEGREES FARENHEIT. Wear what i DEGREES FARENHEIT. Wear what i makes you feel like you. Comfori DEGREES FARENHEIT. Wear what i What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what What�s an Iron. Outlet. SEVENTY makes you feel like you. Comfor

What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what What�s an Iron. Outlet. SEVENTY t and DEGREES FARENHEIT. Wear what t and DEGREES FARENHEIT. Wear what

Style. Jean Fridays. Rep your team. Music Tees. n Style. Jean Fridays. Rep your team. Music Tees. n makes you feel like you. ComforStyle. Jean Fridays. Rep your team. Music Tees. makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. t and What�s an Iron. Outlet. SEVENTY DEGREES g What�s an Iron. Outlet. SEVENTY DEGREES g Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES Style. Jean Fridays. Rep your team. Music Tees. FARENHEIT.

g

FARENHEIT.

g What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. What�s an Iron. Outlet. SEVENTY DEGREES g What�s an Iron. Outlet. SEVENTY DEGREES g

FARENHEIT.

g What�s an Iron. Outlet. SEVENTY DEGREES g

Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep

your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h Wear what Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.

Wear what Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.

What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep Wear what What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep

makes you feel like you. Comfort h makes you feel like you. Comfort h makes you feel like you. Comfort What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep

makes you feel like you. Comfort What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep

your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. makes you feel like you. Comfort your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h makes you feel like you. Comfort h your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h Wear what makes you feel like you. Comfort Wear what What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep Wear what What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep

makes you feel like you. Comfort What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep Wear what What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep

and Style. Jean Fridays. Rep your a and Style. Jean Fridays. Rep your a makes you feel like you. Comfort and Style. Jean Fridays. Rep your makes you feel like you. Comfort h makes you feel like you. Comfort h

and Style. Jean Fridays. Rep your

h makes you feel like you. Comfort h your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. makes you feel like you. Comfort your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

and Style. Jean Fridays. Rep your your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. makes you feel like you. Comfort your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h makes you feel like you. Comfort h your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h

and Style. Jean Fridays. Rep your

h your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h makes you feel like you. Comfort h your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h Wear what makes you feel like you. Comfort Wear what and Style. Jean Fridays. Rep your

Wear what makes you feel like you. Comfort Wear what team. Music Tees. What�s an Iron. iteam. Music Tees. What�s an Iron. iteam. Music Tees. What�s an Iron. and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. and Style. Jean Fridays. Rep your makes you feel like you. Comfort and Style. Jean Fridays. Rep your makes you feel like you. Comfort team. Music Tees. What�s an Iron.

makes you feel like you. Comfort and Style. Jean Fridays. Rep your makes you feel like you. Comfort h makes you feel like you. Comfort h

and Style. Jean Fridays. Rep your

h makes you feel like you. Comfort h

team. Music Tees. What�s an Iron.

h makes you feel like you. Comfort h

and Style. Jean Fridays. Rep your

h makes you feel like you. Comfort h

Outlet. SEVENTY DEGREES dOutlet. SEVENTY DEGREES dOutlet. SEVENTY DEGREES team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES team. Music Tees. What�s an Iron. iteam. Music Tees. What�s an Iron. iOutlet. SEVENTY DEGREES iteam. Music Tees. What�s an Iron. iand Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. and Style. Jean Fridays. Rep your Outlet. SEVENTY DEGREES

and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. and Style. Jean Fridays. Rep your FARENHEIT. Wear what makes dFARENHEIT. Wear what makes dFARENHEIT. Wear what makes d FARENHEIT. Wear what makes d Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes Outlet. SEVENTY DEGREES dOutlet. SEVENTY DEGREES dFARENHEIT. Wear what makes dOutlet. SEVENTY DEGREES d

team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES team. Music Tees. What�s an Iron. FARENHEIT. Wear what makes

team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES team. Music Tees. What�s an Iron. you feel like you. Comford you feel like you. Comford FARENHEIT. Wear what makes you feel like you. ComforFARENHEIT. Wear what makes d FARENHEIT. Wear what makes d you feel like you. Comford FARENHEIT. Wear what makes d Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes Outlet. SEVENTY DEGREES you feel like you. Comfor

Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes Outlet. SEVENTY DEGREES t and FARENHEIT. Wear what makes t and FARENHEIT. Wear what makes dFARENHEIT. Wear what makes dt and dFARENHEIT. Wear what makes d

Style. Jean Fridays. Rep your team. Music

d

Style. Jean Fridays. Rep your team. Music

d you feel like you. ComforStyle. Jean Fridays. Rep your team. Music you feel like you. Comford you feel like you. Comford

Style. Jean Fridays. Rep your team. Music

d you feel like you. Comford t and Style. Jean Fridays. Rep your team. Music t and Tees. What�s an Iron. Outlet. SEVENTY t Tees. What�s an Iron. Outlet. SEVENTY t Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Style. Jean Fridays. Rep your team. Music

DEGREES FARENHEIT. t DEGREES FARENHEIT. t Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and

Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team.

Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. b Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. b Wear Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES

Wear Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES

FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Wear FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team.

what makes you feel like b what makes you feel like b what makes you feel like FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team.

what makes you feel like FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team.

Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. what makes you feel like Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. b Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. b what makes you feel like b Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. b Wear what makes you feel like Wear FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Wear FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team.

what makes you feel like FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Wear FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team.

you. Comfort and Style.

b

you. Comfort and Style.

b what makes you feel like you. Comfort and Style. what makes you feel like b what makes you feel like b

you. Comfort and Style.

b what makes you feel like b Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. what makes you feel like Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.

you. Comfort and Style. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. what makes you feel like Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like Wear

you. Comfort and Style. Wear what makes you feel like Wear

Jean Fridays. Rep your you. Comfort and Style. Jean Fridays. Rep your you. Comfort and Style. what makes you feel like you. Comfort and Style. what makes you feel like Jean Fridays. Rep your

what makes you feel like you. Comfort and Style. what makes you feel like team. Music Tees. Jean Fridays. Rep your team. Music Tees. Jean Fridays. Rep your you. Comfort and Style. Jean Fridays. Rep your you. Comfort and Style. team. Music Tees.

you. Comfort and Style. Jean Fridays. Rep your you. Comfort and Style. What�s an Iron. team. Music Tees. What�s an Iron. team. Music Tees. Jean Fridays. Rep your team. Music Tees. Jean Fridays. Rep your What�s an Iron.

Jean Fridays. Rep your team. Music Tees. Jean Fridays. Rep your Outlet. SEVENTY What�s an Iron. Outlet. SEVENTY What�s an Iron. team. Music Tees. What�s an Iron. team. Music Tees. Outlet. SEVENTY

team. Music Tees. What�s an Iron. team. Music Tees. DEGREES FARENHEIT. t DEGREES FARENHEIT. t Outlet. SEVENTY DEGREES FARENHEIT. Outlet. SEVENTY What�s an Iron. Outlet. SEVENTY What�s an Iron. DEGREES FARENHEIT.

What�s an Iron. Outlet. SEVENTY What�s an Iron. Wear what makes lWear what makes lWear what makes t Wear what makes t DEGREES FARENHEIT. Wear what makes DEGREES FARENHEIT. t DEGREES FARENHEIT. t Wear what makes t DEGREES FARENHEIT. t Outlet. SEVENTY DEGREES FARENHEIT. Outlet. SEVENTY Wear what makes

Outlet. SEVENTY DEGREES FARENHEIT. Outlet. SEVENTY you feel like you. h you feel like you. h Wear what makes you feel like you. Wear what makes DEGREES FARENHEIT. Wear what makes DEGREES FARENHEIT. you feel like you.

DEGREES FARENHEIT. Wear what makes DEGREES FARENHEIT. Comforh Comforh you feel like you. Comforyou feel like you. h you feel like you. h Comforh you feel like you. h Wear what makes you feel like you. Wear what makes Comfor

Wear what makes you feel like you. Wear what makes t and Style. you feel like you. t and Style. you feel like you.

Jean Fridays. Rep your ComforJean Fridays. Rep your Comfort and Style. Jean Fridays. Rep your t and Style. team. Music Tees. What�s Jean Fridays. Rep your team. Music Tees. What�s Jean Fridays. Rep your an Iron. Outlet. SEVENTY team. Music Tees. What�s an Iron. Outlet. SEVENTY team. Music Tees. What�s DEGREES FARENHEIT. an Iron. Outlet. SEVENTY DEGREES FARENHEIT. an Iron. Outlet. SEVENTY

Wear what makes you feel like you. Comfort and Style. Jean

Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what

makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an

Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what Fridays. Rep your team. Music Tees. What�s an

Wear what Fridays. Rep your team. Music Tees. What�s an

Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what Iron. Outlet. SEVENTY DEGREES FARENHEIT.

makes you wmakes you wmakes you Wear what makes you Wear what Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what Iron. Outlet. SEVENTY DEGREES FARENHEIT.

makes you Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what Iron. Outlet. SEVENTY DEGREES FARENHEIT.

feel like ofeel like ofeel like makes you feel like makes you Wear what makes you Wear what feel like

Wear what makes you Wear what y o u . oy o u . oy o u . t y o u . t feel like y o u . feel like makes you feel like makes you y o u .

makes you feel like makes you C o m f o r t nC o m f o r t nC o m f o r t t C o m f o r t t y o u . C o m f o r t y o u . t y o u . t C o m f o r t t y o u . t feel like y o u . feel like C o m f o r t

feel like y o u . feel like a n d na n d na n d C o m f o r t a n d C o m f o r t y o u . C o m f o r t y o u . a n d

y o u . C o m f o r t y o u . S t y l e . a n d S t y l e . a n d C o m f o r t a n d C o m f o r t S t y l e .

C o m f o r t a n d C o m f o r t J e a n ' J e a n ' S t y l e . J e a n S t y l e . a n d S t y l e . a n d J e a n

a n d S t y l e . a n d F r i d aJ e a n F r i d aJ e a n S t y l e . J e a n S t y l e . F r i d a

S t y l e . J e a n S t y l e . y s . F r i d ay s . F r i d aJ e a n F r i d aJ e a n y s .

J e a n F r i d aJ e a n R e p y s . R e p y s . F r i d ay s . F r i d aR e p

F r i d ay s . F r i d ay oR e p y oR e p y s . R e p y s . y o

y s . R e p y s . u r y ou r y oR e p y oR e p u r

R e p y oR e p tu r tu r y ou r y ot

y ou r y o

Seaming

together what seems to See the seemlessly seaming Seamss

ssss

ss

City Scape City Scape City Scape City Scape

City Scape City Scape City Scape City Scape City Scape City Scape City Scape

City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City

Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City

Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City

Scape City Scape City Scape City Scape City Scape City Scape City Scape City

Scape City Scape City Scape City Scape City Scape City Scape City

Scape City Scape City Scape City Scape City Scape City Scape City

Scape City Scape City Scape City Scape City Scape City Scape

City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City

Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City

Scape City Sc

Nin

tttteen

ddo ApApA pppp lelel N64 FiFiFnal Cut

AaB

bCcD

dEeF

fGgH

hIiJjK

kLlMmNnOoPpQqRrSsTtUuVvWwXxYyZzAaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSs

Visual. Glasses. Frame your life. OPTICS. simplicity

.

saf kfjbwk lkmok

fbkwbe fnwcon aksmcl kfjbwk lkmok

fbkwbe fnwcon aksmcl kfjbwk lkmok

akmsc sakfjbw kfbkwb efnwco naks mclakmsc

akmsc sakfjbw kfbkwb efnwco naks mclakmsc

akmsc sakfjbw kfbkwb

sakfjbwk fbkw be fnwcon aksmcl akmsc sakfjb fssddsw

sakfjbwk fbkw be fnwcon aksmcl akmsc sakfjb fssddsw

sakfjbwk fbkw be fnwcon

kfbkwbaksmcl akmsc sakfjb fssddsw kfbkwb

aksmcl akmsc sakfjb fssddsw efnwco naks mclakmsc

aksmcl akmsc sakfjb fssddsw efnwco naks mclakmsc

aksmcl akmsc sakfjb fssddsw

sakfjbwk fbkwbe fnwcon aksmcl akmssakfjakmssakfj

c sakfjbw kfbkwb efnw sdbco naksec

c sakfjbw kfbkwb efnw sdbco naksec

c sakfjbw kfbkwb efnw sdbco v mclakmsc sakfjbw kjdfk

c sakfjbw kfbkwb efnw sdbco v mclakmsc sakfjbw kjdfk

c sakfjbw kfbkwb efnw sdbco

fbkwbe fv mclakmsc sakfjbw kjdfk

fbkwbe fv mclakmsc sakfjbw kjdfk

nwcon aksmcl akm kjsc v mclakmsc sakfjbw kjdfk

nwcon aksmcl akm kjsc v mclakmsc sakfjbw kjdfk

fbkwbe fnwcon aksmcl akm kjsc fbkwbe fv mclakmsc sakfjbw kjdfk

fbkwbe fv mclakmsc sakfjbw kjdfk

nwcon aksmcl akm kjsc v mclakmsc sakfjbw kjdfk

fbkwbe fv mclakmsc sakfjbw kjdfk

sakfjbw kfbkwb efnwco nak ks nwcon aksmcl akm kjsc

bw kfbkwb efnwco nak ks nwcon aksmcl akm kjsc

mclakmsc sakfjb wkoa panff sakfj

lakmsc sakfjb wkoa panff sakfj

fbkwlakmsc sakfjb wkoa panff

fbkwlakmsc sakfjb wkoa panff

be fnwcon aksm nsofcl lakmsc sakfjb wkoa panff

be fnwcon aksm nsofcl lakmsc sakfjb wkoa panff

akmsc sakfjbw kfbkwb own efnwco n lanaks

sc sakfjbw kfbkwb own efnwco n lanaks

sc sakfjbw kfbkwb

mclakmsc sakfjbwk fbkwbe fnwc nslfon

mclakmsc sakfjbwk fbkwbe fnwc nslfon

mclakmsc sakfjbwk

aksmcl akm basc sakfjb nalfw kfbk pwwb sakfjb nalfw kfbk pwwb sakfjb nalfw

efnw bwco naks cndj mclak msc naks cndj mclak msc naks cndj

sakfjbwk k nldwbe yk nldwbe y

sakfjbwk k nldwbe

sakfjbwk

fnwcon

sakfjbwk fbkw be fnwcon aksmcl akmsc sakfjb fssddsw

sakfjbwk fbkw be fnwcon aksmcl akmsc sakfjb fssddsw

sakfjbwk fbkw be fnwcon

kfbkwbaksmcl akmsc sakfjb fssddsw kfbkwb

aksmcl akmsc sakfjb fssddsw efnwco naks mclakmsc

aksmcl akmsc sakfjb fssddsw efnwco naks mclakmsc

aksmcl akmsc sakfjb fssddsw

sakfjbwk fbkwbe fnwcon aksmcl akmssakfjakmssakfj

c sakfjbw kfbkwb efnw sdbco sakfj

c sakfjbw kfbkwb efnw sdbco sakfj

v mclakmsc sakfjbw kjdfk c sakfjbw kfbkwb efnw sdbco v mclakmsc sakfjbw kjdfk

c sakfjbw kfbkwb efnw sdbco

fbkwbe fnwcon aksmcl akm kjsc v mclakmsc sakfjbw kjdfk

nwcon aksmcl akm kjsc v mclakmsc sakfjbw kjdfk

fbkwbe fnwcon aksmcl akm kjsc fbkwbe fsakfjbw kfbkwb efnwco nak ks

nwcon aksmcl akm kjsc bw kfbkwb efnwco nak ks

nwcon aksmcl akm kjsc

lakmsc sakfjb wkoa panff sakfj

lakmsc sakfjb wkoa panff sakfj

fbkwlakmsc sakfjb wkoa panff

fbkwlakmsc sakfjb wkoa panff

be fnwcon aksm nsofcl lakmsc sakfjb wkoa panff

be fnwcon aksm nsofcl lakmsc sakfjb wkoa panff

akmsc sakfjbw kfbkwb own efnwco n lanaks

sc sakfjbw kfbkwb own efnwco n lanaks

sc sakfjbw kfbkwb

mclakmsc sakfjbwk A

aBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZzAaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvW

wX

-

lakmsc sakfjb wkoa panff

-

lakmsc sakfjb wkoa panff lakmsc sakfjb wkoa panff Slakmsc sakfjb wkoa panff be fnwcon aksm nsofcl

S

be fnwcon aksm nsofcl lakmsc sakfjb wkoa panff

be fnwcon aksm nsofcl lakmsc sakfjb wkoa panff Slakmsc sakfjb wkoa panff

be fnwcon aksm nsofcl lakmsc sakfjb wkoa panff tbe fnwcon aksm nsofcl tbe fnwcon aksm nsofcl

sc sakfjbw kfbkwb

t

sc sakfjbw kfbkwb

a

sc sakfjbw kfbkwb

a

sc sakfjbw kfbkwb sc sakfjbw kfbkwb tsc sakfjbw kfbkwb own efnwco n lanaks

t

own efnwco n lanaks sc sakfjbw kfbkwb

own efnwco n lanaks sc sakfjbw kfbkwb tsc sakfjbw kfbkwb

own efnwco n lanaks sc sakfjbw kfbkwb usc sakfjbw kfbkwb usc sakfjbw kfbkwb

own efnwco n lanaks

u

own efnwco n lanaks sc sakfjbw kfbkwb

own efnwco n lanaks sc sakfjbw kfbkwb usc sakfjbw kfbkwb

own efnwco n lanaks sc sakfjbw kfbkwb sown efnwco n lanaks sown efnwco n lanaks

mclakmsc sakfjbwk

s

mclakmsc sakfjbwk

No rest for the Wicked No rest for the

Wicked No rest for the

Wicked No rest for the Wicked BLACK PLASTIC

Envision theFuture

BLACK PLASTICBLACK PLASTICEnvisiont

BLACK PLASTIC

t

BLACK PLASTIC

tEnvisiontEnvisiont

for the Wicked for the Wicked

ajhdh sdibdcsafwf

ajhdh sdibdcsafwf

ajhdh sdibdcsafd ajhdh sdibdcsaf ajhdh sibdcsaf ajhdh sibdcsafvve ajhdh sibdcsaaca ajhdh sibdcsaacwfw ajhdh sibdcsadvva ajhdh sibdcsevb w ajhdh sibdcs ouavbeer

ajhdh sdibdcsafwf

sdsfv sdvsv wwwdc wcwcsdsfv sdvsv

sdsfv sdvsv wwwdc wcwcsdsfv sdvsv wwwdc

sdsfv sdvsv wwwdc wcwcsdsfv sdvsv wwwdc

sdvsv wwwdc wcwcsdsfv sdvsv wwwdc wcwcsdsfv

sdsfv sdvsv wwwdc wcwcsdsfv sdvsv wwwdc vvwcwcd

sdsf

v sd

vsv w

wwdc wcwcsdsfv sdvsv

sdsfv sdvsv wwwdc wcwcsdsfv sdvsv wwwdc wcwcsdsfv

ajhdh sibdcsascbw ajhdh sibdcs evbw ajhdh sibdcsny�g ajhdhggg osobvb doi ajhdh sibdc eonal ajhdh sibdd sqw ajhdh sibsd oidaonkf

ajhdha ajhdha ajhdha ajhdha

ajhdh sdibdcsafwf

ajhdhsdibdajhdh sdibdcsafwf

ajood axcv ajhdh sdibdcsafwf

KJBWCJKBWCBO ONCW AFW

KJBWCJKBWCBO ONCW AFW

KJBWCJKBWCBO ONCW AFW

ajhdhsdib dcsaf

KJBWCJKBWCBO ONCW AFW

KJBW

CJKBWCBO ONCW AFW

KJBWCJKBWCBO ONCW AFW

ajhdh sdibd

KJBWCJKBWCBO ONCW

AFW

KJBWCJKBW

CBO ONCW

KJBWCJKBWCBO ONCW

AFW

KJBWCJKBW

CBO O

NCW

KJBWCJKBW

CBO O

KJBWCJKBW

CBO O

NCW

KJBWCJKBW

CBO O

NCW

KJBWCJKBW

CBO O

KJBWCJKBW

CBO O

NCW

KJBWCJKBW

CBO O

NCW

KJBWCJKBW

CBO O

KJBWCJKBW

CBO O

NCW

KJBWCJKBW

CBO O

NCW

KJBWCJKBW

CBO O

KJBWCJKBW

CBO O

NCW

KJBWCJKBW

CBO ONCW

KJBWCJKBW

CBO O

KJBWCJKBW

CBO O

NCW

KJBWCJKBW

CBO O

NCW

KJBW

CJKBWCBO

KJBWCJKBW

CBO O

NCW

http://vimeo.com/user4633884http://vimeo.com/user4633884s�fvvvsvsvsv

http://vimeo.com/user4633884http://vimeo.com/user4633884s�fvvvsvsvsvhttp://vimeo.com/user4633884http://vimeo.com/user46338

http://vimeo.com/user4633884http://vimeo.com/user46338http://vimeo.com/user4633884

http://vimeo.com/user4633884

http://vimeo.com/user4633884http://vimeo.com/user46338

http://vimeo.com/user4633884http://vimeo.com/user46338

http://vimeo.com/user4633884http://vimeo.com/user46338

http://vimeo.com/user4633884http://vimeo.com/user46338

http://vimeo.com/user4633884http://vimeo.com/user46338

http://

vimeo.com/user4633884http

://vimeo.com/user4633884s�fvvvsvsvsv

ajhdh sibsd ajhdhdv ajhd

weoicnowinvoinwvoinwoinclks

weoicnowinvoinwvoinw

weoicnowinvoinwvoinwoin

weoicnowinvoinwvoinwoinclksndclknwineoinvonadvnoidnvoineovneoinvoineoivnoienoivneorin

weoicnowinvoinwvoinwoinclks

weoicnowinvoinwvoinw

weoicnowinvoinwvoinwoin

weoicnowinvoinwvoinwoinclksndclknwineoinvonadvnoidnvoineovneoinvoineoivnoienoivneorin

weoicnowinvoinwvoinwoinclks

weoicnowinvoinwvoinw

weoicnowinvoinwvoinwoin

weoicnowinvoinwvoinwoinclksndclknwineoinvonadvnoidnvoineovneoinvoineoivnoienoivneorin

weoicnowinvoinwvoinwoinclks

weoicnowinvoinwvoinw

weoicnowinvoinwvoinwoin

weoicnowinvoinwvoinwoinclksndclknwineoinvonadvnoidnvoineovneoinvoineoivnoienoivneorin

weoicnowinvoinwvoinwoinclks

weoicnowinvoinwvoinw

weoicnowinvoinwvoinwoin

weoicnowinvoinwvoinwoinclksndclknwineoinvonadvnoidnvoineovneoinvoineoivnoienoivneorin

svsv ss sdsdsdddvdvsvsvsss fs fsvfv vfvf sdhdhtdttd

t vsv wwwdc wcwdwdowododwdod owohwhohowohocmcmhchmhmcmhmtctmtmcmtms/s/usudsdsederd r

hdhtdt

pdpspsdspsswswtstwtwswtwpspwpwswpw fwfwfpfp:f:/f //f /vwvwd

vd/v//v////v/// vv vfvfwfwvwfw/f /v/f / scsccpcscpc /

s/h

shchcschc :h:s:h:c :chc :csc :chc :c /h/s/h/d/d//d////d/// vdv/h/d/h/tdt/t/d/t/vtvdvtvtdtvtvdvtvvivimvmcvcvvvvvivitvtvtvvvtvitivitictcvctcpvpmpmvmpmcpcvcpcopovoposmsms es eosopspmpmsmpmoposopo:s:m:msm:me/es e/eohosohoopohoposopohopovovomvm/v/e/eve/e/v////v///

tvtotovotomtmvmtmmtmvmtmmpmvmpmw/w/uwupwpmpmwmpm/p/w/p//:/w/://w////w///u/uwu/uu/uwu/uu/u/u/uwu/u/u/uvw vuvuwuvuiwimwmwuwuswsewevwvsvswsvsmwmeweo

wowewerwr4w4owo cwcowod4d46d6odomdmc3c3mcm/c/

sfsf

d sd dsd

sddd sfs fsf

ffvfvfvff

fvf vfvf sdvdvsds vvvv wvwswsw vwvw wwwwdwdcwcwcwc wwwwwwwcwcwwwdcdcsds

dddcscsdcd wswsfwfvwvfvfwfvfmw

mvmvwvmvwwwcwccscsecesescsesocososcsosdod

cdod

cccwcwowocowowdwdvwvsw

sdodwdodd.dwd.dcwcdcdwdcd owoohowohowwwdwdwdwdcwcwcwcdcdwdcdwdcdwdcd owowowoohowohowohowohocwcocowocomcmwmcmcscsvcv

mcmv4vcv4vcccmcmcmcmscs/s/c /s/swsw4s4hshwhwswhwssshshsh

shdsdhdhshdhdwdwwdwwhwdwhwtdtwtwdwtwwtwdwtwtdtwtwdwtwdddtdtdtdtt

dtdt

dtsdststdtstwtwswtwdwtwswtwpspd pspswswwswhshpspwpwswpwwpwswpwpspspspwpwswpwswpwswpw fsfwfwswfwpfpspfpwpw fwpwswpw fwpwwpwfwpwswpwfwpwfwfwdf dhfhwhwfwhwtftwt

wfwtw

tf ttmtftmtvfvwvwfwvwdvdf dvd/v/f /v/fvfffvfwfwvwfwfwfwvwfwvdvdcvctvtdtdvdtdtvtdtdvdtdpvpdpdvdpdcpcvcpcmvmdmdvdmdtmtvtmttmtvtmtpmpvpmpdvdvdvdfvf df dvdf dtftvtftdtdf dtdvdtdf dtdtf tvtf tdtdf dtdvdtdf dtdtmt

ftmtvtmtftmtdvdf dvdvdvdf dvd sesepepspep osowowswowhshwhwswhwhsh:h:s:h:/h/s/h/w/whw/wsw/whw/wehesehewewhwewswewhwew:e:h:e:s:e:h:e:/e/h/e/s/e/h/e/w/wew/whw/wew/wsw/wew/whw/wew/wohosohowowhwowswowhwoww/wow/whw/wow/wsw/wow/whw/wow/w3s3e3ese3e8s8o8oso8o4

s4343s343e3e4e3ese3e4e3e848s848dwdwcdcodowowdwow cd ccccdcccwowhwowdwowhwowtdtwtwdwtwctcdctc/t/d/t/vtvdvtvotodotowowtwowdwowtwow/o/t/o/d/o/t/o/w/wow/wtw/wow/wdw/wow/wtw/wow/w vovtvovdvovtvovtd tctcd ctc8d8o8odo8owow8wowdwow8wow8d8c8cdc8co8odo8owow8wowdwow8wowcoc8cocdcoc8cocc.c8c.cdc.c8c.cccc8cccdccc8cccccc4cccdccc4ccc848d848hdhohodoho8h8d8h8o8oho8odo8oho8o8h8d8h8c8chc8cdc8chc8co8oho8odo8oho8ococ8cochcoc8cocdcoc8cochcoc8coc

td

t8t8d8t8

c8ctc8cdc8ctc8ctdtdtdt/t/d/t/d/t/d/t/vtvdvtvdvtvdvtvoto

dotodotodoto/o/t/o/d/o/t/o/d/o/t/o/d/o/t/o/vovtvovdvovtvovdvovtvovdvovtvovvd vtvtd tvtvwvw8v8w8wvw8ww4wvw4wwcw4wcwvwcw4wcwwhwvwhwhvhtvt8t8v8t8tvtwtwvwtw8t8v8t84t4v4t4w4wtw4wvw4wtw4wpvpwp

wvwpww4wpw4wvw4wpw4wwhwp

whwvwhwp

whwh

phvh

phscscssshshchcschc

tsttst

pspcpcscpctptstpt :s:c:csc:cs:sss:s/s /c /csc /cs/sss/svsvsdvdtvtstsvstspvpdpdvdpd/v/s/svs/sd/dvd/d/v/s /svs /sd/dvd/d///v///s/s /s/svs/s /s/sd/d/d/dvd/d/d/dd vdvd vd wfwfvwv/w/s/sws/sf/fwf/f/w/f/fwf/fv/vwv/vfvf/fvfwfvf/fvf///w///f/f/f/fwf/f/f/f vwvf vfwf vfv vvwv vv iw i

vwv/v/w/v/iwi/i/w/i//i/w/i/mwm/m/w/m/ wiwimwmew eweweowo

/w//w////w/// vw

vdcdcod ovdvidimdmwdwmwmdmwmcmcmecewcwmwmcmwmeweceweeeeceeewcweweceweeweweweceweweweeeeweeeceeeweeew

cwwwwcwwwewewewecewewewe

svsv/s/s/sss/sv/vsv/v/s/v/vsv/vv/v/v/vsv/v/v/vdvdv/d/v/vdv/vvdvvvvdvvvvvvvivimvmhvhvhvvvhvihivihismsmv wwwdwdwwww

dwwwcwcwwcwwwwcwwwcwcccwc wwwwwwwwwwwwwwwwwwwwwwwwwwdwwwdwdcdcdcccdc wsws

cwccwccccwccc wcwcswswdsfvfvf sdvsv ww:

w:/

w/w/w//w////w/// vwviw

imw

mmw

mdmdmedemdmmmmdmmm/d/e/ede/ecoco cc c/c/o/oco/oucuouocouo.u.c.u.cscc cscwowoswseweoeowoeo rwr4w 44w46w63w

3c4c43c33c3w

rwr4w

43w38w8e8ewe8er8rwr8r8w8484

w484c4c46c63c 3484c4844c4444c444646c646s6s63s33s 3hsh3h3s3h3mhmsmhmmmmhmmmsmmmhmmmd3d38d 8/d/mmmdmmm/d////d///udu/u/d/u/uuuduuutdtmtmdmtmmmmtmmmdmmmtmmm/t/d/t////t///d///t///tdt/t/d/t////t///d///t///utudutu/u/t/u/d/u/t/u/upudupuuuupuuuduuupuuus

8

s

84

s

4usussssssusususussssssses esesssespspupusupuuuupuuusuuupuuuusupusususupusu:s:s:sss:ss:sss:ssss:sssssss:ssss/sss/se/es e/eses/sessses/sesf4f4sfseferf reref ere/f/4/4f4/4s/sfs/se/efe/eses/sesfses/ses/f /4 /4f4 /4s/sfs/se/ef e/ee/efe/eeee/eeef eee/eeer/ rf r/ rere/eref ere/ere///f///4/4 /4/4f4/4 /4/4s/s/s/sfs/s/s/se/e/e/efe/e/e/e4o4f4o4v4v4 everv r/v/e/eve/evvvevevevervrv rvr4o4v4o4ivi/i/v/i/cvcfvf4f4v4f4 /f /v/f /4 /4f4 /4v4 /4f4 /4 e/ef e/eve/ef e/e4o4f4o4v4o4f4o4

s/s/vsvdvdvidimdmsmsm fefe v

w

v

wdv de veovofvfefe vefe sdsdcscdcdc wdwo do vwvwswswcscvcvcwvwwwwwcwcswswswsdwdwdwdswsfwfdfdfvdvfvfdfvf cscs wdwd cvcvscswswsvwv csdsfvfvf sdvsv wwcwcow

owowomwmdmdm/d/ududmdm cucuscswcwcsdsfvfvf

http:/d/

d/d/ds/s/// vsvsfvfififmfmfvmvfvfmfvf esesososdodd.dcdcd om/user4633884http:///// vimeo.com/user4633884s�f�f� vfvf vvsvsvsv

hvhv whwvhvvvvhvvv wvwhwvwwswhwswtwtwwswtwswtwtwwtwwswtwswpwpwwvwpwvw:w:ww:w/w/w/d/dw/w

/// vdvd

iwiwmwmwwmwewewwewowoww.wcwcwdcdododmdmdcmc/usdsdeded

46f6f

3388e8

eo8o4

o4

o.4.c4chohomhmwh

wowohowo tmtmwt

wmwmtmwmdtdmdmtmdmtmtmdtdmdmtmdm/d/t/d/pupudpd/d/p/d/udupuducpcucupucuscspscs/s/se/e/e/er/r4/4w/w///e/e/e/e v4v4 i6i6m3m33m3e8e8 o4o4 c�c�o�o�fof�f�o�f� mvmv/uvuv ser46338

hshsdhdtdtdtvtvpvpvspss:s/s/sv/v/v/vv/v/v/vvvvvieiemwmwececoeowew oooomom.c/c/ucuouousos memermr4m4/4/46/6u6u63u3s3s3e8e88e8r8r84r44444h4h6h6ht6tt6t3t3tp3p3p3p /3/8/8/

v8v

8s8sv8v4v4v w4whwhwtwtwwtwtwtwpwpwwpw:///// vimeo.commmm/e/eo/ououo.u.scscosoeoeomemrmrm4m4m/4/u4u6u6us6s3e3er3r3r3r4348686383

hshsrhr ftft4t4f4ftf4f

6t6tftfvtvfvftfvf6t6f6ftf6f

3t3tvpvp3p33p3:3:38:8/

m/

me/e

8/8e

8e/e

8e/o/o/

e/

eo/o8/8

e8

e/

e8

eo8o/o8o

/// v8v84v4ihihohoiohom

dm

dhmhtmttmtpmpececpepcpcecpc:e:owow/o/w/wow/w ccccwcwowow m/user4633884

hshshchcscshscswhw:h:s:shs:sc :chc:cscs:scshscs:scs/h/s/shs/se/ehe/ew/whw/w/h/w/whw/w///h///w/w/w/whw/w/w/wehewewhwew:e:h:e:/e/h/e/w/wew/whw/wew/wohowowhwoww/wow/whw/wow/ww/wow/whw/wow/ww/w/w/wow/w/w/whw/w/w/wow/w/w/wt4t4wtwctc/t/r/rtr/r4/4t4/4vtv4v4t4v4otowowtwow/o/t/o/w/wow/wtw/wow/w vovtvovt4t46t6vtv4v4t4v46v6t6v6iti6i6t6i6ctcp3p3mpm3m3p3m33m3p3m3cpcopo:8:8m:m3m3:3m3 /8/88/8e/e8e8/8e88e8/8e8/8/84/4o/o8o8/8o84o4/4o4/// v4v4svs�v�ovo4o4v4o4.v.s.svs.scvcscsvscs�c�v�c�

/v/ i�i��c�i�c�oio�o�i�o�mfmfvmvfvfmfvf vmvvmvomofofmfofvovmvovfvfofvfmfvfofvf mmmvmvmvmvvmvmvmvvmvmvmvevevsesvevmemvmvevmv/e/v/vev/vs/ses/sueuvuvevuvovovsosvov

uouvuvovuvsusosussossssosss cscsvcvcovovom/8/88/8/user4633884

hwhwwhwtwtwdtdwdwtwdwtwtwwwwtwww

dtdwd

wtwd

wwdwtwdwwwwd

wwwtwwwd

wwwpcpcwpwwpwcwcpcwccpcwcwpwcwcccpcccwcwpwcwwwwcwwwpwwwcwwwcwcccwcpcwcccwc :w:ww:wwww:wwww:wwww:wwwwwwwwww:wwwwwww/w/ww/wwww/wwww/wwww/wwwwww/wwwwwwwwww/wwwwwwwwdwwwdw/wdwwwdw/w/wc/cd/dcdc/cdc/w/wd/dw/wwww/wwwcwc/cwcwww/wwwdwd/dwdwdwwwdw/wdwwwdwcdcwcdc/cdcwcdcdcd/dcdcdcccdc/cdcccdcw/w/w/wwww/www/www/www vcvcsvsdvdcdcvcdcsdsvsdsscsvscsdcdvdcdcdcccdcvcdcccdcsdscsdsvsdscsdswvwswsvswsdwdvdwdcicscsiscswiwcwcicwcmdmdwmwcmcdcdmdcdcwcmcwcdcdwdcdmdcdwdcdcccwcccmcccwccccmcwcwmwcwcccmcccwewwwwewwwwswewswwwwswwwewwwswwwowowwwwowwwdodwdwowdwwowowowwswowswc.ccdcdscsososfofmfmfvmvfvfmfvf /v/vp/pvpv/vpv ususssssdsddedrdrdvrv4v4v6v6vs6s3

m3

m3e3e8o8o

wow8wow8c8cw8wo8owow8wowcoc8cocc.c8c.cc8cccc8ccc 4w4wc4cccc 4cccwcw4wcwwow4wow

p4pcpc4cpchwhwchcohowowhwowopohopototomtmtmtmpmpm/p//://///u/u

i/i/u/ui/im/m

///u/u/u/uvuvusvsisism

im

memermremeerer4e4

oeoovovsos4o46o6ooo.o.cocscsoscs.6.6cvcv6c63

c3

cccvcvcvcvocovovcvov o3o3ooomommmmm////u/u/uuususussseses rere4e4er4r 6r 6r464343463636363

338383

hwhwdhdwhwwwwhwwwdwdhdwd/h

/d/dhd/dtdtdctcwtwdwdtdwdcwctcwcwtwcwctcwctwtwcwctcwc pwpwwwwpwwwwww

dwwwpwwwd

wwwwwwtwwwpwwwtwwwwwwd

wwwtwwwd

wwwpwwwd

wwwtwwwd

www:w:ww:wwww:wwwwww:www/w/wwww/wwwcwc/cwc/w

/ww/wcwc/cwcwww/wwww/w/w/wwww/www/www/wwww/w/w/wcwc/cwc/cwc/cwc vdvdwvwdvdw/wvw/w/v/w/wvw/wd/dvd/dw/w

vw/wdwd/dwdvdwd/dwddiddiddddiddddcdidcdd/did/ddwd/dwdidwd/dwddcd/dcdidcd/dcdmcmcdmddddmdddcccmcccdcdmdcdwmwcwcmcwcdwdmdwdwmwcwcmcwccwcmcwccccwcccmcccwcccdvdmdvddcdvdcdmdcdvdcdwvwmwvwdwdvdwdmdwdvdwdimicicmcicwiwmwiwcwcicwcmcwcicwccwcicwcmcwcicwccwcmcwcmcwcmcwccccwcccmcccwcccmcccwcccmcccwcccececcwcecwccccwcccecccwcccceccccecccmemcmcecmccmcecmcwmwewmwcwcmcwcecwcmcwccwcmcwcecwcmcwccccwcccmcccwcccecccwcccmcccwccccmcecmccccmcccecccmccc owowcocwcwowcwsoswswowswcmcocmcwcwmwcwowcwmwcwwewowewwswewswowswewswwwwswwwewwwswwwowwwswwwewwwswwww.wwsw.wswwew.wewwwwewww.wwwewwwwswewsw.wswewswwwwswwwewwwswww.wwwswwwewwwswwwwcwcdcdocowowcwowwswowswcwswowswdodcdodwdwowdwcwdwowdw ow owcocdodwdw owdwcdcocdcooowow owowdodododwdwowdw owdwowdw .o.c.coc.ccoccccocccdcdodcdmsmsfmfcmcscsmscsomososmsosfofmfoffmfmfmf/m/mfmf/fmfvmv/vmvfvfmfvf/fvfmfvf uvuvmumvmvuvmv/u/v/vuv/vssss/s/usususssusesessusesussessssesssrdrd4d4dv4vded4dedr4r

6v6vr6rvrv6vrvv4v6v4v3v3vs3s3s3sv3v8v8v 8v 8v w8w4w4whwhw twtwtstspdpd:d:

ds:s/s/sf/f/f/fv/vfvf/fvf///f/f/f/f vf vfvvv imeo.com/user46338

hwhwvhvihimhmwmwhwmwwtwmtmwmwtwmwtwtwmtmwmwtwmwpwpwwpwepewewpwew opo:w:wo:o/w/wo/o././w/w./.c/cw/w/w/wvwvwcvcovoioiomdmd

ed

eddod

edodmemdmd

edmd

omom/o//./c/c/ucuouousosmdmdemededmdedhmhehemeherhrmrhr/4/4h/hrhr/rhr4h4/4h44t4/4t4fuf

6u6f6fuf6fufuf4u4f4fuf4ftutftfuftf4t4u4t4f4ftf4fuf4ftf4f6t6u6t6f6ftf6fuf6ftf6f6t6u6t6f6ftf6fuf6ftf6fsvsvs

3s3tstvtvsvtv6t6s6t63t3s3t3evevpepvpvevpv

3p3e3p33p3e3p3p/pep/pvpv/vpvevpv/vpv rsrs3r3prp3p3r3p3:r:3:3r3:34s4s

8484:4:8:848:8/4/8/848/8/4/s4ssss4sss6d6d868/6/d/d6d/d8/868/8v6v8v868v84v464v4

s6sded6ded3d3dv3vv3vded3dedr3rdrd3drdvrv3vrv4343

i3im3m434v4v3v4v6368m8m686v6v8v6vs6s8s6sm6m8m6m383m

3m8m3m

8m

8me8e383m

3m

8m

3m

383e3e8e3e4343e3e4e3e848hoho8h8o8oho8o8h8c8ch

c8co8oho8ococ8coch

coc8coct8t8c8ctc8cw8wtw8wtwtw8t84t4w4wtw4wpwp

wcpcw4wpw4whphwhwp

whwh

pht

pt

:c:cs:s/c /cs/sd/dt/tt/ t/s /sd/dt/t///s/s /s/sd/d/d/dvdvd/v/i/i//i/m/m/ im

ieiei omomeoe.e.ececeocooooo mcmcomo/o/om/mumums/s/e/e/ueursrs4s4se4e6e6er6r343436368383

hohomhmtmtm/t/t/t/utupupusps:e:e/e/er/r/r/r4/4r/r/r/r v4v46v6i3i3m3m33m38m8e8e88e8o4o4hoh.ctcttcteceocoo

totpopooom:m:/m/cmcomo/

v/vo/om/mumumsmsm/s/er4m4m/

4/6/6/u6u3u3us3s3s3se3e8e8er8rc8cscs8scsvcv8vcv8v8vr8r484o8ovov8vovooo8ooo4444646o4om4mo4oooo4ooomom4mommmm4mmmh3h3mhmmmmhmmmtmtmmtmmmmtmmm/t////t///t/t////t///utu/u/t/u/p

8p

8upuupuuuupuuuusupusu:s:ss:ssss:sss/4

/4s/se/eses/ses/4 /4s/se/ee/eeee/eeer/rere/ere///4/

4 /4/

4s/s/s/se/e/e/evevervririrm4m46m6e6e6o3o3.com/user46338

The one god thing about music, w

hen it hits you you feel no pain. Live Music.

http://vimeo.com/user4633884 http://vimeo.com/user4633884 http://vim

Triumph Triumph

Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph

Triumph Triumph Triumph Triumph Triumph Triumph

Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph

Triumph Triumph Triumph

Triumph Triumph

Triumph Triump

h Tri

Hanging out in the backyard. Big front porch neighborhoods. 918. T-Town, Tulsa, OK. 74127. Firepits. Cookouts. Music. Friends. Music Festivals. Road Trips. “Adventures” Top of Mountains. College Life. Boome

Sooner! Cycling. Maxin & Relaxin

TR 3 TR3 TR3 TR3 TR3 TR3 TR3 TR3 TR3 TR3 TR3 TR3 TR3 TR3 TR3

TR3

19 59 1959 1959 1959

1959 1959 1959 1959 1959 1959

1959 1959 1959 1959 1959

1959 1959 1959 1959 1959 1959 1959 1959

1959 1959 1959 1959 1959 1959 1959 1959 1959 1959 1959

1959 1959 1959 1959 1959 1959 1959 1959 1959 1959 1959 1959

1959 1959 1959 1959 1959 1959 1959 1959 1959 1959 1959

1959 1959 1959 1959 1959 1959 1959

1959

Hang-ing out in the

backyard. Big front

porch neighborhoods.

918. T-Town, Tulsa, OK. 74127.

Firepits. Cookouts. Music. Friends.

Music Festivals. Road Trips. “Adventures”

Top of Mountains. College Life. Boome

Sooner! Cycling. Maxin & RelaxinHanging out in

the backyard. Big front porch neighborhoods.

918. T-Town, Tulsa, OK. 74127. Firepits. Cookouts.

Music. Friends. Music Festivals. Road Trips.

“Adventures” Top of Mountains. College Life. Boome

Sooner! Cycling. Maxin & RelaxinHanging out in the

backyard. Big front porch neighborhoods. 918. T-Town,

Tulsa, OK. 74127. Firepits. Cookouts. Music. Friends. Music

Festivals. Road Trips. “Adventures” Top of Mountains. College Life.

Boome Sooner! Cycling. Maxin & RelaxinHanging out in the backyard.

Big front porch neighborhoods. 918. T-Town, Tulsa, OK. 74127. Firepits.

Cookouts. Music. Friends. Music Festivals. Road Trips. “Adventures” Top of

Mountains. College Life. Boome Sooner! Cycling. Maxin & RelaxinHanging out in the

backyard. Big front porch neighborhoods. 918. T-Town, Tulsa, OK. 74127. Firepits. Cookouts. Music. Friends. Music

Festivals. Road Trips. “Adventures” Top of Mountains. College Life. Boome Sooner! Cycling. Maxin & RelaxinHanging out in the

backyard. Big front porch neighborhoods. 918. T-Town, Tulsa, OK. 74127. Firepits. Cookouts. Music. Friends. Music Festivals. Road

Trips. “Adventures” Top of Mountains. College Life. Boome Sooner! Cycling. Maxin & RelaxinHanging out in the backyard. Big front porch

neighborhoods. 918. T-Town, Tulsa, OK. 74127. Firepits. Cookouts. Music. Friends. Music Festivals. Road Trips. “Adventures” Top of Mountains. College Life. Boome Sooner! Cycling. Maxin & RelaxinHanging out in the backyard. Big front porch neighborhoods. 918. T-Town, Tulsa, OK. 74127. Firepits. Cookouts. Music. Friends. Music

Festivals. Road Trips. “Adventures” Top of Mountains. College Life. Boome Sooner! Cycling. Maxin & RelaxinHanging out in the

backyard. Big front porch neighborhoods. 918. T-Town, Tulsa, OK. 74127. Firepits. Cookouts. Music. Friends. Music

Festivals. Road Trips. “Adventures” Top of Mountains. College Life. Boome Sooner! Cycling. Maxin &

RelaxinHanging out in the backyard. Big front porch neighborhoods. 918. T-Town, Tulsa, OK. 74127.

Firepits. Cookouts. Music. Friends. Music Festivals. Road Trips. “Adventures” Top of

Mountains. College Life. Boome Sooner! Cycling. Maxin & RelaxinHanging out

in the backyard. Big front porch neighborhoods. 918. T-Town,

Tulsa, OK. 74127. Firepits. Cookouts. Music.

Friends. Music Festivals. Road

Trips.

PTplic

T-Town, Tulsa, OK. 74127. Firepits. Cookouts. Music.

Maxin & Relaxin

Firepits. Cookouts. Music.

S.rSs

Firepits. Cookouts. Music. Friends. Music Festivals. Road Trips. “Adventures”

College Life. Boome Sooner! Cycling.

Maxin & Relaxin

mpliity

.

aksmcl akm basc sakfjb nalfw kfbk pwwb sakfjb nalfw kfbk pwwb sakfjb nalfw

efnw bwco naks cndj mclak msc naks cndj mclak msc naks cndj

sakfjbwk fbk nldwbe sakfjbwk k nldwbe

sakfjbwk

fnwcon tcon t

Ww lw lX lX liX i

oinwvoinw

oinclksndclknwineoinvonadvnoidnvoineovneoinvoineoivnoienoivneorinvioenrvw

eoicnowinvoinw

voinwoinclksndclknw

ineoinvonadvnoidnvoineovneoinvoineoivnoienoivneorinvioenrvweoicnow

invoinwvoinw

o

voinwoinclksndclknwineoinvonadvnoidnvoineovneoinvoineoivnoienoivneorinvioenrv

Take a minute to enjoy what you

don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy

what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not

have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take

a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a

minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a

minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t

not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have

Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not

have Take a minute to enjoy what you don’t not have Take a

Ptosis (from Greek Ptosis or πτῶσις, to "fall") is

a drooping of the upper or lower eyelid. Ptosis (from

Greek Ptosis or πτῶσις, to "fall") is a drooping

Radio head tv

Radio head tv

Radio

on the radio wacka

o

on the radio wacka

oi

on the radio wacka

in

on the radio wacka

nc

on the radio wacka

cl

on the radio wacka

lk

on the radio wacka

ks

on the radio wacka

sn

on the radio wacka

nd

on the radio wacka

dc

on the radio wacka

cl

on the radio wacka

lk

on the radio wacka

knon the radio wacka nwon the radio wacka wion the radio wacka inon the radio wacka neon the radio wacka eoon the radio wacka oion the radio wacka inon the radio wacka nvon the radio wacka voon the radio wacka onon the radio wacka naon the radio wacka adon the radio wacka dvon the radio wacka vnon the radio wacka noon the radio wacka oion the radio wacka idon the radio wacka dnon the radio wacka nvon the radio wacka voon the radio wacka oion the radio wacka inon the radio wacka neon the radio wacka enon the radio wacka neon the radio wacka eoon the radio wacka oion the radio wacka inon the radio wacka nvon the radio wacka voon the radio wacka onon the radio wacka naon the radio wacka adon the radio wacka dvon the radio wacka vnon the radio wacka noon the radio wacka oion the radio wacka idon the radio wacka dnon the radio wacka nvon the radio wacka voon the radio wacka oion the radio wacka inon the radio wacka neon the radio wacka eoon the radio wacka ovon the radio wacka vnon the radio wacka neon the radio wacka eoon the radio wacka oion the radio wacka inon the radio wacka nvon the radio wacka voon the radio wacka oion the radio wacka inon the radio wacka neon the radio wacka eoon the radio wacka oion the radio wacka ivon the radio wacka vnon the radio wacka noon the radio wacka oion the radio wacka ieon the radio wacka enon the radio wacka noon the radio wacka oion the radio wacka ivon the radio wacka vnon the radio wacka neon the radio wacka eoon the radio wacka oron the radio wacka rion the radio wacka inon the radio wacka nvon the radio wacka vion the radio wacka ioon the radio wacka oeon the radio wacka enon the radio wacka nron the radio wacka rvon the radio wacka vwon the radio wacka weon the radio wacka eoon the radio wacka oion the radio wacka icon the radio wacka cnon the radio wacka noon the radio wacka owon the radio wacka wion the radio wacka inon the radio wacka nvon the radio wacka voon the radio wacka oion the radio wacka inon the radio wacka nwon the radio wacka wvon the radio wacka voon the radio wacka oion the radio wacka inon the radio wacka nwon the radio wacka woon the radio wacka oion the radio wacka inon the radio wacka ncon the radio wacka clon the radio wacka lkon the radio wacka kson the radio wacka snon the radio wacka ndon the radio wacka dcon the radio wacka clon the radio wacka lkon the radio wacka knon the radio wacka nwon the radio wacka wion the radio wacka inon the radio wacka neon the radio wacka eoon the radio wacka oion the radio wacka inon the radio wacka nvon the radio wacka voon the radio wacka onon the radio wacka naon the radio wacka adon the radio wacka dvon the radio wacka vnon the radio wacka noon the radio wacka oion the radio wacka idon the radio wacka dnon the radio wacka nvon the radio wacka voon the radio wacka oion the radio wacka inon the radio wacka neon the radio wacka eoon the radio wacka ovon the radio wacka vnon the radio wacka neon the radio wacka eoon the radio wacka oion the radio wacka inon the radio wacka nvon the radio wacka voon the radio wacka oion the radio wacka inon the radio wacka neon the radio wacka eoon the radio wacka o

head tv on the radio wacka

head tv

plocka flame mumford

o

plocka flame mumford

ov

plocka flame mumford

vn

plocka flame mumford

ne

plocka flame mumford

eo

plocka flame mumford

oi

plocka flame mumford

in

plocka flame mumford

nv

plocka flame mumford

vo

plocka flame mumford

oi

plocka flame mumford

inplocka flame mumford neplocka flame mumford eoplocka flame mumford oiplocka flame mumford ivplocka flame mumford vnplocka flame mumford noplocka flame mumford oiplocka flame mumford ieplocka flame mumford enplocka flame mumford noplocka flame mumford oiplocka flame mumford ivplocka flame mumford vnplocka flame mumford neplocka flame mumford eoplocka flame mumford orplocka flame mumford riplocka flame mumford inplocka flame mumford nvplocka flame mumford viplocka flame mumford ioplocka flame mumford oeplocka flame mumford enplocka flame mumford nrplocka flame mumford rvplocka flame mumford vwplocka flame mumford weplocka flame mumford eoplocka flame mumford oiplocka flame mumford icplocka flame mumford cnplocka flame mumford noplocka flame mumford owplocka flame mumford wiplocka flame mumford inplocka flame mumford nvplocka flame mumford voplocka flame mumford ooplocka flame mumford onplocka flame mumford naplocka flame mumford adplocka flame mumford dvplocka flame mumford vnplocka flame mumford noplocka flame mumford oiplocka flame mumford idplocka flame mumford dnplocka flame mumford nvplocka flame mumford voplocka flame mumford oiplocka flame mumford inplocka flame mumford neplocka flame mumford eoplocka flame mumford ovplocka flame mumford vnplocka flame mumford neplocka flame mumford eoplocka flame mumford oiplocka flame mumford inplocka flame mumford nvplocka flame mumford voplocka flame mumford oiplocka flame mumford inplocka flame mumford neplocka flame mumford eoplocka flame mumford oiplocka flame mumford ivplocka flame mumford vnplocka flame mumford noplocka flame mumford oiplocka flame mumford ieplocka flame mumford enplocka flame mumford noplocka flame mumford oiplocka flame mumford ivplocka flame mumford vnplocka flame mumford neplocka flame mumford eoplocka flame mumford orplocka flame mumford riplocka flame mumford inplocka flame mumford nvplocka flame mumford viplocka flame mumford ioplocka flame mumford oeplocka flame mumford enplocka flame mumford nrplocka flame mumford rvplocka flame mumford vwplocka flame mumford weplocka flame mumford eoplocka flame mumford oiplocka flame mumford icplocka flame mumford cnplocka flame mumford noplocka flame mumford owplocka flame mumford wiplocka flame mumford inplocka flame mumford nvplocka flame mumford voplocka flame mumford oiplocka flame mumford inplocka flame mumford nwplocka flame mumford wvplocka flame mumford voplocka flame mumford oi

plocka flame mumford

in

plocka flame mumford

nw

plocka flame mumford

wo

plocka flame mumford

oi

plocka flame mumford

in

plocka flame mumford

nc

plocka flame mumford

cl

plocka flame mumford

lk

plocka flame mumford

ks

plocka flame mumford

sn

plocka flame mumford

nd

plocka flame mumford

dc

plocka flame mumford

cl

plocka flame mumford

lk

plocka flame mumford

kn

plocka flame mumford

nw

plocka flame mumford

wi

plocka flame mumford

in

plocka flame mumford

no

plocka flame mumford

oi

plocka flame mumford

iv

plocka flame mumford

vn

plocka flame mumford

no

plocka flame mumford

oi

plocka flame mumford

ie

plocka flame mumford

en

plocka flame mumford

no

plocka flame mumford

oi

plocka flame mumford

iv

plocka flame mumford

vnplocka flame mumford neplocka flame mumford eoplocka flame mumford orplocka flame mumford riplocka flame mumford inplocka flame mumford nvplocka flame mumford viplocka flame mumford ioplocka flame mumford oeplocka flame mumford enplocka flame mumford nrplocka flame mumford rvplocka flame mumford vwplocka flame mumford weplocka flame mumford eoplocka flame mumford oiplocka flame mumford icplocka flame mumford cnplocka flame mumford noplocka flame mumford owplocka flame mumford w

iplocka flame mumford inplocka flame mumford nvplocka flame mumford voplocka flame mumford oiplocka flame mumford inplocka flame mumford n

on the radio wacka plocka flame mumford on the radio wacka eon the radio wacka e

plocka flame mumford

eon the radio wacka eoon the radio wacka o

plocka flame mumford

oon the radio wacka owon the radio wacka w

plocka flame mumford

won the radio wacka wion the radio wacka i

plocka flame mumford

ion the radio wacka inon the radio wacka n

plocka flame mumford

non the radio wacka neon the radio wacka e

plocka flame mumford

eon the radio wacka eoon the radio wacka o

plocka flame mumford

oon the radio wacka ooon the radio wacka o

plocka flame mumford

oon the radio wacka oion the radio wacka i

plocka flame mumford

ion the radio wacka i

and sons zac brown band oand sons zac brown band ot

and sons zac brown band

t h

and sons zac brown band

h o

and sons zac brown band

oi

and sons zac brown band

in

and sons zac brown band

nw

and sons zac brown band

wv

and sons zac brown band

vo

and sons zac brown band

oi

and sons zac brown band

in

and sons zac brown band

nw

and sons zac brown band

wo

and sons zac brown band

oi

and sons zac brown band

in

and sons zac brown band

nc

and sons zac brown band

cl

and sons zac brown band

lk

and sons zac brown band

ks

and sons zac brown band

sn

and sons zac brown band

nd

and sons zac brown band

dc

and sons zac brown band

cl

and sons zac brown band

lk

and sons zac brown band

kn

and sons zac brown band

nw

and sons zac brown band

wi

and sons zac brown band

in

and sons zac brown band

ne

and sons zac brown band

eo

and sons zac brown band

oi

and sons zac brown band

in

and sons zac brown band

nv

and sons zac brown band

vo

and sons zac brown band

ow

and sons zac brown band

wv

and sons zac brown band

vo

and sons zac brown band

oi

and sons zac brown band

in

and sons zac brown band

nw

and sons zac brown band

wo

and sons zac brown band

oi

and sons zac brown band

in

and sons zac brown band

nc

and sons zac brown band cl

and sons zac brown band lk

and sons zac brown band ksand sons zac brown band snand sons zac brown band ndand sons zac brown band dcand sons zac brown band cland sons zac brown band lkand sons zac brown band knand sons zac brown band nwand sons zac brown band wiand sons zac brown band inand sons zac brown band neand sons zac brown band eoand sons zac brown band oiand sons zac brown band inand sons zac brown band nvand sons zac brown band voand sons zac brown band onand sons zac brown band naand sons zac brown band adand sons zac brown band dvand sons zac brown band vnand sons zac brown band noand sons zac brown band oiand sons zac brown band idand sons zac brown band dnand sons zac brown band nvand sons zac brown band voand sons zac brown band oiand sons zac brown band inand sons zac brown band neand sons zac brown band eoand sons zac brown band ovand sons zac brown band vnand sons zac brown band neand sons zac brown band eoand sons zac brown band oiand sons zac brown band inand sons zac brown band nvand sons zac brown band voand sons zac brown band oiand sons zac brown band inand sons zac brown band neand sons zac brown band eoand sons zac brown band oiand sons zac brown band ivand sons zac brown band vnand sons zac brown band noand sons zac brown band oiand sons zac brown band ieand sons zac brown band enand sons zac brown band noand sons zac brown band oiand sons zac brown band ivand sons zac brown band vnand sons zac brown band neand sons zac brown band eoand sons zac brown band orand sons zac brown band riand sons zac brown band i

plocka flame mumford and sons zac brown band plocka flame mumford iplocka flame mumford i

and sons zac brown band

iplocka flame mumford inplocka flame mumford n

and sons zac brown band

nplocka flame mumford nvplocka flame mumford v

and sons zac brown band

vplocka flame mumford voplocka flame mumford o

and sons zac brown band

oplocka flame mumford oiplocka flame mumford i

and sons zac brown band

iplocka flame mumford inplocka flame mumford n

and sons zac brown band

nplocka flame mumford nwplocka flame mumford w

and sons zac brown band

wplocka flame mumford woplocka flame mumford o

and sons zac brown band

oplocka flame mumford oiplocka flame mumford i

and sons zac brown band

iplocka flame mumford inplocka flame mumford n

and sons zac brown band

nplocka flame mumford nvplocka flame mumford v

and sons zac brown band

vplocka flame mumford voplocka flame mumford o

and sons zac brown band

oplocka flame mumford onplocka flame mumford n

and sons zac brown band

nplocka flame mumford naplocka flame mumford a

and sons zac brown band

aplocka flame mumford adplocka flame mumford d

and sons zac brown band

dplocka flame mumford dnplocka flame mumford n

and sons zac brown band

nplocka flame mumford nwplocka flame mumford w

and sons zac brown band

wplocka flame mumford w

notorious b.i.g. big gigantic

n

notorious b.i.g. big gigantic

n r

notorious b.i.g. big gigantic ri

notorious b.i.g. big gigantic in

notorious b.i.g. big gigantic nv

notorious b.i.g. big gigantic vi

notorious b.i.g. big gigantic io

notorious b.i.g. big gigantic oe

notorious b.i.g. big gigantic en

notorious b.i.g. big gigantic nr

notorious b.i.g. big gigantic rv

notorious b.i.g. big gigantic vw

notorious b.i.g. big gigantic we

notorious b.i.g. big gigantic eo

notorious b.i.g. big gigantic oi

notorious b.i.g. big gigantic ic

notorious b.i.g. big gigantic cn

notorious b.i.g. big gigantic no

notorious b.i.g. big gigantic ow

notorious b.i.g. big gigantic wi

notorious b.i.g. big gigantic innotorious b.i.g. big gigantic nvnotorious b.i.g. big gigantic vonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic innotorious b.i.g. big gigantic nwnotorious b.i.g. big gigantic wvnotorious b.i.g. big gigantic vonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic innotorious b.i.g. big gigantic nwnotorious b.i.g. big gigantic wonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic innotorious b.i.g. big gigantic ncnotorious b.i.g. big gigantic clnotorious b.i.g. big gigantic lknotorious b.i.g. big gigantic ksnotorious b.i.g. big gigantic snnotorious b.i.g. big gigantic ndnotorious b.i.g. big gigantic dcnotorious b.i.g. big gigantic clnotorious b.i.g. big gigantic lknotorious b.i.g. big gigantic knnotorious b.i.g. big gigantic nwnotorious b.i.g. big gigantic winotorious b.i.g. big gigantic innotorious b.i.g. big gigantic nenotorious b.i.g. big gigantic eonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic innotorious b.i.g. big gigantic nvnotorious b.i.g. big gigantic vonotorious b.i.g. big gigantic onnotorious b.i.g. big gigantic nanotorious b.i.g. big gigantic adnotorious b.i.g. big gigantic dvnotorious b.i.g. big gigantic vnnotorious b.i.g. big gigantic nonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic idnotorious b.i.g. big gigantic dnnotorious b.i.g. big gigantic nvnotorious b.i.g. big gigantic vonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic innotorious b.i.g. big gigantic nenotorious b.i.g. big gigantic eonotorious b.i.g. big gigantic ovnotorious b.i.g. big gigantic vnnotorious b.i.g. big gigantic nenotorious b.i.g. big gigantic eonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic innotorious b.i.g. big gigantic nvnotorious b.i.g. big gigantic vonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic innotorious b.i.g. big gigantic nenotorious b.i.g. big gigantic eonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic ivnotorious b.i.g. big gigantic vnnotorious b.i.g. big gigantic nonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic ienotorious b.i.g. big gigantic ennotorious b.i.g. big gigantic n

and sons zac brown band notorious b.i.g. big gigantic and sons zac brown band eand sons zac brown band e

notorious b.i.g. big gigantic eand sons zac brown band eoand sons zac brown band o

notorious b.i.g. big gigantic oand sons zac brown band orand sons zac brown band r

notorious b.i.g. big gigantic rand sons zac brown band riand sons zac brown band i

notorious b.i.g. big gigantic iand sons zac brown band inand sons zac brown band n

notorious b.i.g. big gigantic nand sons zac brown band nvand sons zac brown band v

notorious b.i.g. big gigantic vand sons zac brown band v

pretty lights sts9 the john n

pretty lights sts9 the john no

pretty lights sts9 the john oi

pretty lights sts9 the john iv

pretty lights sts9 the john vn

pretty lights sts9 the john ne

pretty lights sts9 the john eo

pretty lights sts9 the john or

pretty lights sts9 the john ri

pretty lights sts9 the john in

pretty lights sts9 the john nv

pretty lights sts9 the john vi

pretty lights sts9 the john io

pretty lights sts9 the john oe

pretty lights sts9 the john en

pretty lights sts9 the john nrpretty lights sts9 the john rvpretty lights sts9 the john vwpretty lights sts9 the john wepretty lights sts9 the john eopretty lights sts9 the john oipretty lights sts9 the john icpretty lights sts9 the john cnpretty lights sts9 the john nopretty lights sts9 the john owpretty lights sts9 the john wipretty lights sts9 the john inpretty lights sts9 the john nvpretty lights sts9 the john vopretty lights sts9 the john oipretty lights sts9 the john inpretty lights sts9 the john nwpretty lights sts9 the john wvpretty lights sts9 the john vopretty lights sts9 the john oipretty lights sts9 the john inpretty lights sts9 the john nwpretty lights sts9 the john wopretty lights sts9 the john oipretty lights sts9 the john inpretty lights sts9 the john ncpretty lights sts9 the john clpretty lights sts9 the john lkpretty lights sts9 the john kspretty lights sts9 the john snpretty lights sts9 the john ndpretty lights sts9 the john dcpretty lights sts9 the john clpretty lights sts9 the john lkpretty lights sts9 the john knpretty lights sts9 the john nwpretty lights sts9 the john wipretty lights sts9 the john inpretty lights sts9 the john nepretty lights sts9 the john eopretty lights sts9 the john oipretty lights sts9 the john inpretty lights sts9 the john nvpretty lights sts9 the john vopretty lights sts9 the john onpretty lights sts9 the john napretty lights sts9 the john adpretty lights sts9 the john dvpretty lights sts9 the john vnpretty lights sts9 the john nopretty lights sts9 the john oipretty lights sts9 the john idpretty lights sts9 the john d

notorious b.i.g. big gigantic pretty lights sts9 the john

notorious b.i.g. big gigantic enotorious b.i.g. big gigantic e

pretty lights sts9 the john enotorious b.i.g. big gigantic ennotorious b.i.g. big gigantic n

pretty lights sts9 the john nnotorious b.i.g. big gigantic nonotorious b.i.g. big gigantic o

pretty lights sts9 the john onotorious b.i.g. big gigantic oi

notorious b.i.g. big gigantic i

pretty lights sts9 the john i

notorious b.i.g. big gigantic i

butler pretty lights sts9 the john

butler pretty lights sts9 the john

trio coldplay .trio coldplay .mtrio coldplay m

i

trio coldplay id

trio coldplay dn

trio coldplay nv

trio coldplay vo

trio coldplay oi

trio coldplay in

trio coldplay ne

trio coldplay eo

trio coldplay ov

trio coldplay vn

trio coldplay ne

trio coldplay eo

trio coldplay oi

trio coldplay in

trio coldplay nv

trio coldplay vo

trio coldplay oi

trio coldplay intrio coldplay netrio coldplay eotrio coldplay oitrio coldplay ivtrio coldplay vntrio coldplay notrio coldplay oitrio coldplay ietrio coldplay entrio coldplay notrio coldplay oitrio coldplay ivtrio coldplay vntrio coldplay netrio coldplay eotrio coldplay ortrio coldplay ritrio coldplay intrio coldplay nvtrio coldplay vitrio coldplay iotrio coldplay oetrio coldplay entrio coldplay nrtrio coldplay rvtrio coldplay vwtrio coldplay wetrio coldplay eotrio coldplay oitrio coldplay ictrio coldplay cntrio coldplay notrio coldplay owtrio coldplay witrio coldplay intrio coldplay nvtrio coldplay votrio coldplay oitrio coldplay intrio coldplay nwtrio coldplay wvtrio coldplay votrio coldplay oitrio coldplay intrio coldplay n

pretty lights sts9 the john trio coldplay

pretty lights sts9 the john npretty lights sts9 the john n

trio coldplay npretty lights sts9 the john nopretty lights sts9 the john o

trio coldplay opretty lights sts9 the john oipretty lights sts9 the john i

trio coldplay ipretty lights sts9 the john idpretty lights sts9 the john d

trio coldplay dpretty lights sts9 the john dnpretty lights sts9 the john n

trio coldplay npretty lights sts9 the john n

band butler

band butler

of band

of band

hoof

hoof

rho

rho

Page 38: pBook 6
Page 39: pBook 6

Typographic Self-Portrait

Instructional Diagram

Visual Poetry Calendar

Project: Instructional Diagram11x17 - Adobe Illustrator

The Instructional Diagram is an assignment in which we are to visually explain how to complete a task.

The assignment began by brainstorming common tasks among different demographics. The chosen task

mus be communicated clearly and concisely. We studied the use of iconography in this projects. The mor

simple an object was illustrated the better. The other task at hand was to create an effective and easy to

read layout that leads the viewers eye from one step to the next.

1

2

3

D2

Page 40: pBook 6
Page 41: pBook 6

To Change a Bike Tire

Replacement Intertube

Tire Tool

Portable Pump

1

2

34

5

Lift B

oth

Leve

r Up

6

Page 42: pBook 6
Page 43: pBook 6

Typographic Self-Portrait

Instructional Diagram

Visual Poetry Calendar

Project: Visual Poetry Calendar11x17 - Adobe Illustrator (3)

The Visual Poetry Calendar was slightly different because it was the first group project we were

assigned. The goal of the project was to develope a cohesive 12 month calendar with four group

members, each having their own season. The month I chose was Spring. To begin the project each

member created a mood board for thier month. After collaborating and reviewing each others boards

we decided on the centralized theme. This project was broken down into step. Each step focused our

attention to specific detail, such as imagery, type selection and layout and overall calendar layout/

integration.

1

2

3

D3

Page 44: pBook 6
Page 45: pBook 6
Page 46: pBook 6

Book Notes

Design Notes:

This book was designed and written by ADD YOUR NAME

in partial fulfillment of ART 2633 Visual Communication I and

ART 2643 Design Technology at the University of Oklahoma

School of Art & Art History, Fall 2011.

Software: Adobe Creative Suite

Typographic Notes:

All type was set in 8/14 pt. Univers Font.

Univers is one of a group of neo-grotesque sans-serif typefaces,

all released in 1957, that includes Folio and Neue Haas Grotesk

(later renamed Helvetica). These three faces are sometimes

confused with each other, because each is based on the 1898

typeface Akzidenz-Grotesk. These typefaces figure prominently in

the Swiss Style of graphic design.

A very important aspect of the Univers family is its modularity.

Frutiger wanted to create a series of related designs that were

absolutely harmonious with each other.

Frutiger has continued to improve and expand the Univers

family, working with Linotype designers to add new

weights and enlarging the character set to include many

languages such as Greek, Cyrillic and Arabic. The final

iteration of the family, Univers Next – a complete upgrading

of the design – was released in 2010.

Typographic Design:

Univers typeface designed by Adrian Frutiger.

Page 47: pBook 6