pBook 6
description
Transcript of pBook 6
![Page 1: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/1.jpg)
“It’s not the Destination.It’s the Adventure along the way” A Process Book of Design
Ben Hart
Visual Communication | School of Art & Art History | Fall Semester 2011
![Page 2: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/2.jpg)
![Page 3: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/3.jpg)
Visual Communication | School of Art & Art History | Fall Semester 2011
“It’s not the Destination.It’s the Adventure along the way” A Process Book of Design
Ben Hart
![Page 4: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/4.jpg)
Introduction: (General Synopsis of Your Design Work this Semester)
I was always a very visual kid. The day I discovered the world
digital video editing in the 6th grade, I fell in love with the
ability to manipulate and create using technology. Spending
more time on the dvd cover art and opening credits sequence
than the body of the film led me to the conclusion that
creating videos has nothing to do with my interests. Through
this, I discovered Design.
Sub conciously everyone knows more goes into design than
what your eyes see and brain comprehends. Design is the art
of communicating.
I was always a very visual kid. The day I discovered the world
digital video editing in the 6th grade, I fell in love with the
ability to manipulate and create using technology. Spending
more time on the dvd cover art and opening credits sequence
than the body of the film led me to the conclusion that
creating videos has nothing to do with my interests. Through
this, I discovered Design.
Sub conciously everyone knows more goes into design than
what your eyes see and brain comprehends. Design is the art
of communicating.
I was always a very visual kid. The day I discovered the world
digital video editing in the 6th grade, I fell in love with the
ability to manipulate and create using technology. Spending
more time on the dvd cover art and opening credits sequence
than the body of the film led me to the conclusion that
creating videos has nothing to do with my interests. Through
this, I discovered Design.
Sub conciously everyone knows more goes into design than
what your eyes see and brain comprehends. Design is the art
of communicating.
I was always a very visual kid. The day I discovered the world
digital video editing in the 6th grade, I fell in love with the
ability to manipulate and create using technology. Spending
more time on the dvd cover art and opening credits sequence
than the body of the film led me to the conclusion that
creating videos has nothing to do with my interests. Through
this, I discovered Design.
Sub conciously everyone knows more goes into design than
what your eyes see and brain comprehends. Design is the art
of communicating.
I was always a very visual kid. The day I discovered the world
digital video editing in the 6th grade, I fell in love with the
ability to manipulate and create using technology. Spending
more time on the dvd cover art and opening credits sequence
than the body of the film led me to the conclusion that
creating videos has nothing to do with my interests. Through
this, I discovered Design.
Sub conciously everyone knows more goes into design than
what your eyes see and brain comprehends. Design is the art
of communicating.
![Page 5: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/5.jpg)
ART 2633Visual Communications 1
Line Studies
Color
Photography
Grid Series
Curve Lines
Shape Studies
Word Communication
![Page 6: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/6.jpg)
Line Interval:Concept Development (5x5)
In this project you will be interpreting sound visually. As you
develop your ideas it will be helpful to consider the components
of sound such as tempo, volume, duration, context, etc and
translate them into visual equivalents.
As you develop your ideas it will be helpful to consider the
components of sound such as tempo, volume, duration,
context, etc and translate them into visual equivalents.
Remember that the simpler compositions are generally the
most successful. In this project you will be interpreting sound
visually.
Top: 1a, 1b, 1c
Bottom: 2, 3, 4, 5
![Page 7: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/7.jpg)
Line Studies
Color
Photography
Grid Series
Curve Lines
Shape Studies
Word Communication
1
2
3
4
5
6
7
Project: Line Interval Studies5x5 Studies (8)
The Line Interval Studies is a series of vertical line layouts that demonstrate result the behavior among
different weighted lines and thier proximity to one another. We were instructed to not use a measuring
device and to manipulate the space completly based on the way it appears optically. After a few
critiques the reasoning behind not using a ruler to measure became more apparent. The is about the
communication of the visual interaction between the four white lines and five black lines, and counting
milimeters only created less of an understanding.
V1
![Page 8: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/8.jpg)
![Page 9: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/9.jpg)
Line Studies
Color
Photography
Grid Series
Curve Lines
Shape Studies
Word Communication
Project: Color Exploration10x10 Studies (7)
Color Exploration was the next step of our learning process. Seamlessly we advanced into the project
with help from our Line Interval Studies. Our random line studies were perfected and enlarged to the
14x17 mounted 10x10 format that would be used from this point on. The first set is the Value study
created soley with shades of grey. The two compositions were to contrast each other, one dark dominant
and the other light dominant. Second is the Monochromatic Study and Third is the Complementary Color
Study. Each of the two color sets are made up of two cntrasting dark/light compositions that match up to
the corresponding Value study.
1
2
3
4
5
6
7
V2
![Page 10: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/10.jpg)
Random Line StudyFinal 10x10 Composition
Type Me- don’t leave widows in your text.
![Page 11: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/11.jpg)
ValueContrasting Studies
Type Me- don’t leave widows in your text.
![Page 12: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/12.jpg)
MonochromaticContrasting Studies
Type Me- don’t leave widows in your text.
![Page 13: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/13.jpg)
ComplementaryContrasting Studies
Type Me- don’t leave widows in your text.
![Page 14: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/14.jpg)
![Page 15: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/15.jpg)
Line Studies
Color
Photography
Grid Series
Curve Lines
Shape Studies
Word Communication
Project: Photography Compositions8x8 Composition (2)
The first week of class the assignment was given to go out in and take pictures of line in nature and
the built enviroment. Looking through the cropped frame of a viewfinder focuses the eye on specific
variables of lines. Elements such as scale, number, weight, direction and color, as well as the context
of the line were among the things to be taken into consideration. The project was broken down into two
parts, both aimed at developing an awareness of visual elements as language. The second part of the
project was to make a quardrant composition with four images, and a composition that sits on a 16 quare
grid. As well as the adition of the grid, the compositions to also have a theme. The theme I chose was
simply light and the way light interacts with line, whether it is a backlit silloute or the light in and of itself.
The guidelines of part two forces the focus to be on the movement of line and the relationship between
the aranged images.
1
2
3
4
5
6
7
V3
![Page 16: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/16.jpg)
Grid Process Docs
![Page 17: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/17.jpg)
Line Studies
Color
Photography
Grid Series
Curve Lines
Shape Studies
Word Communication
Project: Gird Series10x10 Composition (3)
The Grid series is the three step progression demonstrating our chosen visual operation communicated
exponentially. To communicate this with our 10x10 square we have countless options when it comes to
exhausting tool options (xacto, black paper, markers etc), but whatever we do we must always “use the
grid”. The goal of the initial first Grid is to answer the question, what is the visual operation? Once this is
achieved we are to also ask a question. The progression from the first grid to the second and third expand
on this concept while taking it a step farther each time, but while still remaining cohesive to Grid 1.
1
2
3
4
5
6
7
V4
![Page 18: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/18.jpg)
1
2
![Page 19: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/19.jpg)
3
![Page 20: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/20.jpg)
Curve Process Docs
![Page 21: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/21.jpg)
Line Studies
Color
Photography
Grid Series
Curve Lines
Shape Studies
Word Communication
Project: Curve Lines10x10 Composition (2)
This project involved studying the way lines curve, bend, and pivot. The study was a progression that
began with a simple bend first, and a bend that doubles back the other direction second. The third line
study began to manipulate the space in a more controlled manner with a greater number of sharper
curves. With the fourth and last curve we were to not only manipulate the surrounding space but also
to use the idea of figure/ground relationships to create illusion of a shape. After creating the initial
four curves they get aranged in a 10x10 sqaure. Within the arrangment of lines no seperating distance
along the top and bottom can be the same. Along with a simple line arrangement we also completed
a compsition using three fills. The two inside negative areas created shapes that must contrast in
dominance.
1
2
3
4
5
6
7
V5
![Page 22: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/22.jpg)
![Page 23: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/23.jpg)
![Page 24: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/24.jpg)
(Process Docs)
![Page 25: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/25.jpg)
Line Studies
Color
Photography
Grid Series
Curve Lines
Shape Studies
Word Communication
Project: Shape StudiesProgressing Studies (3)
The Shape Studies were very similar to the curved line compositions. However, unlike curves, the
finished curves were communicated soley with the use of fills. The first shape communication is
fold. The design came from the actual folding of a 2x11 strip ob black construction paper. Second
communicates as a simple unbiased flat shape, but while still having three changes in direction. Shape
number three is a complex ambiguous shape. It commuicates detailed form, while still coming across as
a random figure ground shape with no top or bottom.
1
2
3
4
5
6
7
V6
![Page 26: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/26.jpg)
![Page 27: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/27.jpg)
(Process Docs)
![Page 28: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/28.jpg)
Group 1Word Communication
Group 2Word Communication
![Page 29: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/29.jpg)
Line Studies
Color
Photography
Grid Series
Curve Lines
Shape Studies
Word Communication
Project: Word Communication8x8 Composition (20)
The Word Communication project expands a single word and communicating it visually through form,
pacement and color. This project was broken in to three groups of words, and seasons for the fourth. The
first group must only be communicated with black one inch squares. The second is the same, but with
the freedom applying color to each square. Both groups three and four allow the same freedom of color,
but with the addition of simple illustrations replacing the one inch cubes. This assignment questions the
reasoning of our decisions. What this does is it ensures that when we design, we are using what we
have learned this semester to create both smart and succesful design.
1
2
3
4
5
6
7
V7
![Page 30: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/30.jpg)
Group 3Word Communication
![Page 31: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/31.jpg)
Group 4Word Communication
![Page 32: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/32.jpg)
Introduction: (General Synopsis of Your Design Work this Semester)
I was always a very visual kid. The day I discovered the world
digital video editing in the 6th grade, I fell in love with the
ability to manipulate and create using technology. Spending
more time on the dvd cover art and opening credits sequence
than the body of the film led me to the conclusion that
creating videos has nothing to do with my interests. Through
this, I discovered Design.
Sub conciously everyone knows more goes into design than
what your eyes see and brain comprehends. Design is the art
of communicating.
I was always a very visual kid. The day I discovered the world
digital video editing in the 6th grade, I fell in love with the
ability to manipulate and create using technology. Spending
more time on the dvd cover art and opening credits sequence
than the body of the film led me to the conclusion that
creating videos has nothing to do with my interests. Through
this, I discovered Design.
Sub conciously everyone knows more goes into design than
what your eyes see and brain comprehends. Design is the art
of communicating.
I was always a very visual kid. The day I discovered the world
digital video editing in the 6th grade, I fell in love with the
ability to manipulate and create using technology. Spending
more time on the dvd cover art and opening credits sequence
than the body of the film led me to the conclusion that
creating videos has nothing to do with my interests. Through
this, I discovered Design.
Sub conciously everyone knows more goes into design than
what your eyes see and brain comprehends. Design is the art
of communicating.
I was always a very visual kid. The day I discovered the world
digital video editing in the 6th grade, I fell in love with the
ability to manipulate and create using technology. Spending
more time on the dvd cover art and opening credits sequence
than the body of the film led me to the conclusion that
creating videos has nothing to do with my interests. Through
this, I discovered Design.
Sub conciously everyone knows more goes into design than
what your eyes see and brain comprehends. Design is the art
of communicating.
I was always a very visual kid. The day I discovered the world
digital video editing in the 6th grade, I fell in love with the
ability to manipulate and create using technology. Spending
more time on the dvd cover art and opening credits sequence
than the body of the film led me to the conclusion that
creating videos has nothing to do with my interests. Through
this, I discovered Design.
Sub conciously everyone knows more goes into design than
what your eyes see and brain comprehends. Design is the art
of communicating.
![Page 33: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/33.jpg)
ART 2643Design Technology
Self Portrait
Instructional Diagram
Calendar
Process Book
![Page 34: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/34.jpg)
![Page 35: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/35.jpg)
Typographic Self-Portrait
Instructional Diagram
Visual Poetry Calendar
Project: Typographic Self-Portrait11x17 - Adobe Illustrator
The typographic self-portrait is an image of ourselves created completly with text. Type may be used
to create lines, fill areas, and any other way seen fit as long as the type is not distorted in any way. One
emphasis of this project was to use individual letters as form. The idea was to use letterforms as shape,
and thus renforcing the use of the elements of design being practiced in Visual Communications 1.
1
2
3
D1
![Page 36: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/36.jpg)
![Page 37: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/37.jpg)
Rap Count
ryRockDubstepWOMP
Chacos. Ultimate Disc. Sun.
“I re
ad s
omew
here
... h
ow im
port
ant i
t is i
n lif
e not necessarily
to b
e stro
ng... but to
feel
The
core
of m
ans'
spiri
t comes fro
m
new experiences.
Everyone needs a change in p a c e S o m e t i m e s
No
res
t for the wicked
Swim
Ultim
ate
Fris
bee
Run
Bike
Camp
Hike
SailClimb
If I wanted to
paddle down the river, w
here's the
best place to launch o
ut of?
“Tw
enty
years
fro
m n
ow
you w
ill b
e m
ore
dis
apo
inte
d b
y t
he t
hin
gs
you d
idn’t
do
than b
y t
he o
nes
you d
id.”
- M
ark
Tw
ain
you
're staring
at the
sun you're standing in the sea your mouth is open wide yo
u're trying
hard
to breath
e th
e water's at y o
ur n
ec k
T h i s is a song T h i s
is a song T h i s
for those who is a song
for those who is a song
lost their hope a for those who lost their hope a for those who
long a long time agolost their hope a long a long time agolost their hope a
I know someday that you long a long time agoI know someday that you long a long time ago
will find it somehow I know someday that you will find it somehow I know someday that you
Because you're not too oldwill find it somehow Because you're not too oldwill find it somehow
to accomplish goals and all the Because you're not too oldto accomplish goals and all the Because you're not too old
answers are within your soul its up to to accomplish goals and all the answers are within your soul its up to to accomplish goals and all the
you, you gotta figure it out Uh huhanswers are within your soul its up to you, you gotta figure it out Uh huhanswers are within your soul its up to
Whether you want love or money Good you, you gotta figure it out Uh huhWhether you want love or money Good you, you gotta figure it out Uh huh
fortune or fame You want a brand new card Whether you want love or money Good fortune or fame You want a brand new card Whether you want love or money Good
You want the world to change You better take fortune or fame You want a brand new card You want the world to change You better take fortune or fame You want a brand new card
some action right now, oh yes Because there's You want the world to change You better take some action right now, oh yes Because there's You want the world to change You better take
nothing in the world that you can't get So don't fill some action right now, oh yes Because there's nothing in the world that you can't get So don't fill some action right now, oh yes Because there's
your life with confusion and regret You better take nothing in the world that you can't get So don't fill your life with confusion and regret You better take nothing in the world that you can't get So don't fill
some chances right nowyour life with confusion and regret You better take some chances right nowyour life with confusion and regret You better take
Well you can gain the world but for the price of your soul some chances right nowWell you can gain the world but for the price of your soul some chances right now
yes I know, well I know, yes I know you can gain the world for Well you can gain the world but for the price of your soul yes I know, well I know, yes I know you can gain the world for Well you can gain the world but for the price of your soul the price of your soul but I hope you take the road less traveled yes I know, well I know, yes I know you can gain the world for the price of your soul but I hope you take the road less traveled yes I know, well I know, yes I know you can gain the world for and I hope you find the courage to grow well I hope you find the the price of your soul but I hope you take the road less traveled and I hope you find the courage to grow well I hope you find the the price of your soul but I hope you take the road less traveled courage to grow and I hope you find the courage to grow well I hope you find the courage to grow and I hope you find the courage to grow well I hope you find the
So now you're 45 and you realize just what you
b
So now you're 45 and you realize just what you
b
and I hope you find the courage to grow well I hope you find the So now you're 45 and you realize just what you
and I hope you find the courage to grow well I hope you find the wanna do with your life just took some time for you to figure it courage to grow wanna do with your life just took some time for you to figure it courage to grow So now you're 45 and you realize just what you wanna do with your life just took some time for you to figure it
So now you're 45 and you realize just what you
out Cause everyone one of us Has a purpose here Sometimes its wanna do with your life just took some time for you to figure it out Cause everyone one of us Has a purpose here Sometimes its wanna do with your life just took some time for you to figure it
hidden underneath your fear Just takes some time for the truth to
t
hidden underneath your fear Just takes some time for the truth to
t
out Cause everyone one of us Has a purpose here Sometimes its hidden underneath your fear Just takes some time for the truth to out Cause everyone one of us Has a purpose here Sometimes its
come out So whether you want love or money Good fortune or fame hidden underneath your fear Just takes some time for the truth to come out So whether you want love or money Good fortune or fame hidden underneath your fear Just takes some time for the truth to
You want a brand new card You want the world to change You better come out So whether you want love or money Good fortune or fame You want a brand new card You want the world to change You better come out So whether you want love or money Good fortune or fame
take some action right now, oh yes Because there's nothing in the
l
take some action right now, oh yes Because there's nothing in the
l
You want a brand new card You want the world to change You better take some action right now, oh yes Because there's nothing in the You want a brand new card You want the world to change You better
world that you can't get So don't fill your life with confusion and regret take some action right now, oh yes Because there's nothing in the world that you can't get So don't fill your life with confusion and regret take some action right now, oh yes Because there's nothing in the
You better take some chances right nowworld that you can't get So don't fill your life with confusion and regret You better take some chances right nowworld that you can't get So don't fill your life with confusion and regret
Well you can gain the world but for the price of your soul yes I know, well I know, You better take some chances right now
Well you can gain the world but for the price of your soul yes I know, well I know, You better take some chances right now
yes I know you can gain the Well you can gain the world but for the price of your soul yes I know, well I know,
yes I know you can gain the Well you can gain the world but for the price of your soul yes I know, well I know,
world for the price of your soul but I Well you can gain the world but for the price of your soul yes I know, well I know,
world for the price of your soul but I Well you can gain the world but for the price of your soul yes I know, well I know,
hope you take the yes I know you can gain the
hope you take the yes I know you can gain the
road less traveled and I hope you
c
road less traveled and I hope you
c
croad less traveled and I hope you chroad less traveled and I hope you hworld for the price of your soul but I
road less traveled and I hope you world for the price of your soul but I
find the hope you take the
find the hope you take the
courage to grow well I road less traveled and I hope you
courage to grow well I road less traveled and I hope you
hope you find the
hope you find the
find the courage to courage to grow well I
find the courage to courage to grow well I
grow find the courage to
grow find the courage to
courage to find the courage to
courage to find the courage to
grow courage to grow find the courage to
grow find the courage to
courage to find the courage to
grow find the courage to
growcourage to growcourage to -Rebelution
grow-Rebelution
grow
Columbia
W e a r
w h a t
makes you
feel like you.
Comfort and Style.
Jean Fridays. Rep your
team. Music Tees. What�s an
tteam. Music Tees. What�s an
tIron. Outlet. SEVENTY DEGREES
FARENHEIT. t FARENHEIT. t Wear what makes you feel
tmakes you feel
tlike you. Comfort
hlike you. Comfort
hand Style. Jean
Fridays. Rep your team. Music Tees.
What�s an Iron. Outlet. SEVENTY
D E G R E E S n D E G R E E S nF A R E N H E I T . W e a r
what makes y what makes y y o u feel like you. y feel like you. y
Comfort and S t y l e . Jean Fridays. Rep y o u r
team. Music Tees. What�s an Iron. ' What�s an Iron. ' team. Music Tees. What�s an Iron.
team. Music Tees.
Outlet. SEVENTY DEGREES FARENHEIT. Wear w h a t
makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.
SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s
an Iron. Outlet. SEVENTY DEGREES FARENHEIT. W e a r Music Tees. What�s
W e a r Music Tees. What�s
what makes you feel like an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
what makes you feel like an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
y o u . W e a r
y o u . W e a r
Comfort and Style. Jean what makes you feel like
Comfort and Style. Jean what makes you feel like
Fridays. Rep y o u .
Fridays. Rep y o u .
your team. Music Tees. What�s Comfort and Style. Jean
your team. Music Tees. What�s Comfort and Style. Jean
an Iron. Outlet. Fridays. Rep
an Iron. Outlet. Fridays. Rep
SEVENTY DEGREES FARENHEIT. your team. Music Tees. What�s
SEVENTY DEGREES FARENHEIT. your team. Music Tees. What�s
Wear what Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes hWear what makes hmakes you feel like you. Comfort and Style. Jean Wear what makes makes you feel like you. Comfort and Style. Jean hmakes you feel like you. Comfort and Style. Jean hWear what makes hmakes you feel like you. Comfort and Style. Jean h
you feel like you. Comfort and Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. you feel like you. Comfort and Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Style. Jean Fridays. Rep tStyle. Jean Fridays. Rep tWear what makes Style. Jean Fridays. Rep Wear what makes tWear what makes tStyle. Jean Fridays. Rep tWear what makes t
your team. Music Tees. What�s an you feel like you. Comfort and your team. Music Tees. What�s an you feel like you. Comfort and Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. you feel like you. Comfort and Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
your team. Music Tees. What�s an Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. you feel like you. Comfort and Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
Iron. Outlet. SEVENTY
t
Iron. Outlet. SEVENTY
tStyle. Jean Fridays. Rep Iron. Outlet. SEVENTY Style. Jean Fridays. Rep tStyle. Jean Fridays. Rep t
Iron. Outlet. SEVENTY
tStyle. Jean Fridays. Rep t
DEGREES FARENHEIT. your team. Music Tees. What�s an DEGREES FARENHEIT. your team. Music Tees. What�s an Wear what makes you feel
your team. Music Tees. What�s an Wear what makes you feel
your team. Music Tees. What�s an like you. Comfort and Style. Jean Fridays.
Iron. Outlet. SEVENTY like you. Comfort and Style. Jean Fridays.
Iron. Outlet. SEVENTY Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES
DEGREES FARENHEIT. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES
DEGREES FARENHEIT. Wear what makes you feel Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES
Wear what makes you feel FARENHEIT.
like you. Comfort and Style. Jean Fridays. FARENHEIT.
like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. bWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. bMusic Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. bWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. btWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. t
Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. bMusic Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. bWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. bMusic Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. b
SEVENTY DEGREES FARENHEIT. hSEVENTY DEGREES FARENHEIT. hWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.
Wear what Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.
Wear what Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.
makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes h makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes hemakes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes eSEVENTY DEGREES FARENHEIT.
makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes SEVENTY DEGREES FARENHEIT. hSEVENTY DEGREES FARENHEIT. h makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes hSEVENTY DEGREES FARENHEIT. h Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what
makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes Wear what
you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you e you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you emakes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you
makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. sfeel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. syou feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Is you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iseyou feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iefeel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Ifeel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. ron. Outlefeel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. ron. Outlefeel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t. SEVENTY DEGREES ht. SEVENTY DEGREES h
feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t. SEVENTY DEGREES feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes t. SEVENTY DEGREES Wear what makes FARENHEIT. e FARENHEIT. eaFARENHEIT. a
you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an IFARENHEIT. you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an IWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY hWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY hWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY
you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an IWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY
you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. OutleWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY
ron. Outlet. SEVENTY DEGREES Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY
t. SEVENTY DEGREES ht. SEVENTY DEGREES hWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY ht. SEVENTY DEGREES hDEGREES a DEGREES aFARENHEIT. DEGREES
FARENHEIT. FARENHE
FARENHEIT. FARENHE
FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY FARENHE
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY IT.
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an I
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an I
Wear what makes you feel like you. Comfort and Style. Jean Fridays. you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an I
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outle
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY ron. Outle
Wear what makes you feel like you. Comfort and Style. Jean Fridays. ron. Outle
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY ron. Outlet. SEVENTY DEGREES
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY t. SEVENTY DEGREES
Wear what makes you feel like you. Comfort and Style. Jean Fridays. t. SEVENTY DEGREES
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY t. SEVENTY DEGREES
Rep your team. Music Tees. yRep your team. Music Tees. yFARENHEIT.
Rep your team. Music Tees. FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY
Rep your team. Music Tees. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY
DEGREES Rep your team. Music Tees. DEGREES FARENHEIT.
DEGREES FARENHEIT.
Rep your team. Music Tees. FARENHEIT.
DEGREES FARENHEIT.
FARENHERep your team. Music Tees. FARENHEFARENHEIT.
FARENHEFARENHEIT.
Rep your team. Music Tees. FARENHEIT.
FARENHEFARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY
FARENHEWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY
Rep your team. Music Tees. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY
FARENHEWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY
IT. Rep your team. Music Tees. IT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY
IT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY
Rep your team. Music Tees. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY
IT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY
Rep your team. Music Tees. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY
WhaWear what makes you feel like you. Comfort and Style. Jean Fridays. WhaWear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wha
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. WhaWear what makes you feel like you. Comfort and Style. Jean Fridays. WhaWear what makes you feel like you. Comfort and Style. Jean Fridays. t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. WhaWear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wha
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wha
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and Style. Jean Fridays. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your oWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your oRep your team. Music Tees.
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your Rep your team. Music Tees. Wha
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wha
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wha
team. Music Tees.t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
team. Music Tees.t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
What�s an Iron. Outlet. SEVENTY DEGREES t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
What�s an Iron. Outlet. SEVENTY DEGREES t�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your
FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Wear what makes
What�s an Iron. Outlet. SEVENTY DEGREES Wear what makes
What�s an Iron. Outlet. SEVENTY DEGREES an Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes an Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.
you feel likFARENHEIT.
you feel likFARENHEIT. Wear what makes y
you feel likWear what makes you feel like you. Comfort and Style. Je
you feel likou feel like you. Comfort and Style. Je
What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.you feel likWhat�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.e you. Comfort and Style. Jean Fridays. Rep your team. Music ou feel like you. Comfort and Style. Je
e you. Comfort and Style. Jean Fridays. Rep your team. Music ou feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.
e you. Comfort and Style. Jean Fridays. Rep your team. Music an Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.
What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.e you. Comfort and Style. Jean Fridays. Rep your team. Music What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your teame you. Comfort and Style. Jean Fridays. Rep your team. Music Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. e you. Comfort and Style. Jean Fridays. Rep your team. Music . Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes e you. Comfort and Style. Jean Fridays. Rep your team. Music Wear what makes an Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes an Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.
e you. Comfort and Style. Jean Fridays. Rep your team. Music an Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes an Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.
Tees. What�s an Iron. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.
Tees. What�s an Iron. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.you feel likTees. What�s an Iron. you feel likWhat�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.you feel likWhat�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.
Tees. What�s an Iron. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.you feel likWhat�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.e you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. e you. Comfort and Style. Jean Fridays. Rep your team. Music What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.e you. Comfort and Style. Jean Fridays. Rep your team. Music What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.
Tees. What�s an Iron. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.e you. Comfort and Style. Jean Fridays. Rep your team. Music What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.
Outlet. SEVENTe you. Comfort and Style. Jean Fridays. Rep your team. Music Outlet. SEVENTe you. Comfort and Style. Jean Fridays. Rep your team. Music What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.e you. Comfort and Style. Jean Fridays. Rep your team. Music What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.
Outlet. SEVENTWhat�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style.e you. Comfort and Style. Jean Fridays. Rep your team. Music What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your teame you. Comfort and Style. Jean Fridays. Rep your team. Music Jean Fridays. Rep your team
Outlet. SEVENT Jean Fridays. Rep your teame you. Comfort and Style. Jean Fridays. Rep your team. Music Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. e you. Comfort and Style. Jean Fridays. Rep your team. Music . Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
Outlet. SEVENT. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. e you. Comfort and Style. Jean Fridays. Rep your team. Music . Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
Y DEGREES FARENHEIT. Wear e you. Comfort and Style. Jean Fridays. Rep your team. Music Y DEGREES FARENHEIT. Wear e you. Comfort and Style. Jean Fridays. Rep your team. Music . Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. e you. Comfort and Style. Jean Fridays. Rep your team. Music . Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
Y DEGREES FARENHEIT. Wear . Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. e you. Comfort and Style. Jean Fridays. Rep your team. Music . Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes e you. Comfort and Style. Jean Fridays. Rep your team. Music Wear what makes
Y DEGREES FARENHEIT. Wear Wear what makes e you. Comfort and Style. Jean Fridays. Rep your team. Music Wear what makes
what e you. Comfort and Style. Jean Fridays. Rep your team. Music what e you. Comfort and Style. Jean Fridays. Rep your team. Music Wear what makes e you. Comfort and Style. Jean Fridays. Rep your team. Music Wear what makes what
Wear what makes e you. Comfort and Style. Jean Fridays. Rep your team. Music Wear what makes makes youTees. What�s an Iron. makes youTees. What�s an Iron. you feel likTees. What�s an Iron. you feel likmakes you
you feel likTees. What�s an Iron. you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. e you. Comfort and Style. Jean Fridays. Rep your team. Music makes you
e you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. e you. Comfort and Style. Jean Fridays. Rep your team. Music feel like you. Comfor
e you. Comfort and Style. Jean Fridays. Rep your team. Music feel like you. Comfor
e you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. feel like you. ComforTees. What�s an Iron. e you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. e you. Comfort and Style. Jean Fridays. Rep your team. Music feel like you. Comfor
e you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. e you. Comfort and Style. Jean Fridays. Rep your team. Music Outlet. SEVENT feel like you. ComforOutlet. SEVENTe you. Comfort and Style. Jean Fridays. Rep your team. Music Outlet. SEVENTe you. Comfort and Style. Jean Fridays. Rep your team. Music feel like you. Comfor
e you. Comfort and Style. Jean Fridays. Rep your team. Music Outlet. SEVENTe you. Comfort and Style. Jean Fridays. Rep your team. Music t and Style. Jean Fridays. Rep your team. Music Tees. Outlet. SEVENTt and Style. Jean Fridays. Rep your team. Music Tees. Outlet. SEVENTY DEGREES FARENHEIT. Wear t and Style. Jean Fridays. Rep your team. Music Tees. Y DEGREES FARENHEIT. Wear what t and Style. Jean Fridays. Rep your team. Music Tees. what
What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. makes youWhat�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. makes you feel like you. ComforWhat�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you.
Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES
d
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES
dFARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t Wear what makes you feel like you. dWear what makes you feel like you. d
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES Wear what makes you feel like you.
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES
Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. thComfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h
FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. t Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
Wear what makes you feel like you. Wear
what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h Wear what makes you feel Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear Wear what makes you feel Wear
like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. h like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. h like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. h what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes you feel What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. i What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. i like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes you feel
What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes you feel
Wear what makes you feel like like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.
Wear what makes you feel like like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.
you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES i you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES is you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES sWhat�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES
What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. i What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. i you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES i What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. i Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES
Wear what makes you feel like FARENHEIT. s FARENHEIT. s you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES Wear what you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES
makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music FARENHEIT. makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Wear what Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. o Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. o makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
Wear what makes you feel like you. Wear what
Wear what makes you feel like you. Wear what
Wear what makes you feel like you.
makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. p makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. p Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron.
Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron.
Wear what Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean e Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean emakes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean
makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear e Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear e Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear
Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.
Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.
Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes you feel like what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. Wear what makes you feel like what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s Wear what makes you feel like
an Iron. Outlet. SEVENTY DEGREES FARENHEIT. you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s Wear what makes you feel like you.
you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s Wear what makes you feel like you.
you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.
h
Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.
hiComfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. iComfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.
an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.
an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.
Wear what makes you feel like you. SEVENTY DEGREES FARENHEIT. d SEVENTY DEGREES FARENHEIT. d
Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. Wear what makes you feel like hWear what makes you feel like h
Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. Wear what makes you feel like Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
Wear what makes you feel like an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you.
Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. Wear what makes you feel like you.
Wear what makes you feel like Wear what makes you feel like you.
Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. Wear what makes you feel like you.
you. Comfort and Style. Jean Fridays. Rep your tyou. Comfort and Style. Jean Fridays. Rep your tyou. Comfort and Style. Jean Fridays. Rep your d you. Comfort and Style. Jean Fridays. Rep your d you. Comfort and Style. Jean Fridays. Rep your Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.
you. Comfort and Style. Jean Fridays. Rep your Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.
SEVENTY DEGREES FARENHEIT. you. Comfort and Style. Jean Fridays. Rep your SEVENTY DEGREES FARENHEIT. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.
SEVENTY DEGREES FARENHEIT. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.
you. Comfort and Style. Jean Fridays. Rep your Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.
SEVENTY DEGREES FARENHEIT. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your Wear what makes you feel like Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. Wear what makes you feel like Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.
you. Comfort and Style. Jean Fridays. Rep your Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. Wear what makes you feel like Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet.
team. Music Tees. What�s an Iron. Outlet. you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. you. Comfort and Style. Jean Fridays. Rep your SEVENTY DEGREES FARENHEIT. you. Comfort and Style. Jean Fridays. Rep your SEVENTY DEGREES FARENHEIT. team. Music Tees. What�s an Iron. Outlet.
SEVENTY DEGREES FARENHEIT. you. Comfort and Style. Jean Fridays. Rep your SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your Wear what makes you feel like team. Music Tees. What�s an Iron. Outlet.
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your Wear what makes you feel like SEVENTY DEGREES FARENHEIT. team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. team. Music Tees. What�s an Iron. Outlet. you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. you. Comfort and Style. Jean Fridays. Rep your SEVENTY DEGREES FARENHEIT.
you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. you. Comfort and Style. Jean Fridays. Rep your Wear what makes you feel like
team. Music Tees. What�s an Iron. Outlet. Wear what makes you feel like
team. Music Tees. What�s an Iron. Outlet. you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an
SEVENTY DEGREES FARENHEIT. you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an
SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an
Wear what makes you feel like Iron. Outlet. SEVENTY DEGREES FARENHEIT.
you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep
your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you
Iron. Outlet. SEVENTY DEGREES FARENHEIT.Wear what makes you
Iron. Outlet. SEVENTY DEGREES FARENHEIT.Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep
Wear what makes you Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep
your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your Wear what makes you your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your
feel like you. Comfort and Style. Jean your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your
feel like you. Comfort and Style. Jean your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your
team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. feel like you. Comfort and Style. Jean team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Wear what makes you your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your Wear what makes you your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your
feel like you. Comfort and Style. Jean your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your Wear what makes you your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your
Fridays. Rep your team. Music Tees. feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. feel like you. Comfort and Style. Jean team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. feel like you. Comfort and Style. Jean team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
Fridays. Rep your team. Music Tees. team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. feel like you. Comfort and Style. Jean team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Wear what makes you
Fridays. Rep your team. Music Tees. Wear what makes you feel like you. Comfort and Style. Jean Wear what makes you
What�s an Iron. Outlet. SEVENTY DEGREES Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES Fridays. Rep your team. Music Tees. feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. feel like you. Comfort and Style. Jean What�s an Iron. Outlet. SEVENTY DEGREES
feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. feel like you. Comfort and Style. Jean FARENHEIT. Wear what makes you feel like bFARENHEIT. Wear what makes you feel like bFARENHEIT. Wear what makes you feel like What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like What�s an Iron. Outlet. SEVENTY DEGREES Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES Fridays. Rep your team. Music Tees. FARENHEIT. Wear what makes you feel like
Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES Fridays. Rep your team. Music Tees. you. ComforFARENHEIT. Wear what makes you feel like you. ComforFARENHEIT. Wear what makes you feel like What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like What�s an Iron. Outlet. SEVENTY DEGREES you. Comfor
What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like What�s an Iron. Outlet. SEVENTY DEGREES t and Style. Jean Fridays. Rep your team. bt and Style. Jean Fridays. Rep your team. bFARENHEIT. Wear what makes you feel like t and Style. Jean Fridays. Rep your team. FARENHEIT. Wear what makes you feel like bFARENHEIT. Wear what makes you feel like bt and Style. Jean Fridays. Rep your team. bFARENHEIT. Wear what makes you feel like bMusic Tees. What�s an Iron. Outlet. SEVENTY DEGREES you. ComforMusic Tees. What�s an Iron. Outlet. SEVENTY DEGREES you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES t and Style. Jean Fridays. Rep your team. bt and Style. Jean Fridays. Rep your team. bMusic Tees. What�s an Iron. Outlet. SEVENTY DEGREES bt and Style. Jean Fridays. Rep your team. b
FARENHEIT. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. dWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. ddOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s dOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s
an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel dWear what makes you feel dWear what makes you feel dWear what makes you feel dWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron.
Wear what makes you feel Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. dWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. dWear what makes you feel dWear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. dOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s Wear what makes you feel Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s dOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s dWear what makes you feel dOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s dlike you. Comfort and Style. Jean
Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s
like you. Comfort and Style. Jean Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s
an Iron. Outlet. SEVENTY DEGREES FARENHEIT. like you. Comfort and Style. Jean an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Wear what makes you feel dWear what makes you feel dlike you. Comfort and Style. Jean dWear what makes you feel dOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s Wear what makes you feel Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s
like you. Comfort and Style. Jean Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s Wear what makes you feel Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s dOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s dWear what makes you feel dOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s dlike you. Comfort and Style. Jean dOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s dWear what makes you feel dOutlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s d
Fridays. Rep your team. Music Tees. tFridays. Rep your team. Music Tees. tFridays. Rep your team. Music Tees. like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. like you. Comfort and Style. Jean an Iron. Outlet. SEVENTY DEGREES FARENHEIT. like you. Comfort and Style. Jean an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
Fridays. Rep your team. Music Tees. an Iron. Outlet. SEVENTY DEGREES FARENHEIT. like you. Comfort and Style. Jean an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Wear what makes you feel
Fridays. Rep your team. Music Tees. Wear what makes you feel like you. Comfort and Style. Jean Wear what makes you feel
What�s an Iron. Outlet. SEVENTY tWhat�s an Iron. Outlet. SEVENTY tWhat�s an Iron. Outlet. SEVENTY Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Fridays. Rep your team. Music Tees. like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. like you. Comfort and Style. Jean What�s an Iron. Outlet. SEVENTY
like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. like you. Comfort and Style. Jean DEGREES FARENHEIT. Wear what i DEGREES FARENHEIT. Wear what i What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what What�s an Iron. Outlet. SEVENTY Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Fridays. Rep your team. Music Tees. DEGREES FARENHEIT. Wear what
Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Fridays. Rep your team. Music Tees. makes you feel like you. ComforDEGREES FARENHEIT. Wear what makes you feel like you. ComforDEGREES FARENHEIT. Wear what i DEGREES FARENHEIT. Wear what i makes you feel like you. Comfori DEGREES FARENHEIT. Wear what i What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what What�s an Iron. Outlet. SEVENTY makes you feel like you. Comfor
What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what What�s an Iron. Outlet. SEVENTY t and DEGREES FARENHEIT. Wear what t and DEGREES FARENHEIT. Wear what
Style. Jean Fridays. Rep your team. Music Tees. n Style. Jean Fridays. Rep your team. Music Tees. n makes you feel like you. ComforStyle. Jean Fridays. Rep your team. Music Tees. makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. t and What�s an Iron. Outlet. SEVENTY DEGREES g What�s an Iron. Outlet. SEVENTY DEGREES g Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES Style. Jean Fridays. Rep your team. Music Tees. FARENHEIT.
g
FARENHEIT.
g What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. What�s an Iron. Outlet. SEVENTY DEGREES g What�s an Iron. Outlet. SEVENTY DEGREES g
FARENHEIT.
g What�s an Iron. Outlet. SEVENTY DEGREES g
Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep
your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h Wear what Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.
Wear what Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees.
What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep Wear what What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep
makes you feel like you. Comfort h makes you feel like you. Comfort h makes you feel like you. Comfort What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep
makes you feel like you. Comfort What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep
your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. makes you feel like you. Comfort your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h makes you feel like you. Comfort h your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h Wear what makes you feel like you. Comfort Wear what What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep Wear what What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep
makes you feel like you. Comfort What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep Wear what What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep
and Style. Jean Fridays. Rep your a and Style. Jean Fridays. Rep your a makes you feel like you. Comfort and Style. Jean Fridays. Rep your makes you feel like you. Comfort h makes you feel like you. Comfort h
and Style. Jean Fridays. Rep your
h makes you feel like you. Comfort h your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. makes you feel like you. Comfort your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
and Style. Jean Fridays. Rep your your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. makes you feel like you. Comfort your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h makes you feel like you. Comfort h your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h
and Style. Jean Fridays. Rep your
h your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h makes you feel like you. Comfort h your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. h Wear what makes you feel like you. Comfort Wear what and Style. Jean Fridays. Rep your
Wear what makes you feel like you. Comfort Wear what team. Music Tees. What�s an Iron. iteam. Music Tees. What�s an Iron. iteam. Music Tees. What�s an Iron. and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. and Style. Jean Fridays. Rep your makes you feel like you. Comfort and Style. Jean Fridays. Rep your makes you feel like you. Comfort team. Music Tees. What�s an Iron.
makes you feel like you. Comfort and Style. Jean Fridays. Rep your makes you feel like you. Comfort h makes you feel like you. Comfort h
and Style. Jean Fridays. Rep your
h makes you feel like you. Comfort h
team. Music Tees. What�s an Iron.
h makes you feel like you. Comfort h
and Style. Jean Fridays. Rep your
h makes you feel like you. Comfort h
Outlet. SEVENTY DEGREES dOutlet. SEVENTY DEGREES dOutlet. SEVENTY DEGREES team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES team. Music Tees. What�s an Iron. iteam. Music Tees. What�s an Iron. iOutlet. SEVENTY DEGREES iteam. Music Tees. What�s an Iron. iand Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. and Style. Jean Fridays. Rep your Outlet. SEVENTY DEGREES
and Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. and Style. Jean Fridays. Rep your FARENHEIT. Wear what makes dFARENHEIT. Wear what makes dFARENHEIT. Wear what makes d FARENHEIT. Wear what makes d Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes Outlet. SEVENTY DEGREES dOutlet. SEVENTY DEGREES dFARENHEIT. Wear what makes dOutlet. SEVENTY DEGREES d
team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES team. Music Tees. What�s an Iron. FARENHEIT. Wear what makes
team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES team. Music Tees. What�s an Iron. you feel like you. Comford you feel like you. Comford FARENHEIT. Wear what makes you feel like you. ComforFARENHEIT. Wear what makes d FARENHEIT. Wear what makes d you feel like you. Comford FARENHEIT. Wear what makes d Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes Outlet. SEVENTY DEGREES you feel like you. Comfor
Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes Outlet. SEVENTY DEGREES t and FARENHEIT. Wear what makes t and FARENHEIT. Wear what makes dFARENHEIT. Wear what makes dt and dFARENHEIT. Wear what makes d
Style. Jean Fridays. Rep your team. Music
d
Style. Jean Fridays. Rep your team. Music
d you feel like you. ComforStyle. Jean Fridays. Rep your team. Music you feel like you. Comford you feel like you. Comford
Style. Jean Fridays. Rep your team. Music
d you feel like you. Comford t and Style. Jean Fridays. Rep your team. Music t and Tees. What�s an Iron. Outlet. SEVENTY t Tees. What�s an Iron. Outlet. SEVENTY t Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY Style. Jean Fridays. Rep your team. Music
DEGREES FARENHEIT. t DEGREES FARENHEIT. t Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Tees. What�s an Iron. Outlet. SEVENTY Wear what makes you feel like you. Comfort and
Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team.
Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. b Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. b Wear Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES
Wear Style. Jean Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES
FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Wear FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team.
what makes you feel like b what makes you feel like b what makes you feel like FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team.
what makes you feel like FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team.
Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. what makes you feel like Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. b Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. b what makes you feel like b Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. b Wear what makes you feel like Wear FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Wear FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team.
what makes you feel like FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Wear FARENHEIT. Wear what makes you feel like you. Comfort and Style. Jean Fridays. Rep your team.
you. Comfort and Style.
b
you. Comfort and Style.
b what makes you feel like you. Comfort and Style. what makes you feel like b what makes you feel like b
you. Comfort and Style.
b what makes you feel like b Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. what makes you feel like Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT.
you. Comfort and Style. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. what makes you feel like Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what makes you feel like Wear
you. Comfort and Style. Wear what makes you feel like Wear
Jean Fridays. Rep your you. Comfort and Style. Jean Fridays. Rep your you. Comfort and Style. what makes you feel like you. Comfort and Style. what makes you feel like Jean Fridays. Rep your
what makes you feel like you. Comfort and Style. what makes you feel like team. Music Tees. Jean Fridays. Rep your team. Music Tees. Jean Fridays. Rep your you. Comfort and Style. Jean Fridays. Rep your you. Comfort and Style. team. Music Tees.
you. Comfort and Style. Jean Fridays. Rep your you. Comfort and Style. What�s an Iron. team. Music Tees. What�s an Iron. team. Music Tees. Jean Fridays. Rep your team. Music Tees. Jean Fridays. Rep your What�s an Iron.
Jean Fridays. Rep your team. Music Tees. Jean Fridays. Rep your Outlet. SEVENTY What�s an Iron. Outlet. SEVENTY What�s an Iron. team. Music Tees. What�s an Iron. team. Music Tees. Outlet. SEVENTY
team. Music Tees. What�s an Iron. team. Music Tees. DEGREES FARENHEIT. t DEGREES FARENHEIT. t Outlet. SEVENTY DEGREES FARENHEIT. Outlet. SEVENTY What�s an Iron. Outlet. SEVENTY What�s an Iron. DEGREES FARENHEIT.
What�s an Iron. Outlet. SEVENTY What�s an Iron. Wear what makes lWear what makes lWear what makes t Wear what makes t DEGREES FARENHEIT. Wear what makes DEGREES FARENHEIT. t DEGREES FARENHEIT. t Wear what makes t DEGREES FARENHEIT. t Outlet. SEVENTY DEGREES FARENHEIT. Outlet. SEVENTY Wear what makes
Outlet. SEVENTY DEGREES FARENHEIT. Outlet. SEVENTY you feel like you. h you feel like you. h Wear what makes you feel like you. Wear what makes DEGREES FARENHEIT. Wear what makes DEGREES FARENHEIT. you feel like you.
DEGREES FARENHEIT. Wear what makes DEGREES FARENHEIT. Comforh Comforh you feel like you. Comforyou feel like you. h you feel like you. h Comforh you feel like you. h Wear what makes you feel like you. Wear what makes Comfor
Wear what makes you feel like you. Wear what makes t and Style. you feel like you. t and Style. you feel like you.
Jean Fridays. Rep your ComforJean Fridays. Rep your Comfort and Style. Jean Fridays. Rep your t and Style. team. Music Tees. What�s Jean Fridays. Rep your team. Music Tees. What�s Jean Fridays. Rep your an Iron. Outlet. SEVENTY team. Music Tees. What�s an Iron. Outlet. SEVENTY team. Music Tees. What�s DEGREES FARENHEIT. an Iron. Outlet. SEVENTY DEGREES FARENHEIT. an Iron. Outlet. SEVENTY
Wear what makes you feel like you. Comfort and Style. Jean
Fridays. Rep your team. Music Tees. What�s an Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what
makes you feel like you. Comfort and Style. Jean Fridays. Rep your team. Music Tees. What�s an
Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what Fridays. Rep your team. Music Tees. What�s an
Wear what Fridays. Rep your team. Music Tees. What�s an
Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what Iron. Outlet. SEVENTY DEGREES FARENHEIT.
makes you wmakes you wmakes you Wear what makes you Wear what Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what Iron. Outlet. SEVENTY DEGREES FARENHEIT.
makes you Iron. Outlet. SEVENTY DEGREES FARENHEIT. Wear what Iron. Outlet. SEVENTY DEGREES FARENHEIT.
feel like ofeel like ofeel like makes you feel like makes you Wear what makes you Wear what feel like
Wear what makes you Wear what y o u . oy o u . oy o u . t y o u . t feel like y o u . feel like makes you feel like makes you y o u .
makes you feel like makes you C o m f o r t nC o m f o r t nC o m f o r t t C o m f o r t t y o u . C o m f o r t y o u . t y o u . t C o m f o r t t y o u . t feel like y o u . feel like C o m f o r t
feel like y o u . feel like a n d na n d na n d C o m f o r t a n d C o m f o r t y o u . C o m f o r t y o u . a n d
y o u . C o m f o r t y o u . S t y l e . a n d S t y l e . a n d C o m f o r t a n d C o m f o r t S t y l e .
C o m f o r t a n d C o m f o r t J e a n ' J e a n ' S t y l e . J e a n S t y l e . a n d S t y l e . a n d J e a n
a n d S t y l e . a n d F r i d aJ e a n F r i d aJ e a n S t y l e . J e a n S t y l e . F r i d a
S t y l e . J e a n S t y l e . y s . F r i d ay s . F r i d aJ e a n F r i d aJ e a n y s .
J e a n F r i d aJ e a n R e p y s . R e p y s . F r i d ay s . F r i d aR e p
F r i d ay s . F r i d ay oR e p y oR e p y s . R e p y s . y o
y s . R e p y s . u r y ou r y oR e p y oR e p u r
R e p y oR e p tu r tu r y ou r y ot
y ou r y o
Seaming
together what seems to See the seemlessly seaming Seamss
ssss
ss
City Scape City Scape City Scape City Scape
City Scape City Scape City Scape City Scape City Scape City Scape City Scape
City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City
Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City
Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City
Scape City Scape City Scape City Scape City Scape City Scape City Scape City
Scape City Scape City Scape City Scape City Scape City Scape City
Scape City Scape City Scape City Scape City Scape City Scape City
Scape City Scape City Scape City Scape City Scape City Scape
City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City
Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City Scape City
Scape City Sc
Nin
tttteen
ddo ApApA pppp lelel N64 FiFiFnal Cut
AaB
bCcD
dEeF
fGgH
hIiJjK
kLlMmNnOoPpQqRrSsTtUuVvWwXxYyZzAaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSs
Visual. Glasses. Frame your life. OPTICS. simplicity
.
saf kfjbwk lkmok
fbkwbe fnwcon aksmcl kfjbwk lkmok
fbkwbe fnwcon aksmcl kfjbwk lkmok
akmsc sakfjbw kfbkwb efnwco naks mclakmsc
akmsc sakfjbw kfbkwb efnwco naks mclakmsc
akmsc sakfjbw kfbkwb
sakfjbwk fbkw be fnwcon aksmcl akmsc sakfjb fssddsw
sakfjbwk fbkw be fnwcon aksmcl akmsc sakfjb fssddsw
sakfjbwk fbkw be fnwcon
kfbkwbaksmcl akmsc sakfjb fssddsw kfbkwb
aksmcl akmsc sakfjb fssddsw efnwco naks mclakmsc
aksmcl akmsc sakfjb fssddsw efnwco naks mclakmsc
aksmcl akmsc sakfjb fssddsw
sakfjbwk fbkwbe fnwcon aksmcl akmssakfjakmssakfj
c sakfjbw kfbkwb efnw sdbco naksec
c sakfjbw kfbkwb efnw sdbco naksec
c sakfjbw kfbkwb efnw sdbco v mclakmsc sakfjbw kjdfk
c sakfjbw kfbkwb efnw sdbco v mclakmsc sakfjbw kjdfk
c sakfjbw kfbkwb efnw sdbco
fbkwbe fv mclakmsc sakfjbw kjdfk
fbkwbe fv mclakmsc sakfjbw kjdfk
nwcon aksmcl akm kjsc v mclakmsc sakfjbw kjdfk
nwcon aksmcl akm kjsc v mclakmsc sakfjbw kjdfk
fbkwbe fnwcon aksmcl akm kjsc fbkwbe fv mclakmsc sakfjbw kjdfk
fbkwbe fv mclakmsc sakfjbw kjdfk
nwcon aksmcl akm kjsc v mclakmsc sakfjbw kjdfk
fbkwbe fv mclakmsc sakfjbw kjdfk
sakfjbw kfbkwb efnwco nak ks nwcon aksmcl akm kjsc
bw kfbkwb efnwco nak ks nwcon aksmcl akm kjsc
mclakmsc sakfjb wkoa panff sakfj
lakmsc sakfjb wkoa panff sakfj
fbkwlakmsc sakfjb wkoa panff
fbkwlakmsc sakfjb wkoa panff
be fnwcon aksm nsofcl lakmsc sakfjb wkoa panff
be fnwcon aksm nsofcl lakmsc sakfjb wkoa panff
akmsc sakfjbw kfbkwb own efnwco n lanaks
sc sakfjbw kfbkwb own efnwco n lanaks
sc sakfjbw kfbkwb
mclakmsc sakfjbwk fbkwbe fnwc nslfon
mclakmsc sakfjbwk fbkwbe fnwc nslfon
mclakmsc sakfjbwk
aksmcl akm basc sakfjb nalfw kfbk pwwb sakfjb nalfw kfbk pwwb sakfjb nalfw
efnw bwco naks cndj mclak msc naks cndj mclak msc naks cndj
sakfjbwk k nldwbe yk nldwbe y
sakfjbwk k nldwbe
sakfjbwk
fnwcon
sakfjbwk fbkw be fnwcon aksmcl akmsc sakfjb fssddsw
sakfjbwk fbkw be fnwcon aksmcl akmsc sakfjb fssddsw
sakfjbwk fbkw be fnwcon
kfbkwbaksmcl akmsc sakfjb fssddsw kfbkwb
aksmcl akmsc sakfjb fssddsw efnwco naks mclakmsc
aksmcl akmsc sakfjb fssddsw efnwco naks mclakmsc
aksmcl akmsc sakfjb fssddsw
sakfjbwk fbkwbe fnwcon aksmcl akmssakfjakmssakfj
c sakfjbw kfbkwb efnw sdbco sakfj
c sakfjbw kfbkwb efnw sdbco sakfj
v mclakmsc sakfjbw kjdfk c sakfjbw kfbkwb efnw sdbco v mclakmsc sakfjbw kjdfk
c sakfjbw kfbkwb efnw sdbco
fbkwbe fnwcon aksmcl akm kjsc v mclakmsc sakfjbw kjdfk
nwcon aksmcl akm kjsc v mclakmsc sakfjbw kjdfk
fbkwbe fnwcon aksmcl akm kjsc fbkwbe fsakfjbw kfbkwb efnwco nak ks
nwcon aksmcl akm kjsc bw kfbkwb efnwco nak ks
nwcon aksmcl akm kjsc
lakmsc sakfjb wkoa panff sakfj
lakmsc sakfjb wkoa panff sakfj
fbkwlakmsc sakfjb wkoa panff
fbkwlakmsc sakfjb wkoa panff
be fnwcon aksm nsofcl lakmsc sakfjb wkoa panff
be fnwcon aksm nsofcl lakmsc sakfjb wkoa panff
akmsc sakfjbw kfbkwb own efnwco n lanaks
sc sakfjbw kfbkwb own efnwco n lanaks
sc sakfjbw kfbkwb
mclakmsc sakfjbwk A
aBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZzAaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvW
wX
-
lakmsc sakfjb wkoa panff
-
lakmsc sakfjb wkoa panff lakmsc sakfjb wkoa panff Slakmsc sakfjb wkoa panff be fnwcon aksm nsofcl
S
be fnwcon aksm nsofcl lakmsc sakfjb wkoa panff
be fnwcon aksm nsofcl lakmsc sakfjb wkoa panff Slakmsc sakfjb wkoa panff
be fnwcon aksm nsofcl lakmsc sakfjb wkoa panff tbe fnwcon aksm nsofcl tbe fnwcon aksm nsofcl
sc sakfjbw kfbkwb
t
sc sakfjbw kfbkwb
a
sc sakfjbw kfbkwb
a
sc sakfjbw kfbkwb sc sakfjbw kfbkwb tsc sakfjbw kfbkwb own efnwco n lanaks
t
own efnwco n lanaks sc sakfjbw kfbkwb
own efnwco n lanaks sc sakfjbw kfbkwb tsc sakfjbw kfbkwb
own efnwco n lanaks sc sakfjbw kfbkwb usc sakfjbw kfbkwb usc sakfjbw kfbkwb
own efnwco n lanaks
u
own efnwco n lanaks sc sakfjbw kfbkwb
own efnwco n lanaks sc sakfjbw kfbkwb usc sakfjbw kfbkwb
own efnwco n lanaks sc sakfjbw kfbkwb sown efnwco n lanaks sown efnwco n lanaks
mclakmsc sakfjbwk
s
mclakmsc sakfjbwk
No rest for the Wicked No rest for the
Wicked No rest for the
Wicked No rest for the Wicked BLACK PLASTIC
Envision theFuture
BLACK PLASTICBLACK PLASTICEnvisiont
BLACK PLASTIC
t
BLACK PLASTIC
tEnvisiontEnvisiont
for the Wicked for the Wicked
ajhdh sdibdcsafwf
ajhdh sdibdcsafwf
ajhdh sdibdcsafd ajhdh sdibdcsaf ajhdh sibdcsaf ajhdh sibdcsafvve ajhdh sibdcsaaca ajhdh sibdcsaacwfw ajhdh sibdcsadvva ajhdh sibdcsevb w ajhdh sibdcs ouavbeer
ajhdh sdibdcsafwf
sdsfv sdvsv wwwdc wcwcsdsfv sdvsv
sdsfv sdvsv wwwdc wcwcsdsfv sdvsv wwwdc
sdsfv sdvsv wwwdc wcwcsdsfv sdvsv wwwdc
sdvsv wwwdc wcwcsdsfv sdvsv wwwdc wcwcsdsfv
sdsfv sdvsv wwwdc wcwcsdsfv sdvsv wwwdc vvwcwcd
sdsf
v sd
vsv w
wwdc wcwcsdsfv sdvsv
sdsfv sdvsv wwwdc wcwcsdsfv sdvsv wwwdc wcwcsdsfv
ajhdh sibdcsascbw ajhdh sibdcs evbw ajhdh sibdcsny�g ajhdhggg osobvb doi ajhdh sibdc eonal ajhdh sibdd sqw ajhdh sibsd oidaonkf
ajhdha ajhdha ajhdha ajhdha
ajhdh sdibdcsafwf
ajhdhsdibdajhdh sdibdcsafwf
ajood axcv ajhdh sdibdcsafwf
KJBWCJKBWCBO ONCW AFW
KJBWCJKBWCBO ONCW AFW
KJBWCJKBWCBO ONCW AFW
ajhdhsdib dcsaf
KJBWCJKBWCBO ONCW AFW
KJBW
CJKBWCBO ONCW AFW
KJBWCJKBWCBO ONCW AFW
ajhdh sdibd
KJBWCJKBWCBO ONCW
AFW
KJBWCJKBW
CBO ONCW
KJBWCJKBWCBO ONCW
AFW
KJBWCJKBW
CBO O
NCW
KJBWCJKBW
CBO O
KJBWCJKBW
CBO O
NCW
KJBWCJKBW
CBO O
NCW
KJBWCJKBW
CBO O
KJBWCJKBW
CBO O
NCW
KJBWCJKBW
CBO O
NCW
KJBWCJKBW
CBO O
KJBWCJKBW
CBO O
NCW
KJBWCJKBW
CBO O
NCW
KJBWCJKBW
CBO O
KJBWCJKBW
CBO O
NCW
KJBWCJKBW
CBO ONCW
KJBWCJKBW
CBO O
KJBWCJKBW
CBO O
NCW
KJBWCJKBW
CBO O
NCW
KJBW
CJKBWCBO
KJBWCJKBW
CBO O
NCW
http://vimeo.com/user4633884http://vimeo.com/user4633884s�fvvvsvsvsv
http://vimeo.com/user4633884http://vimeo.com/user4633884s�fvvvsvsvsvhttp://vimeo.com/user4633884http://vimeo.com/user46338
http://vimeo.com/user4633884http://vimeo.com/user46338http://vimeo.com/user4633884
http://vimeo.com/user4633884
http://vimeo.com/user4633884http://vimeo.com/user46338
http://vimeo.com/user4633884http://vimeo.com/user46338
http://vimeo.com/user4633884http://vimeo.com/user46338
http://vimeo.com/user4633884http://vimeo.com/user46338
http://vimeo.com/user4633884http://vimeo.com/user46338
http://
vimeo.com/user4633884http
://vimeo.com/user4633884s�fvvvsvsvsv
ajhdh sibsd ajhdhdv ajhd
weoicnowinvoinwvoinwoinclks
weoicnowinvoinwvoinw
weoicnowinvoinwvoinwoin
weoicnowinvoinwvoinwoinclksndclknwineoinvonadvnoidnvoineovneoinvoineoivnoienoivneorin
weoicnowinvoinwvoinwoinclks
weoicnowinvoinwvoinw
weoicnowinvoinwvoinwoin
weoicnowinvoinwvoinwoinclksndclknwineoinvonadvnoidnvoineovneoinvoineoivnoienoivneorin
weoicnowinvoinwvoinwoinclks
weoicnowinvoinwvoinw
weoicnowinvoinwvoinwoin
weoicnowinvoinwvoinwoinclksndclknwineoinvonadvnoidnvoineovneoinvoineoivnoienoivneorin
weoicnowinvoinwvoinwoinclks
weoicnowinvoinwvoinw
weoicnowinvoinwvoinwoin
weoicnowinvoinwvoinwoinclksndclknwineoinvonadvnoidnvoineovneoinvoineoivnoienoivneorin
weoicnowinvoinwvoinwoinclks
weoicnowinvoinwvoinw
weoicnowinvoinwvoinwoin
weoicnowinvoinwvoinwoinclksndclknwineoinvonadvnoidnvoineovneoinvoineoivnoienoivneorin
svsv ss sdsdsdddvdvsvsvsss fs fsvfv vfvf sdhdhtdttd
t vsv wwwdc wcwdwdowododwdod owohwhohowohocmcmhchmhmcmhmtctmtmcmtms/s/usudsdsederd r
hdhtdt
pdpspsdspsswswtstwtwswtwpspwpwswpw fwfwfpfp:f:/f //f /vwvwd
vd/v//v////v/// vv vfvfwfwvwfw/f /v/f / scsccpcscpc /
s/h
shchcschc :h:s:h:c :chc :csc :chc :c /h/s/h/d/d//d////d/// vdv/h/d/h/tdt/t/d/t/vtvdvtvtdtvtvdvtvvivimvmcvcvvvvvivitvtvtvvvtvitivitictcvctcpvpmpmvmpmcpcvcpcopovoposmsms es eosopspmpmsmpmoposopo:s:m:msm:me/es e/eohosohoopohoposopohopovovomvm/v/e/eve/e/v////v///
tvtotovotomtmvmtmmtmvmtmmpmvmpmw/w/uwupwpmpmwmpm/p/w/p//:/w/://w////w///u/uwu/uu/uwu/uu/u/u/uwu/u/u/uvw vuvuwuvuiwimwmwuwuswsewevwvsvswsvsmwmeweo
wowewerwr4w4owo cwcowod4d46d6odomdmc3c3mcm/c/
sfsf
d sd dsd
sddd sfs fsf
ffvfvfvff
fvf vfvf sdvdvsds vvvv wvwswsw vwvw wwwwdwdcwcwcwc wwwwwwwcwcwwwdcdcsds
dddcscsdcd wswsfwfvwvfvfwfvfmw
mvmvwvmvwwwcwccscsecesescsesocososcsosdod
cdod
cccwcwowocowowdwdvwvsw
sdodwdodd.dwd.dcwcdcdwdcd owoohowohowwwdwdwdwdcwcwcwcdcdwdcdwdcdwdcd owowowoohowohowohowohocwcocowocomcmwmcmcscsvcv
mcmv4vcv4vcccmcmcmcmscs/s/c /s/swsw4s4hshwhwswhwssshshsh
shdsdhdhshdhdwdwwdwwhwdwhwtdtwtwdwtwwtwdwtwtdtwtwdwtwdddtdtdtdtt
dtdt
dtsdststdtstwtwswtwdwtwswtwpspd pspswswwswhshpspwpwswpwwpwswpwpspspspwpwswpwswpwswpw fsfwfwswfwpfpspfpwpw fwpwswpw fwpwwpwfwpwswpwfwpwfwfwdf dhfhwhwfwhwtftwt
wfwtw
tf ttmtftmtvfvwvwfwvwdvdf dvd/v/f /v/fvfffvfwfwvwfwfwfwvwfwvdvdcvctvtdtdvdtdtvtdtdvdtdpvpdpdvdpdcpcvcpcmvmdmdvdmdtmtvtmttmtvtmtpmpvpmpdvdvdvdfvf df dvdf dtftvtftdtdf dtdvdtdf dtdtf tvtf tdtdf dtdvdtdf dtdtmt
ftmtvtmtftmtdvdf dvdvdvdf dvd sesepepspep osowowswowhshwhwswhwhsh:h:s:h:/h/s/h/w/whw/wsw/whw/wehesehewewhwewswewhwew:e:h:e:s:e:h:e:/e/h/e/s/e/h/e/w/wew/whw/wew/wsw/wew/whw/wew/wohosohowowhwowswowhwoww/wow/whw/wow/wsw/wow/whw/wow/w3s3e3ese3e8s8o8oso8o4
s4343s343e3e4e3ese3e4e3e848s848dwdwcdcodowowdwow cd ccccdcccwowhwowdwowhwowtdtwtwdwtwctcdctc/t/d/t/vtvdvtvotodotowowtwowdwowtwow/o/t/o/d/o/t/o/w/wow/wtw/wow/wdw/wow/wtw/wow/w vovtvovdvovtvovtd tctcd ctc8d8o8odo8owow8wowdwow8wow8d8c8cdc8co8odo8owow8wowdwow8wowcoc8cocdcoc8cocc.c8c.cdc.c8c.cccc8cccdccc8cccccc4cccdccc4ccc848d848hdhohodoho8h8d8h8o8oho8odo8oho8o8h8d8h8c8chc8cdc8chc8co8oho8odo8oho8ococ8cochcoc8cocdcoc8cochcoc8coc
td
t8t8d8t8
c8ctc8cdc8ctc8ctdtdtdt/t/d/t/d/t/d/t/vtvdvtvdvtvdvtvoto
dotodotodoto/o/t/o/d/o/t/o/d/o/t/o/d/o/t/o/vovtvovdvovtvovdvovtvovdvovtvovvd vtvtd tvtvwvw8v8w8wvw8ww4wvw4wwcw4wcwvwcw4wcwwhwvwhwhvhtvt8t8v8t8tvtwtwvwtw8t8v8t84t4v4t4w4wtw4wvw4wtw4wpvpwp
wvwpww4wpw4wvw4wpw4wwhwp
whwvwhwp
whwh
phvh
phscscssshshchcschc
tsttst
pspcpcscpctptstpt :s:c:csc:cs:sss:s/s /c /csc /cs/sss/svsvsdvdtvtstsvstspvpdpdvdpd/v/s/svs/sd/dvd/d/v/s /svs /sd/dvd/d///v///s/s /s/svs/s /s/sd/d/d/dvd/d/d/dd vdvd vd wfwfvwv/w/s/sws/sf/fwf/f/w/f/fwf/fv/vwv/vfvf/fvfwfvf/fvf///w///f/f/f/fwf/f/f/f vwvf vfwf vfv vvwv vv iw i
vwv/v/w/v/iwi/i/w/i//i/w/i/mwm/m/w/m/ wiwimwmew eweweowo
/w//w////w/// vw
vdcdcod ovdvidimdmwdwmwmdmwmcmcmecewcwmwmcmwmeweceweeeeceeewcweweceweeweweweceweweweeeeweeeceeeweeew
cwwwwcwwwewewewecewewewe
svsv/s/s/sss/sv/vsv/v/s/v/vsv/vv/v/v/vsv/v/v/vdvdv/d/v/vdv/vvdvvvvdvvvvvvvivimvmhvhvhvvvhvihivihismsmv wwwdwdwwww
dwwwcwcwwcwwwwcwwwcwcccwc wwwwwwwwwwwwwwwwwwwwwwwwwwdwwwdwdcdcdcccdc wsws
cwccwccccwccc wcwcswswdsfvfvf sdvsv ww:
w:/
w/w/w//w////w/// vwviw
imw
mmw
mdmdmedemdmmmmdmmm/d/e/ede/ecoco cc c/c/o/oco/oucuouocouo.u.c.u.cscc cscwowoswseweoeowoeo rwr4w 44w46w63w
3c4c43c33c3w
rwr4w
43w38w8e8ewe8er8rwr8r8w8484
w484c4c46c63c 3484c4844c4444c444646c646s6s63s33s 3hsh3h3s3h3mhmsmhmmmmhmmmsmmmhmmmd3d38d 8/d/mmmdmmm/d////d///udu/u/d/u/uuuduuutdtmtmdmtmmmmtmmmdmmmtmmm/t/d/t////t///d///t///tdt/t/d/t////t///d///t///utudutu/u/t/u/d/u/t/u/upudupuuuupuuuduuupuuus
8
s
84
s
4usussssssusususussssssses esesssespspupusupuuuupuuusuuupuuuusupusususupusu:s:s:sss:ss:sss:ssss:sssssss:ssss/sss/se/es e/eses/sessses/sesf4f4sfseferf reref ere/f/4/4f4/4s/sfs/se/efe/eses/sesfses/ses/f /4 /4f4 /4s/sfs/se/ef e/ee/efe/eeee/eeef eee/eeer/ rf r/ rere/eref ere/ere///f///4/4 /4/4f4/4 /4/4s/s/s/sfs/s/s/se/e/e/efe/e/e/e4o4f4o4v4v4 everv r/v/e/eve/evvvevevevervrv rvr4o4v4o4ivi/i/v/i/cvcfvf4f4v4f4 /f /v/f /4 /4f4 /4v4 /4f4 /4 e/ef e/eve/ef e/e4o4f4o4v4o4f4o4
s/s/vsvdvdvidimdmsmsm fefe v
w
v
wdv de veovofvfefe vefe sdsdcscdcdc wdwo do vwvwswswcscvcvcwvwwwwwcwcswswswsdwdwdwdswsfwfdfdfvdvfvfdfvf cscs wdwd cvcvscswswsvwv csdsfvfvf sdvsv wwcwcow
owowomwmdmdm/d/ududmdm cucuscswcwcsdsfvfvf
http:/d/
d/d/ds/s/// vsvsfvfififmfmfvmvfvfmfvf esesososdodd.dcdcd om/user4633884http:///// vimeo.com/user4633884s�f�f� vfvf vvsvsvsv
hvhv whwvhvvvvhvvv wvwhwvwwswhwswtwtwwswtwswtwtwwtwwswtwswpwpwwvwpwvw:w:ww:w/w/w/d/dw/w
/// vdvd
iwiwmwmwwmwewewwewowoww.wcwcwdcdododmdmdcmc/usdsdeded
46f6f
3388e8
eo8o4
o4
o.4.c4chohomhmwh
wowohowo tmtmwt
wmwmtmwmdtdmdmtmdmtmtmdtdmdmtmdm/d/t/d/pupudpd/d/p/d/udupuducpcucupucuscspscs/s/se/e/e/er/r4/4w/w///e/e/e/e v4v4 i6i6m3m33m3e8e8 o4o4 c�c�o�o�fof�f�o�f� mvmv/uvuv ser46338
hshsdhdtdtdtvtvpvpvspss:s/s/sv/v/v/vv/v/v/vvvvvieiemwmwececoeowew oooomom.c/c/ucuouousos memermr4m4/4/46/6u6u63u3s3s3e8e88e8r8r84r44444h4h6h6ht6tt6t3t3tp3p3p3p /3/8/8/
v8v
8s8sv8v4v4v w4whwhwtwtwwtwtwtwpwpwwpw:///// vimeo.commmm/e/eo/ououo.u.scscosoeoeomemrmrm4m4m/4/u4u6u6us6s3e3er3r3r3r4348686383
hshsrhr ftft4t4f4ftf4f
6t6tftfvtvfvftfvf6t6f6ftf6f
3t3tvpvp3p33p3:3:38:8/
m/
me/e
8/8e
8e/e
8e/o/o/
e/
eo/o8/8
e8
e/
e8
eo8o/o8o
/// v8v84v4ihihohoiohom
dm
dhmhtmttmtpmpececpepcpcecpc:e:owow/o/w/wow/w ccccwcwowow m/user4633884
hshshchcscshscswhw:h:s:shs:sc :chc:cscs:scshscs:scs/h/s/shs/se/ehe/ew/whw/w/h/w/whw/w///h///w/w/w/whw/w/w/wehewewhwew:e:h:e:/e/h/e/w/wew/whw/wew/wohowowhwoww/wow/whw/wow/ww/wow/whw/wow/ww/w/w/wow/w/w/whw/w/w/wow/w/w/wt4t4wtwctc/t/r/rtr/r4/4t4/4vtv4v4t4v4otowowtwow/o/t/o/w/wow/wtw/wow/w vovtvovt4t46t6vtv4v4t4v46v6t6v6iti6i6t6i6ctcp3p3mpm3m3p3m33m3p3m3cpcopo:8:8m:m3m3:3m3 /8/88/8e/e8e8/8e88e8/8e8/8/84/4o/o8o8/8o84o4/4o4/// v4v4svs�v�ovo4o4v4o4.v.s.svs.scvcscsvscs�c�v�c�
/v/ i�i��c�i�c�oio�o�i�o�mfmfvmvfvfmfvf vmvvmvomofofmfofvovmvovfvfofvfmfvfofvf mmmvmvmvmvvmvmvmvvmvmvmvevevsesvevmemvmvevmv/e/v/vev/vs/ses/sueuvuvevuvovovsosvov
uouvuvovuvsusosussossssosss cscsvcvcovovom/8/88/8/user4633884
hwhwwhwtwtwdtdwdwtwdwtwtwwwwtwww
dtdwd
wtwd
wwdwtwdwwwwd
wwwtwwwd
wwwpcpcwpwwpwcwcpcwccpcwcwpwcwcccpcccwcwpwcwwwwcwwwpwwwcwwwcwcccwcpcwcccwc :w:ww:wwww:wwww:wwww:wwwwwwwwww:wwwwwww/w/ww/wwww/wwww/wwww/wwwwww/wwwwwwwwww/wwwwwwwwdwwwdw/wdwwwdw/w/wc/cd/dcdc/cdc/w/wd/dw/wwww/wwwcwc/cwcwww/wwwdwd/dwdwdwwwdw/wdwwwdwcdcwcdc/cdcwcdcdcd/dcdcdcccdc/cdcccdcw/w/w/wwww/www/www/www vcvcsvsdvdcdcvcdcsdsvsdsscsvscsdcdvdcdcdcccdcvcdcccdcsdscsdsvsdscsdswvwswsvswsdwdvdwdcicscsiscswiwcwcicwcmdmdwmwcmcdcdmdcdcwcmcwcdcdwdcdmdcdwdcdcccwcccmcccwccccmcwcwmwcwcccmcccwewwwwewwwwswewswwwwswwwewwwswwwowowwwwowwwdodwdwowdwwowowowwswowswc.ccdcdscsososfofmfmfvmvfvfmfvf /v/vp/pvpv/vpv ususssssdsddedrdrdvrv4v4v6v6vs6s3
m3
m3e3e8o8o
wow8wow8c8cw8wo8owow8wowcoc8cocc.c8c.cc8cccc8ccc 4w4wc4cccc 4cccwcw4wcwwow4wow
p4pcpc4cpchwhwchcohowowhwowopohopototomtmtmtmpmpm/p//://///u/u
i/i/u/ui/im/m
///u/u/u/uvuvusvsisism
im
memermremeerer4e4
oeoovovsos4o46o6ooo.o.cocscsoscs.6.6cvcv6c63
c3
cccvcvcvcvocovovcvov o3o3ooomommmmm////u/u/uuususussseses rere4e4er4r 6r 6r464343463636363
338383
hwhwdhdwhwwwwhwwwdwdhdwd/h
/d/dhd/dtdtdctcwtwdwdtdwdcwctcwcwtwcwctcwctwtwcwctcwc pwpwwwwpwwwwww
dwwwpwwwd
wwwwwwtwwwpwwwtwwwwwwd
wwwtwwwd
wwwpwwwd
wwwtwwwd
www:w:ww:wwww:wwwwww:www/w/wwww/wwwcwc/cwc/w
/ww/wcwc/cwcwww/wwww/w/w/wwww/www/www/wwww/w/w/wcwc/cwc/cwc/cwc vdvdwvwdvdw/wvw/w/v/w/wvw/wd/dvd/dw/w
vw/wdwd/dwdvdwd/dwddiddiddddiddddcdidcdd/did/ddwd/dwdidwd/dwddcd/dcdidcd/dcdmcmcdmddddmdddcccmcccdcdmdcdwmwcwcmcwcdwdmdwdwmwcwcmcwccwcmcwccccwcccmcccwcccdvdmdvddcdvdcdmdcdvdcdwvwmwvwdwdvdwdmdwdvdwdimicicmcicwiwmwiwcwcicwcmcwcicwccwcicwcmcwcicwccwcmcwcmcwcmcwccccwcccmcccwcccmcccwcccmcccwcccececcwcecwccccwcccecccwcccceccccecccmemcmcecmccmcecmcwmwewmwcwcmcwcecwcmcwccwcmcwcecwcmcwccccwcccmcccwcccecccwcccmcccwccccmcecmccccmcccecccmccc owowcocwcwowcwsoswswowswcmcocmcwcwmwcwowcwmwcwwewowewwswewswowswewswwwwswwwewwwswwwowwwswwwewwwswwww.wwsw.wswwew.wewwwwewww.wwwewwwwswewsw.wswewswwwwswwwewwwswww.wwwswwwewwwswwwwcwcdcdocowowcwowwswowswcwswowswdodcdodwdwowdwcwdwowdw ow owcocdodwdw owdwcdcocdcooowow owowdodododwdwowdw owdwowdw .o.c.coc.ccoccccocccdcdodcdmsmsfmfcmcscsmscsomososmsosfofmfoffmfmfmf/m/mfmf/fmfvmv/vmvfvfmfvf/fvfmfvf uvuvmumvmvuvmv/u/v/vuv/vssss/s/usususssusesessusesussessssesssrdrd4d4dv4vded4dedr4r
6v6vr6rvrv6vrvv4v6v4v3v3vs3s3s3sv3v8v8v 8v 8v w8w4w4whwhw twtwtstspdpd:d:
ds:s/s/sf/f/f/fv/vfvf/fvf///f/f/f/f vf vfvvv imeo.com/user46338
hwhwvhvihimhmwmwhwmwwtwmtmwmwtwmwtwtwmtmwmwtwmwpwpwwpwepewewpwew opo:w:wo:o/w/wo/o././w/w./.c/cw/w/w/wvwvwcvcovoioiomdmd
ed
eddod
edodmemdmd
edmd
omom/o//./c/c/ucuouousosmdmdemededmdedhmhehemeherhrmrhr/4/4h/hrhr/rhr4h4/4h44t4/4t4fuf
6u6f6fuf6fufuf4u4f4fuf4ftutftfuftf4t4u4t4f4ftf4fuf4ftf4f6t6u6t6f6ftf6fuf6ftf6f6t6u6t6f6ftf6fuf6ftf6fsvsvs
3s3tstvtvsvtv6t6s6t63t3s3t3evevpepvpvevpv
3p3e3p33p3e3p3p/pep/pvpv/vpvevpv/vpv rsrs3r3prp3p3r3p3:r:3:3r3:34s4s
8484:4:8:848:8/4/8/848/8/4/s4ssss4sss6d6d868/6/d/d6d/d8/868/8v6v8v868v84v464v4
s6sded6ded3d3dv3vv3vded3dedr3rdrd3drdvrv3vrv4343
i3im3m434v4v3v4v6368m8m686v6v8v6vs6s8s6sm6m8m6m383m
3m8m3m
8m
8me8e383m
3m
8m
3m
383e3e8e3e4343e3e4e3e848hoho8h8o8oho8o8h8c8ch
c8co8oho8ococ8coch
coc8coct8t8c8ctc8cw8wtw8wtwtw8t84t4w4wtw4wpwp
wcpcw4wpw4whphwhwp
whwh
pht
pt
:c:cs:s/c /cs/sd/dt/tt/ t/s /sd/dt/t///s/s /s/sd/d/d/dvdvd/v/i/i//i/m/m/ im
ieiei omomeoe.e.ececeocooooo mcmcomo/o/om/mumums/s/e/e/ueursrs4s4se4e6e6er6r343436368383
hohomhmtmtm/t/t/t/utupupusps:e:e/e/er/r/r/r4/4r/r/r/r v4v46v6i3i3m3m33m38m8e8e88e8o4o4hoh.ctcttcteceocoo
totpopooom:m:/m/cmcomo/
v/vo/om/mumumsmsm/s/er4m4m/
4/6/6/u6u3u3us3s3s3se3e8e8er8rc8cscs8scsvcv8vcv8v8vr8r484o8ovov8vovooo8ooo4444646o4om4mo4oooo4ooomom4mommmm4mmmh3h3mhmmmmhmmmtmtmmtmmmmtmmm/t////t///t/t////t///utu/u/t/u/p
8p
8upuupuuuupuuuusupusu:s:ss:ssss:sss/4
/4s/se/eses/ses/4 /4s/se/ee/eeee/eeer/rere/ere///4/
4 /4/
4s/s/s/se/e/e/evevervririrm4m46m6e6e6o3o3.com/user46338
The one god thing about music, w
hen it hits you you feel no pain. Live Music.
http://vimeo.com/user4633884 http://vimeo.com/user4633884 http://vim
Triumph Triumph
Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph
Triumph Triumph Triumph Triumph Triumph Triumph
Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph Triumph
Triumph Triumph Triumph
Triumph Triumph
Triumph Triump
h Tri
Hanging out in the backyard. Big front porch neighborhoods. 918. T-Town, Tulsa, OK. 74127. Firepits. Cookouts. Music. Friends. Music Festivals. Road Trips. “Adventures” Top of Mountains. College Life. Boome
Sooner! Cycling. Maxin & Relaxin
TR 3 TR3 TR3 TR3 TR3 TR3 TR3 TR3 TR3 TR3 TR3 TR3 TR3 TR3 TR3
TR3
19 59 1959 1959 1959
1959 1959 1959 1959 1959 1959
1959 1959 1959 1959 1959
1959 1959 1959 1959 1959 1959 1959 1959
1959 1959 1959 1959 1959 1959 1959 1959 1959 1959 1959
1959 1959 1959 1959 1959 1959 1959 1959 1959 1959 1959 1959
1959 1959 1959 1959 1959 1959 1959 1959 1959 1959 1959
1959 1959 1959 1959 1959 1959 1959
1959
Hang-ing out in the
backyard. Big front
porch neighborhoods.
918. T-Town, Tulsa, OK. 74127.
Firepits. Cookouts. Music. Friends.
Music Festivals. Road Trips. “Adventures”
Top of Mountains. College Life. Boome
Sooner! Cycling. Maxin & RelaxinHanging out in
the backyard. Big front porch neighborhoods.
918. T-Town, Tulsa, OK. 74127. Firepits. Cookouts.
Music. Friends. Music Festivals. Road Trips.
“Adventures” Top of Mountains. College Life. Boome
Sooner! Cycling. Maxin & RelaxinHanging out in the
backyard. Big front porch neighborhoods. 918. T-Town,
Tulsa, OK. 74127. Firepits. Cookouts. Music. Friends. Music
Festivals. Road Trips. “Adventures” Top of Mountains. College Life.
Boome Sooner! Cycling. Maxin & RelaxinHanging out in the backyard.
Big front porch neighborhoods. 918. T-Town, Tulsa, OK. 74127. Firepits.
Cookouts. Music. Friends. Music Festivals. Road Trips. “Adventures” Top of
Mountains. College Life. Boome Sooner! Cycling. Maxin & RelaxinHanging out in the
backyard. Big front porch neighborhoods. 918. T-Town, Tulsa, OK. 74127. Firepits. Cookouts. Music. Friends. Music
Festivals. Road Trips. “Adventures” Top of Mountains. College Life. Boome Sooner! Cycling. Maxin & RelaxinHanging out in the
backyard. Big front porch neighborhoods. 918. T-Town, Tulsa, OK. 74127. Firepits. Cookouts. Music. Friends. Music Festivals. Road
Trips. “Adventures” Top of Mountains. College Life. Boome Sooner! Cycling. Maxin & RelaxinHanging out in the backyard. Big front porch
neighborhoods. 918. T-Town, Tulsa, OK. 74127. Firepits. Cookouts. Music. Friends. Music Festivals. Road Trips. “Adventures” Top of Mountains. College Life. Boome Sooner! Cycling. Maxin & RelaxinHanging out in the backyard. Big front porch neighborhoods. 918. T-Town, Tulsa, OK. 74127. Firepits. Cookouts. Music. Friends. Music
Festivals. Road Trips. “Adventures” Top of Mountains. College Life. Boome Sooner! Cycling. Maxin & RelaxinHanging out in the
backyard. Big front porch neighborhoods. 918. T-Town, Tulsa, OK. 74127. Firepits. Cookouts. Music. Friends. Music
Festivals. Road Trips. “Adventures” Top of Mountains. College Life. Boome Sooner! Cycling. Maxin &
RelaxinHanging out in the backyard. Big front porch neighborhoods. 918. T-Town, Tulsa, OK. 74127.
Firepits. Cookouts. Music. Friends. Music Festivals. Road Trips. “Adventures” Top of
Mountains. College Life. Boome Sooner! Cycling. Maxin & RelaxinHanging out
in the backyard. Big front porch neighborhoods. 918. T-Town,
Tulsa, OK. 74127. Firepits. Cookouts. Music.
Friends. Music Festivals. Road
Trips.
PTplic
T-Town, Tulsa, OK. 74127. Firepits. Cookouts. Music.
Maxin & Relaxin
Firepits. Cookouts. Music.
S.rSs
Firepits. Cookouts. Music. Friends. Music Festivals. Road Trips. “Adventures”
College Life. Boome Sooner! Cycling.
Maxin & Relaxin
mpliity
.
aksmcl akm basc sakfjb nalfw kfbk pwwb sakfjb nalfw kfbk pwwb sakfjb nalfw
efnw bwco naks cndj mclak msc naks cndj mclak msc naks cndj
sakfjbwk fbk nldwbe sakfjbwk k nldwbe
sakfjbwk
fnwcon tcon t
Ww lw lX lX liX i
oinwvoinw
oinclksndclknwineoinvonadvnoidnvoineovneoinvoineoivnoienoivneorinvioenrvw
eoicnowinvoinw
voinwoinclksndclknw
ineoinvonadvnoidnvoineovneoinvoineoivnoienoivneorinvioenrvweoicnow
invoinwvoinw
o
voinwoinclksndclknwineoinvonadvnoidnvoineovneoinvoineoivnoienoivneorinvioenrv
Take a minute to enjoy what you
don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy
what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not
have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take
a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a
minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a
minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t
not have Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not have
Take a minute to enjoy what you don’t not have Take a minute to enjoy what you don’t not
have Take a minute to enjoy what you don’t not have Take a
Ptosis (from Greek Ptosis or πτῶσις, to "fall") is
a drooping of the upper or lower eyelid. Ptosis (from
Greek Ptosis or πτῶσις, to "fall") is a drooping
Radio head tv
Radio head tv
Radio
on the radio wacka
o
on the radio wacka
oi
on the radio wacka
in
on the radio wacka
nc
on the radio wacka
cl
on the radio wacka
lk
on the radio wacka
ks
on the radio wacka
sn
on the radio wacka
nd
on the radio wacka
dc
on the radio wacka
cl
on the radio wacka
lk
on the radio wacka
knon the radio wacka nwon the radio wacka wion the radio wacka inon the radio wacka neon the radio wacka eoon the radio wacka oion the radio wacka inon the radio wacka nvon the radio wacka voon the radio wacka onon the radio wacka naon the radio wacka adon the radio wacka dvon the radio wacka vnon the radio wacka noon the radio wacka oion the radio wacka idon the radio wacka dnon the radio wacka nvon the radio wacka voon the radio wacka oion the radio wacka inon the radio wacka neon the radio wacka enon the radio wacka neon the radio wacka eoon the radio wacka oion the radio wacka inon the radio wacka nvon the radio wacka voon the radio wacka onon the radio wacka naon the radio wacka adon the radio wacka dvon the radio wacka vnon the radio wacka noon the radio wacka oion the radio wacka idon the radio wacka dnon the radio wacka nvon the radio wacka voon the radio wacka oion the radio wacka inon the radio wacka neon the radio wacka eoon the radio wacka ovon the radio wacka vnon the radio wacka neon the radio wacka eoon the radio wacka oion the radio wacka inon the radio wacka nvon the radio wacka voon the radio wacka oion the radio wacka inon the radio wacka neon the radio wacka eoon the radio wacka oion the radio wacka ivon the radio wacka vnon the radio wacka noon the radio wacka oion the radio wacka ieon the radio wacka enon the radio wacka noon the radio wacka oion the radio wacka ivon the radio wacka vnon the radio wacka neon the radio wacka eoon the radio wacka oron the radio wacka rion the radio wacka inon the radio wacka nvon the radio wacka vion the radio wacka ioon the radio wacka oeon the radio wacka enon the radio wacka nron the radio wacka rvon the radio wacka vwon the radio wacka weon the radio wacka eoon the radio wacka oion the radio wacka icon the radio wacka cnon the radio wacka noon the radio wacka owon the radio wacka wion the radio wacka inon the radio wacka nvon the radio wacka voon the radio wacka oion the radio wacka inon the radio wacka nwon the radio wacka wvon the radio wacka voon the radio wacka oion the radio wacka inon the radio wacka nwon the radio wacka woon the radio wacka oion the radio wacka inon the radio wacka ncon the radio wacka clon the radio wacka lkon the radio wacka kson the radio wacka snon the radio wacka ndon the radio wacka dcon the radio wacka clon the radio wacka lkon the radio wacka knon the radio wacka nwon the radio wacka wion the radio wacka inon the radio wacka neon the radio wacka eoon the radio wacka oion the radio wacka inon the radio wacka nvon the radio wacka voon the radio wacka onon the radio wacka naon the radio wacka adon the radio wacka dvon the radio wacka vnon the radio wacka noon the radio wacka oion the radio wacka idon the radio wacka dnon the radio wacka nvon the radio wacka voon the radio wacka oion the radio wacka inon the radio wacka neon the radio wacka eoon the radio wacka ovon the radio wacka vnon the radio wacka neon the radio wacka eoon the radio wacka oion the radio wacka inon the radio wacka nvon the radio wacka voon the radio wacka oion the radio wacka inon the radio wacka neon the radio wacka eoon the radio wacka o
head tv on the radio wacka
head tv
plocka flame mumford
o
plocka flame mumford
ov
plocka flame mumford
vn
plocka flame mumford
ne
plocka flame mumford
eo
plocka flame mumford
oi
plocka flame mumford
in
plocka flame mumford
nv
plocka flame mumford
vo
plocka flame mumford
oi
plocka flame mumford
inplocka flame mumford neplocka flame mumford eoplocka flame mumford oiplocka flame mumford ivplocka flame mumford vnplocka flame mumford noplocka flame mumford oiplocka flame mumford ieplocka flame mumford enplocka flame mumford noplocka flame mumford oiplocka flame mumford ivplocka flame mumford vnplocka flame mumford neplocka flame mumford eoplocka flame mumford orplocka flame mumford riplocka flame mumford inplocka flame mumford nvplocka flame mumford viplocka flame mumford ioplocka flame mumford oeplocka flame mumford enplocka flame mumford nrplocka flame mumford rvplocka flame mumford vwplocka flame mumford weplocka flame mumford eoplocka flame mumford oiplocka flame mumford icplocka flame mumford cnplocka flame mumford noplocka flame mumford owplocka flame mumford wiplocka flame mumford inplocka flame mumford nvplocka flame mumford voplocka flame mumford ooplocka flame mumford onplocka flame mumford naplocka flame mumford adplocka flame mumford dvplocka flame mumford vnplocka flame mumford noplocka flame mumford oiplocka flame mumford idplocka flame mumford dnplocka flame mumford nvplocka flame mumford voplocka flame mumford oiplocka flame mumford inplocka flame mumford neplocka flame mumford eoplocka flame mumford ovplocka flame mumford vnplocka flame mumford neplocka flame mumford eoplocka flame mumford oiplocka flame mumford inplocka flame mumford nvplocka flame mumford voplocka flame mumford oiplocka flame mumford inplocka flame mumford neplocka flame mumford eoplocka flame mumford oiplocka flame mumford ivplocka flame mumford vnplocka flame mumford noplocka flame mumford oiplocka flame mumford ieplocka flame mumford enplocka flame mumford noplocka flame mumford oiplocka flame mumford ivplocka flame mumford vnplocka flame mumford neplocka flame mumford eoplocka flame mumford orplocka flame mumford riplocka flame mumford inplocka flame mumford nvplocka flame mumford viplocka flame mumford ioplocka flame mumford oeplocka flame mumford enplocka flame mumford nrplocka flame mumford rvplocka flame mumford vwplocka flame mumford weplocka flame mumford eoplocka flame mumford oiplocka flame mumford icplocka flame mumford cnplocka flame mumford noplocka flame mumford owplocka flame mumford wiplocka flame mumford inplocka flame mumford nvplocka flame mumford voplocka flame mumford oiplocka flame mumford inplocka flame mumford nwplocka flame mumford wvplocka flame mumford voplocka flame mumford oi
plocka flame mumford
in
plocka flame mumford
nw
plocka flame mumford
wo
plocka flame mumford
oi
plocka flame mumford
in
plocka flame mumford
nc
plocka flame mumford
cl
plocka flame mumford
lk
plocka flame mumford
ks
plocka flame mumford
sn
plocka flame mumford
nd
plocka flame mumford
dc
plocka flame mumford
cl
plocka flame mumford
lk
plocka flame mumford
kn
plocka flame mumford
nw
plocka flame mumford
wi
plocka flame mumford
in
plocka flame mumford
no
plocka flame mumford
oi
plocka flame mumford
iv
plocka flame mumford
vn
plocka flame mumford
no
plocka flame mumford
oi
plocka flame mumford
ie
plocka flame mumford
en
plocka flame mumford
no
plocka flame mumford
oi
plocka flame mumford
iv
plocka flame mumford
vnplocka flame mumford neplocka flame mumford eoplocka flame mumford orplocka flame mumford riplocka flame mumford inplocka flame mumford nvplocka flame mumford viplocka flame mumford ioplocka flame mumford oeplocka flame mumford enplocka flame mumford nrplocka flame mumford rvplocka flame mumford vwplocka flame mumford weplocka flame mumford eoplocka flame mumford oiplocka flame mumford icplocka flame mumford cnplocka flame mumford noplocka flame mumford owplocka flame mumford w
iplocka flame mumford inplocka flame mumford nvplocka flame mumford voplocka flame mumford oiplocka flame mumford inplocka flame mumford n
on the radio wacka plocka flame mumford on the radio wacka eon the radio wacka e
plocka flame mumford
eon the radio wacka eoon the radio wacka o
plocka flame mumford
oon the radio wacka owon the radio wacka w
plocka flame mumford
won the radio wacka wion the radio wacka i
plocka flame mumford
ion the radio wacka inon the radio wacka n
plocka flame mumford
non the radio wacka neon the radio wacka e
plocka flame mumford
eon the radio wacka eoon the radio wacka o
plocka flame mumford
oon the radio wacka ooon the radio wacka o
plocka flame mumford
oon the radio wacka oion the radio wacka i
plocka flame mumford
ion the radio wacka i
and sons zac brown band oand sons zac brown band ot
and sons zac brown band
t h
and sons zac brown band
h o
and sons zac brown band
oi
and sons zac brown band
in
and sons zac brown band
nw
and sons zac brown band
wv
and sons zac brown band
vo
and sons zac brown band
oi
and sons zac brown band
in
and sons zac brown band
nw
and sons zac brown band
wo
and sons zac brown band
oi
and sons zac brown band
in
and sons zac brown band
nc
and sons zac brown band
cl
and sons zac brown band
lk
and sons zac brown band
ks
and sons zac brown band
sn
and sons zac brown band
nd
and sons zac brown band
dc
and sons zac brown band
cl
and sons zac brown band
lk
and sons zac brown band
kn
and sons zac brown band
nw
and sons zac brown band
wi
and sons zac brown band
in
and sons zac brown band
ne
and sons zac brown band
eo
and sons zac brown band
oi
and sons zac brown band
in
and sons zac brown band
nv
and sons zac brown band
vo
and sons zac brown band
ow
and sons zac brown band
wv
and sons zac brown band
vo
and sons zac brown band
oi
and sons zac brown band
in
and sons zac brown band
nw
and sons zac brown band
wo
and sons zac brown band
oi
and sons zac brown band
in
and sons zac brown band
nc
and sons zac brown band cl
and sons zac brown band lk
and sons zac brown band ksand sons zac brown band snand sons zac brown band ndand sons zac brown band dcand sons zac brown band cland sons zac brown band lkand sons zac brown band knand sons zac brown band nwand sons zac brown band wiand sons zac brown band inand sons zac brown band neand sons zac brown band eoand sons zac brown band oiand sons zac brown band inand sons zac brown band nvand sons zac brown band voand sons zac brown band onand sons zac brown band naand sons zac brown band adand sons zac brown band dvand sons zac brown band vnand sons zac brown band noand sons zac brown band oiand sons zac brown band idand sons zac brown band dnand sons zac brown band nvand sons zac brown band voand sons zac brown band oiand sons zac brown band inand sons zac brown band neand sons zac brown band eoand sons zac brown band ovand sons zac brown band vnand sons zac brown band neand sons zac brown band eoand sons zac brown band oiand sons zac brown band inand sons zac brown band nvand sons zac brown band voand sons zac brown band oiand sons zac brown band inand sons zac brown band neand sons zac brown band eoand sons zac brown band oiand sons zac brown band ivand sons zac brown band vnand sons zac brown band noand sons zac brown band oiand sons zac brown band ieand sons zac brown band enand sons zac brown band noand sons zac brown band oiand sons zac brown band ivand sons zac brown band vnand sons zac brown band neand sons zac brown band eoand sons zac brown band orand sons zac brown band riand sons zac brown band i
plocka flame mumford and sons zac brown band plocka flame mumford iplocka flame mumford i
and sons zac brown band
iplocka flame mumford inplocka flame mumford n
and sons zac brown band
nplocka flame mumford nvplocka flame mumford v
and sons zac brown band
vplocka flame mumford voplocka flame mumford o
and sons zac brown band
oplocka flame mumford oiplocka flame mumford i
and sons zac brown band
iplocka flame mumford inplocka flame mumford n
and sons zac brown band
nplocka flame mumford nwplocka flame mumford w
and sons zac brown band
wplocka flame mumford woplocka flame mumford o
and sons zac brown band
oplocka flame mumford oiplocka flame mumford i
and sons zac brown band
iplocka flame mumford inplocka flame mumford n
and sons zac brown band
nplocka flame mumford nvplocka flame mumford v
and sons zac brown band
vplocka flame mumford voplocka flame mumford o
and sons zac brown band
oplocka flame mumford onplocka flame mumford n
and sons zac brown band
nplocka flame mumford naplocka flame mumford a
and sons zac brown band
aplocka flame mumford adplocka flame mumford d
and sons zac brown band
dplocka flame mumford dnplocka flame mumford n
and sons zac brown band
nplocka flame mumford nwplocka flame mumford w
and sons zac brown band
wplocka flame mumford w
notorious b.i.g. big gigantic
n
notorious b.i.g. big gigantic
n r
notorious b.i.g. big gigantic ri
notorious b.i.g. big gigantic in
notorious b.i.g. big gigantic nv
notorious b.i.g. big gigantic vi
notorious b.i.g. big gigantic io
notorious b.i.g. big gigantic oe
notorious b.i.g. big gigantic en
notorious b.i.g. big gigantic nr
notorious b.i.g. big gigantic rv
notorious b.i.g. big gigantic vw
notorious b.i.g. big gigantic we
notorious b.i.g. big gigantic eo
notorious b.i.g. big gigantic oi
notorious b.i.g. big gigantic ic
notorious b.i.g. big gigantic cn
notorious b.i.g. big gigantic no
notorious b.i.g. big gigantic ow
notorious b.i.g. big gigantic wi
notorious b.i.g. big gigantic innotorious b.i.g. big gigantic nvnotorious b.i.g. big gigantic vonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic innotorious b.i.g. big gigantic nwnotorious b.i.g. big gigantic wvnotorious b.i.g. big gigantic vonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic innotorious b.i.g. big gigantic nwnotorious b.i.g. big gigantic wonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic innotorious b.i.g. big gigantic ncnotorious b.i.g. big gigantic clnotorious b.i.g. big gigantic lknotorious b.i.g. big gigantic ksnotorious b.i.g. big gigantic snnotorious b.i.g. big gigantic ndnotorious b.i.g. big gigantic dcnotorious b.i.g. big gigantic clnotorious b.i.g. big gigantic lknotorious b.i.g. big gigantic knnotorious b.i.g. big gigantic nwnotorious b.i.g. big gigantic winotorious b.i.g. big gigantic innotorious b.i.g. big gigantic nenotorious b.i.g. big gigantic eonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic innotorious b.i.g. big gigantic nvnotorious b.i.g. big gigantic vonotorious b.i.g. big gigantic onnotorious b.i.g. big gigantic nanotorious b.i.g. big gigantic adnotorious b.i.g. big gigantic dvnotorious b.i.g. big gigantic vnnotorious b.i.g. big gigantic nonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic idnotorious b.i.g. big gigantic dnnotorious b.i.g. big gigantic nvnotorious b.i.g. big gigantic vonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic innotorious b.i.g. big gigantic nenotorious b.i.g. big gigantic eonotorious b.i.g. big gigantic ovnotorious b.i.g. big gigantic vnnotorious b.i.g. big gigantic nenotorious b.i.g. big gigantic eonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic innotorious b.i.g. big gigantic nvnotorious b.i.g. big gigantic vonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic innotorious b.i.g. big gigantic nenotorious b.i.g. big gigantic eonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic ivnotorious b.i.g. big gigantic vnnotorious b.i.g. big gigantic nonotorious b.i.g. big gigantic oinotorious b.i.g. big gigantic ienotorious b.i.g. big gigantic ennotorious b.i.g. big gigantic n
and sons zac brown band notorious b.i.g. big gigantic and sons zac brown band eand sons zac brown band e
notorious b.i.g. big gigantic eand sons zac brown band eoand sons zac brown band o
notorious b.i.g. big gigantic oand sons zac brown band orand sons zac brown band r
notorious b.i.g. big gigantic rand sons zac brown band riand sons zac brown band i
notorious b.i.g. big gigantic iand sons zac brown band inand sons zac brown band n
notorious b.i.g. big gigantic nand sons zac brown band nvand sons zac brown band v
notorious b.i.g. big gigantic vand sons zac brown band v
pretty lights sts9 the john n
pretty lights sts9 the john no
pretty lights sts9 the john oi
pretty lights sts9 the john iv
pretty lights sts9 the john vn
pretty lights sts9 the john ne
pretty lights sts9 the john eo
pretty lights sts9 the john or
pretty lights sts9 the john ri
pretty lights sts9 the john in
pretty lights sts9 the john nv
pretty lights sts9 the john vi
pretty lights sts9 the john io
pretty lights sts9 the john oe
pretty lights sts9 the john en
pretty lights sts9 the john nrpretty lights sts9 the john rvpretty lights sts9 the john vwpretty lights sts9 the john wepretty lights sts9 the john eopretty lights sts9 the john oipretty lights sts9 the john icpretty lights sts9 the john cnpretty lights sts9 the john nopretty lights sts9 the john owpretty lights sts9 the john wipretty lights sts9 the john inpretty lights sts9 the john nvpretty lights sts9 the john vopretty lights sts9 the john oipretty lights sts9 the john inpretty lights sts9 the john nwpretty lights sts9 the john wvpretty lights sts9 the john vopretty lights sts9 the john oipretty lights sts9 the john inpretty lights sts9 the john nwpretty lights sts9 the john wopretty lights sts9 the john oipretty lights sts9 the john inpretty lights sts9 the john ncpretty lights sts9 the john clpretty lights sts9 the john lkpretty lights sts9 the john kspretty lights sts9 the john snpretty lights sts9 the john ndpretty lights sts9 the john dcpretty lights sts9 the john clpretty lights sts9 the john lkpretty lights sts9 the john knpretty lights sts9 the john nwpretty lights sts9 the john wipretty lights sts9 the john inpretty lights sts9 the john nepretty lights sts9 the john eopretty lights sts9 the john oipretty lights sts9 the john inpretty lights sts9 the john nvpretty lights sts9 the john vopretty lights sts9 the john onpretty lights sts9 the john napretty lights sts9 the john adpretty lights sts9 the john dvpretty lights sts9 the john vnpretty lights sts9 the john nopretty lights sts9 the john oipretty lights sts9 the john idpretty lights sts9 the john d
notorious b.i.g. big gigantic pretty lights sts9 the john
notorious b.i.g. big gigantic enotorious b.i.g. big gigantic e
pretty lights sts9 the john enotorious b.i.g. big gigantic ennotorious b.i.g. big gigantic n
pretty lights sts9 the john nnotorious b.i.g. big gigantic nonotorious b.i.g. big gigantic o
pretty lights sts9 the john onotorious b.i.g. big gigantic oi
notorious b.i.g. big gigantic i
pretty lights sts9 the john i
notorious b.i.g. big gigantic i
butler pretty lights sts9 the john
butler pretty lights sts9 the john
trio coldplay .trio coldplay .mtrio coldplay m
i
trio coldplay id
trio coldplay dn
trio coldplay nv
trio coldplay vo
trio coldplay oi
trio coldplay in
trio coldplay ne
trio coldplay eo
trio coldplay ov
trio coldplay vn
trio coldplay ne
trio coldplay eo
trio coldplay oi
trio coldplay in
trio coldplay nv
trio coldplay vo
trio coldplay oi
trio coldplay intrio coldplay netrio coldplay eotrio coldplay oitrio coldplay ivtrio coldplay vntrio coldplay notrio coldplay oitrio coldplay ietrio coldplay entrio coldplay notrio coldplay oitrio coldplay ivtrio coldplay vntrio coldplay netrio coldplay eotrio coldplay ortrio coldplay ritrio coldplay intrio coldplay nvtrio coldplay vitrio coldplay iotrio coldplay oetrio coldplay entrio coldplay nrtrio coldplay rvtrio coldplay vwtrio coldplay wetrio coldplay eotrio coldplay oitrio coldplay ictrio coldplay cntrio coldplay notrio coldplay owtrio coldplay witrio coldplay intrio coldplay nvtrio coldplay votrio coldplay oitrio coldplay intrio coldplay nwtrio coldplay wvtrio coldplay votrio coldplay oitrio coldplay intrio coldplay n
pretty lights sts9 the john trio coldplay
pretty lights sts9 the john npretty lights sts9 the john n
trio coldplay npretty lights sts9 the john nopretty lights sts9 the john o
trio coldplay opretty lights sts9 the john oipretty lights sts9 the john i
trio coldplay ipretty lights sts9 the john idpretty lights sts9 the john d
trio coldplay dpretty lights sts9 the john dnpretty lights sts9 the john n
trio coldplay npretty lights sts9 the john n
band butler
band butler
of band
of band
hoof
hoof
rho
rho
![Page 38: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/38.jpg)
![Page 39: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/39.jpg)
Typographic Self-Portrait
Instructional Diagram
Visual Poetry Calendar
Project: Instructional Diagram11x17 - Adobe Illustrator
The Instructional Diagram is an assignment in which we are to visually explain how to complete a task.
The assignment began by brainstorming common tasks among different demographics. The chosen task
mus be communicated clearly and concisely. We studied the use of iconography in this projects. The mor
simple an object was illustrated the better. The other task at hand was to create an effective and easy to
read layout that leads the viewers eye from one step to the next.
1
2
3
D2
![Page 40: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/40.jpg)
![Page 41: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/41.jpg)
To Change a Bike Tire
Replacement Intertube
Tire Tool
Portable Pump
1
2
34
5
Lift B
oth
Leve
r Up
6
![Page 42: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/42.jpg)
![Page 43: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/43.jpg)
Typographic Self-Portrait
Instructional Diagram
Visual Poetry Calendar
Project: Visual Poetry Calendar11x17 - Adobe Illustrator (3)
The Visual Poetry Calendar was slightly different because it was the first group project we were
assigned. The goal of the project was to develope a cohesive 12 month calendar with four group
members, each having their own season. The month I chose was Spring. To begin the project each
member created a mood board for thier month. After collaborating and reviewing each others boards
we decided on the centralized theme. This project was broken down into step. Each step focused our
attention to specific detail, such as imagery, type selection and layout and overall calendar layout/
integration.
1
2
3
D3
![Page 44: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/44.jpg)
![Page 45: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/45.jpg)
![Page 46: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/46.jpg)
Book Notes
Design Notes:
This book was designed and written by ADD YOUR NAME
in partial fulfillment of ART 2633 Visual Communication I and
ART 2643 Design Technology at the University of Oklahoma
School of Art & Art History, Fall 2011.
Software: Adobe Creative Suite
Typographic Notes:
All type was set in 8/14 pt. Univers Font.
Univers is one of a group of neo-grotesque sans-serif typefaces,
all released in 1957, that includes Folio and Neue Haas Grotesk
(later renamed Helvetica). These three faces are sometimes
confused with each other, because each is based on the 1898
typeface Akzidenz-Grotesk. These typefaces figure prominently in
the Swiss Style of graphic design.
A very important aspect of the Univers family is its modularity.
Frutiger wanted to create a series of related designs that were
absolutely harmonious with each other.
Frutiger has continued to improve and expand the Univers
family, working with Linotype designers to add new
weights and enlarging the character set to include many
languages such as Greek, Cyrillic and Arabic. The final
iteration of the family, Univers Next – a complete upgrading
of the design – was released in 2010.
Typographic Design:
Univers typeface designed by Adrian Frutiger.
![Page 47: pBook 6](https://reader034.fdocuments.in/reader034/viewer/2022052604/568c2c431a28abd8328ce933/html5/thumbnails/47.jpg)