CoverBSC6900 UMTS V900R012C00SPC110Parameter ReferenceHuawei Technologies Co., Ltd. provides customers with comprehensive technical support and service. For any assistance, please contact our local office or company headquarters.Huawei Technologies Co., Ltd.Address:Huawei Industrial BaseBantian, LonggangShenzhen 518129People's Republic of ChinaWebsite:http://www.huawei.comEmail:support@huawei.comCopyright Huawei Technologies Co., Ltd. 2010. All rights reserved.No part of this document may be reproduced or transmitted in any form or by any means without prior written consent of Huawei Technologies Co., Ltd.Trademarks and Permissionsand other Huawei trademarks are trademarks of Huawei Technologies Co., Ltd.All other trademarks and trade names mentioned in this document are the property of their respective holders.

support@huawei.comhttp://www.huawei.com

About This DocumentPurposeThis document provides information about the BSC6900 parameters, including the meaning, value, and usage of the parameters.Intended AudienceNetwork plannersField engineersSystem engineersShift operatorsOrganizationEach parameter is described in the following aspects.DescriptionRemarksMOModel object name for NBIParameter IDSimple string for identifying a parameterNBI Parameter NameNBI parameter nameParameter NameFull name of the parameterNENEs on which the parameter is setMML CommandCommands for setting the parameterMeaningFunctions, functioning ways, and protocols of the parameterIsKeyIsKey of MO for NBIMandatoryMandatory attribute of the parameter in each command for NBIFeature IDRelevant feature IDFeature NameFeatures using the parameterValue TypeParameter value typeGUI Value RangeParameter value range displayed on the GUIActual Value RangeActual parameter value range corresponding to the GUI Value Range. For example, the GUI Value Range is 0, and the corresponding Actual Value Range is OFF.UnitParameter value unitDefault ValueInitial value provided by the systemRecommended ValueValues recommended in different scenariosImpactParameter impact scope, that is, objects specified when the parameter is setParameter RelationshipRelationship between this parameter and other parameters. For example, to use this parameter, you need to set related switches and parameters.AccessWhether this parameter is read/write or read onlyService Interrupted After ModificationWhether modifying the parameter value may interrupt the existing servicesInterruption ScopePossible interruption scope in the case that modifying the parameter value may interrupt the existing servicesInterruption Duration (min)Possible interruption duration in the case that modifying the parameter value may interrupt the existing servicesCautionCautions to be taken during the modificationValidation of ModificationRequirements on how to validate the modification of the parameter. For example, you may need to reset the device to validate the modification.Impact on Radio Network PerformanceImpact of the radio parameter on the network performanceIntroduced in VersionVersion in which this parameter is introducedAttributeWhether this parameter is a radio parameter, a transport parameter, or an equipment parameterChange HistoryThis section provides information on the changes between V900R012C00SPC110 and V900R012C00SPC100.None.

Parameter List_1STTMML CommandParameter Namen v qun lMeaningMOParameter IDNBI Parameter NameNEIsKeyMandatoryFeature IDFeature NameValue TypeGUI Value RangeActual Value RangeUnitDefault ValueRecommended ValueImpactParameter RelationshipAccessService Interrupted After ModificationInterruption ScopeInterruption Duration(Min)CautionValidation of ModificationImpact on Radio Network PerformanceIntroduced in VersionAttribute1ADD AAL2PATH(Mandatory)MOD AAL2PATH(Mandatory)Bearing subrack No.MNG LISubrack number of bearing the AAL2 pathAAL2PATHCARRYFCARRYFBSC6900NOYESWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceInterval Type0~110~11NoneNoneNoneAAL2 pathWhen the value of "CARRYT" in "ADD AAL2PATH" is set to UNI, IMA, FRAATM, NCOPT, or ATM LGCPORT, this parameter is valid.Read & WriteYAAL2 pathLess than 5 minutesNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment2ADD AAL2PATH(Mandatory)MOD AAL2PATH(Mandatory)Bearing slot No.MNG LINumber of the slot bearing the AAL2 linkAAL2PATHCARRYSNCARRYSNBSC6900NOYESWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceInterval Type0~5,8~270~5, 8~27NoneNoneNoneAAL2 pathWhen the value of "CARRYT" in "ADD AAL2PATH" is set to UNI, IMA, FRAATM, NCOPT, or ATM LGCPORT, this parameter is valid.Read & WriteYAAL2 pathLess than 5 minutesNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport3ADD AAL2PATH(Mandatory)MOD AAL2PATH(Mandatory)Bearing UNI link No.MNG LINumber of the UNI link that carries the PATH. The field is value only when the " bearer type " parameter is set to UNI. The bearing UNI link must be configured already.AAL2PATHCARRYUNILNKNCARRYUNILNKNBSC6900NOYESWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceInterval Type0~3350~335NoneNoneNoneAAL2 pathWhen the value of "CARRYT" in "ADD AAL2PATH" is set to UNI, this parameter is valid.Read & WriteYAAL2 pathLess than 5 minutesThe UNI link must be available.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport4ADD AAL2PATH(Mandatory)MOD AAL2PATH(Mandatory)Bearing IMA group No.MNG LINumber of the IMA group that carries the PATH. The field is value only when the " bearer type " parameter is set to IMA. The bearing IMA group must be configured already.AAL2PATHCARRYIMAGRPNCARRYIMAGRPNBSC6900NOYESWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceInterval Type0~1670~167NoneNoneNoneAAL2 pathWhen the value of "CARRYT" in "ADD AAL2PATH" is set to IMA, this parameter is valid.Read & WriteYAAL2 pathLess than 5 minutesThe IMA group must be available.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport5ADD AAL2PATH(Mandatory)MOD AAL2PATH(Mandatory)Bearing FRAATM link No.MNG LINumber of the FRA ATM link that carries the PATH. This field is valid only when the " bearer type " parameter is set to FRAATM. The bearing FRAATM link must be configured already.AAL2PATHCARRYFRAATMLNKNCARRYFRAATMLNKNBSC6900NOYESWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceInterval Type0~310~31NoneNoneNoneAAL2 pathWhen the value of "CARRYT" in "ADD AAL2PATH" is set to FRAATM, this parameter is valid.Read & WriteYAAL2 pathLess than 5 minutesThe FRAATM link must be available.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport6ADD AAL2PATH(Mandatory)MOD AAL2PATH(Mandatory)Bearing NCOPT port No.MNG LINumber of the NCOPT port that carries the path. This field is valid only when the " bearer type " parameter is set to NCOPT.AAL2PATHCARRYNCOPTNCARRYNCOPTNBSC6900NOYESWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceInterval Type0~70~7NoneNoneNoneAAL2 pathWhen the value of "CARRYT" in "ADD AAL2PATH" is set to NCOPT, this parameter is valid.Read & WriteYAAL2 pathLess than 5 minutesThe port must be available.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport7ADD AAL2PATH(Mandatory)MOD AAL2PATH(Mandatory)Bearing ATM logic port No.MNG LIATM logic port No. bearing the PATH. This field is valid only when the " bearer type " parameter is set to ATM logic port. The bearing ATM logic port must be configured. The value mapping between interface boards and ATM logic ports are as follows: AEUa: 0~127; AOUa: 0~255; UOIa_ATM: 0~383; AOUc: 0~499; UOIc: 0~499. The ATM logic port must be the leaf ATM logic port (the last level ATM logic port).AAL2PATHCARRYVPNCARRYVPNBSC6900NOYESWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceInterval Type0~4990~499NoneNoneNoneAAL2 pathWhen the value of "CARRYT" in "ADD AAL2PATH" is set to ATM LGCPORT, this parameter is valid.Read & WriteYAAL2 pathLess than 5 minutesThe ATM logic port after the modification must be available.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport8ADD AAL2PATH(Mandatory)MOD AAL2PATH(Mandatory)Add To Rscgrp FlagMNG LIWhether to add the AAL2 path to the resource groupAAL2PATHRSCGRPFLAGRSCGRPFLAGBSC6900NOYESWRFD-050301ATM Transmission Introduction PackageEnumeration TypeNO(NO), YES(YES)NO, YESNoneNoneNoneAAL2 pathWhen the value of "CARRYT" in "ADD AAL2PATH" is set to UNI, IMA, FRAATM, or NCOPT, this parameter is valid.Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport9ADD AAL2PATH(Mandatory)MOD AAL2PATH(Mandatory)Rscgrp No.MNG LIResource group number of the PATHAAL2PATHRSCGRPNRSCGRPNBSC6900NOYESWRFD-050301ATM Transmission Introduction PackageInterval Type0~20470~2047NoneNoneNoneAAL2 pathWhen the value of "ADDTORSCGRP" in "ADD AAL2PATH" is set to YES, this parameter is valid.Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedThe resource group must exist.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport10ADD AAL2PATH(Mandatory)MOD AAL2PATH(Mandatory)RMV AAL2PATH(Mandatory)Adjacent Node IDMNG LIUniquely identifies an adjacent nodeAAL2PATHANIANIBSC6900YESYESWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceInterval Type0~45990~4599NoneNoneNoneAdjacent nodeNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport11ADD AAL2PATH(Mandatory)MOD AAL2PATH(Mandatory)RMV AAL2PATH(Mandatory)AAL2 path IDMNG LIID of one AAL2 path between two AAL2 nodes. The PATHID of the same AAL2 path configured between two AAL2 nodes must be the same. The value should not be equal to 0.AAL2PATHPATHIDPATHIDBSC6900YESYESWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceInterval Type1~42949672951~4294967295NoneNoneNoneAAL2 pathNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport12ADD AAL2PATH(Mandatory)MOD AAL2PATH(Optional)Bearing typeMNG LILower layer link type of bearing the Path.UNI: see"ADD UNILNK";IMA: see"ADD IMALNK";FRAATM: see"ADD FRALNK";NCOPT: see"LST OPT";ATMLOGICPORT: see"ADD ATMLOGICPORT";NULL: used when testing.AAL2PATHCARRYTCARRYTBSC6900NOYESWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceEnumeration TypeUNI(UNI Link), IMA(IMA Group), FRAATM(FRAATM Link), NCOPT(Optical Port), ATMLOGICPORT(ATM Logical Port), NULL(NULL)UNI, IMA, FRAATM, NCOPT, ATMLOGICPORT, NULLNoneNoneNoneAAL2 PathWhen the value of "RscMngMode" in "ADD NODEB" of the resource corresponding NodeB is set to EXCLUSIVE, the AAL2 Path must carry on ATM LGCPORT or RSCGRPRead & WriteYAAL2 pathLess than 5 minutesNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport13ADD AAL2PATH(Mandatory)MOD AAL2PATH(Optional)Bearing VPIMNG LIVPI of the AAL2 path out BSC6900AAL2PATHVPIVPIBSC6900NOYESWRFD-050301ATM Transmission Introduction PackageInterval Type0~40950~4095NoneNoneNoneAAL2 PathWhen the value of "CARRYT" in "ADD AAL2PATH" is set to UNI, IMA, FRAATM, NCOPT, or ATMLOGICPORT, this parameter is valid.Read & WriteYAAL2 pathLess than 5 minutesThe configuration data must be the same as that of the peer system.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport14ADD AAL2PATH(Mandatory)MOD AAL2PATH(Optional)Bearing VCIMNG LIVCI of the AAL2 path out BSC6900AAL2PATHVCIVCIBSC6900NOYESWRFD-050301ATM Transmission Introduction PackageInterval Type32~6553532~65535NoneNoneNoneAAL2 PathWhen the value of "CARRYT" in "ADD AAL2PATH" is set to UNI, IMA, FRAATM, NCOPT, or ATMLOGICPORT, this parameter is valid.Read & WriteYAAL2 pathLess than 5 minutesThe configuration data must be the same as that of the peer system.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport15ADD AAL2PATH(Mandatory)MOD AAL2PATH(Optional)TX traffic record indexMNG LITX traffic record index of the AAL2 Path on the out BSC6900 port (ATM layer PVC traffic). The traffic index is configured in the ATM traffic table (see "LST ATMTRF").AAL2PATHTXTRFXTXTRFXBSC6900NOYESWRFD-05030107CBR, rt-VBR, nrt-VBR, UBR ATM QoS ClassesInterval Type100~1999100~1999NoneNoneNoneAAL2 PathWhen the value of "CARRYT" in "ADD AAL2PATH" is set to UNI, IMA, FRAATM, NCOPT, or ATMLOGICPORT, this parameter is valid.Read & WriteYAAL2 pathLess than 5 minutesNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport16ADD AAL2PATH(Mandatory)MOD AAL2PATH(Optional)RX traffic record indexMNG LIRX traffic record index of the AAL2 Path on the out BSC6900 port (ATM layer PVC traffic). The traffic index is configured in the ATM traffic table (see "LST ATMTRF").AAL2PATHRXTRFXRXTRFXBSC6900NOYESWRFD-05030107CBR, rt-VBR, nrt-VBR, UBR ATM QoS ClassesInterval Type100~1999100~1999NoneNoneNoneAAL2 pathWhen the value of "CARRYT" in "ADD AAL2PATH" is set to UNI, IMA, FRAATM, NCOPT, or ATMLOGICPORT, this parameter is valid.Read & WriteYAAL2 pathLess than 5 minutesNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport17ADD AAL2PATH(Mandatory)MOD AAL2PATH(Optional)AAL2 Path TypeMNG LIService type of carried over the PATH. For R99, only the R99 service can be carried. For HSPA, only the HSPA service can be carried. For SHARE, R99 and HSPA services can be carried at the same time.AAL2PATHAAL2PATHTAAL2PATHTBSC6900NOYESWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceEnumeration TypeR99(R99), HSPA(HSPA), SHARE(SHARE)R99, HSPA, SHARENoneNoneNoneAAL2 pathNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport18ADD AAL2PATH(Optional)MOD AAL2PATH(Optional)AAL2 path ownershipMNG LIThe ownership of the AAL2 path is local or peerAAL2PATHOWNERSHIPOWNERSHIPBSC6900NONOWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceEnumeration TypePEER(PEER), LOCAL(LOCAL)PEER, LOCALNoneLOCALLOCALAAL2 pathNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport19ADD AAL2PATH(Optional)MOD AAL2PATH(Optional)TRM load threshold indexMNG LITRM load threshold index. The TRM load threshold must be configured.AAL2PATHTRMLOADTHINDEXTRMLOADTHINDEXBSC6900NONOWRFD-050406ATM QoS Introduction on Hub NodeB (Overbooking on Hub Node B Transmission)Interval Type0~1990~199None00BSC6900NoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedThe TRM load threshold must be configured already.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport20ADD AAL2PATH(Optional)MOD AAL2PATH(Optional)Timer_CU timerMNG LITimer_CU timer. The parameter affects the AAL2 transport efficiency and transport delay.AAL2PATHTIMERCUTIMERCUBSC6900NONOWRFD-050301ATM Transmission Introduction PackageInterval Type1~641~64, step:0.05ms1010AAL2 pathNoneRead & WriteYAAL2 pathLess than 5 minutesNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport21ADD AAL2RT(Mandatory)Destination ATM addressMNG LIATM address of the destination node of the AAL2 route. The value is entered in the hexadecimal format, with the length ranging from 2 bytes to 21 bytes (including the 1-byte H' prefix). It is recommended that the initial byte of the ATM address uses H'45 (indicating E.164 address) or H'39 (indicating the DCC address) or H'47 (indicating the ICD address). The ATM address starting with H'45 close to seven and half bytes of the H'45 must be in the BCD code (15-bit digit). The following is the DSP. When the DSP is all-zero, it is E.164e, for example, 0x45000971500202001F0000000000000000000000. When the DSP is not all zero, it is E.164A. The ATM address is allocated uniquely in the ATM network. The H'45 format is recommended.AAL2RTNSAPNSAPBSC6900NOYESWRFD-050301ATM Transmission Introduction PackageAny TypeNoneNoneNoneNoneNoneBSC6900NoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport22ADD AAL2RT(Mandatory)Adjacent Node IDMNG LIUniquely identifies an adjacent nodeAAL2RTANIANIBSC6900NOYESWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceInterval Type0~45990~4599NoneNoneNoneAdjacent nodeNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport23ADD AAL2RT(Optional)MOD AAL2RT(Mandatory)Destination ATM address ownershipMNG LIWhether to indicate that the " destination ATM node " is the same as the ATM node specified by the " adjacent node ID ".AAL2RTOWNERSHIPOWNERSHIPBSC6900NONOWRFD-050301ATM Transmission Introduction PackageEnumeration TypeNO(ATM_ADDRESS_DOES_NOT_BELONG_TO_THIS_ADJACENT_NODE), YES(ATM_ADDRESS_BELONGS_TO_THIS_ADJACENT_NODE)NO, YESNoneYESYESBSC6900NoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedModified according to practical networking.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport24ADD AAL2RT(Optional)MOD AAL2RT(Mandatory)RMV AAL2RT(Mandatory)Route indexMNG LIRoute logical numberAAL2RTRTXRTXBSC6900YESNOWRFD-050301ATM Transmission Introduction PackageInterval Type0~42949672950~4294967295NoneNoneNoneBSC6900NoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport25ADD ADJMAP(Mandatory)MOD ADJMAP(Mandatory)RMV ADJMAP(Mandatory)Adjacent Node IDMNG LIUniquely identifies an adjacent nodeADJMAPANIANIBSC6900YESYESWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceInterval Type0~45990~4599NoneNoneNoneAdjacent nodeNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport26ADD ADJMAP(Mandatory)MOD ADJMAP(Mandatory)RMV ADJMAP(Mandatory)Interface TypeMNG LIType of the adjacent nodeADJMAPITFTITFTBSC6900NOYESNoneNoneEnumeration TypeIUB(Iub Interface), IUR(Iur Interface), IUCS(Iu-CS Interface), IUPS(Iu-PS Interface)IUB, IUR, IUCS, IUPSNoneNoneNoneBSC6900NoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport27ADD ADJMAP(Mandatory)MOD ADJMAP(Mandatory)RMV ADJMAP(Mandatory)Resource Management ModeMNG LIResource management mode. When the interface type is IUB, the value can be set to SHARE or EXCLUSIVE. When the interface type is IUR, IUCS, or IUPS, the value can be set to SHARE only.ADJMAPCNMNGMODECNMNGMODEBSC6900YESYESWRFD-021305RAN Sharing Phase 2Enumeration TypeSHARE(SHARE), EXCLUSIVE(EXCLUSIVE)SHARE, EXCLUSIVENoneNoneNoneAdjacent nodeNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport28ADD ADJMAP(Mandatory)MOD ADJMAP(Mandatory)RMV ADJMAP(Mandatory)CN Operator indexMNG LIOperator index of the resource groupADJMAPCNOPINDEXCNOPINDEXBSC6900YESYESWRFD-021305RAN Sharing Phase 2Interval Type0~30~3NoneNoneNoneTransmission resource groupWhen "RSCMNGMODE" in "ADD RSCGRP" is set to EXCLUSIVE, this parameter is valid.Read & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Equipment29ADD ADJMAP(Mandatory)MOD ADJMAP(Optional)Transport Type of the adjacent node and interface typeMNG LITransport type of the adjacent node and interface typeADJMAPTRANSTTRANSTBSC6900NOYESWRFD-021305RAN Sharing Phase 2Enumeration TypeATM(ATM), IP(IP), ATM_IP(ATM and IP), HYBRID_IP(HYBRID IP)ATM, IP, ATM_IP, HYBRID_IPNoneNoneNoneBSC6900When the value of "ITFT" in "ADD TRMMAP" is set to IUB, IUR, IUCS, this parameter is valid.Read & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport30ADD ADJMAP(Mandatory)MOD ADJMAP(Optional)Gold user TRMMAP indexMNG LIGold user TRMMAP index used by the current adjacent nodeADJMAPTMIGLDTMIGLDBSC6900NOYESWRFD-021305RAN Sharing Phase 2Interval Type0~1630~163NoneNoneNoneAdjacent nodeThe TRMMAP index is configured by setting the value of "TMI" in "ADD TRMMAP".Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedThe TRMMAP must be configured.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport31ADD ADJMAP(Mandatory)MOD ADJMAP(Optional)Silver user TRMMAP indexMNG LISilver user TRMMAP index used by the current adjacent nodeADJMAPTMISLVTMISLVBSC6900NOYESWRFD-021305RAN Sharing Phase 2Interval Type0~1630~163NoneNoneNoneAdjacent nodeThe TRMMAP index is configured by setting the value of "TMI" in "ADD TRMMAP".Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedThe TRMMAP must be configured.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport32ADD ADJMAP(Mandatory)MOD ADJMAP(Optional)Bronze user TRMMAP indexMNG LIBronze user TRMMAP index used by the current adjacent nodeADJMAPTMIBRZTMIBRZBSC6900NOYESWRFD-021305RAN Sharing Phase 2Interval Type0~1630~163NoneNoneNoneAdjacent nodeThe TRMMAP index is configured by setting the value of "TMI" in "ADD TRMMAP".Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedThe TRMMAP must be configured.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport33ADD ADJMAP(Mandatory)MOD ADJMAP(Optional)Factor table indexMNG LIActivation factor table indexADJMAPFTIFTIBSC6900NOYESWRFD-050406ATM QoS Introduction on Hub NodeB (Overbooking on Hub Node B Transmission)Interval Type0~330~33NoneNoneNoneAdjacent nodeThe factor table index is configured by setting the value of "FTI" in "ADD FACTORTABLE".Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedThe FACTORTABLE must be configured.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport34ADD ADJMAP(Mandatory)MOD ADJMAP(Optional)Gold user Load EQ indexMNG LIGold user load EQ index used by the current adjacent nodeADJMAPLEIGLDLEIGLDBSC6900NOYESWRFD-021305RAN Sharing Phase 2Interval Type0~630~63NoneNoneNoneAdjacent nodeThe load EQ table index is configured by setting the value of "LEI" in "ADD LOADEQ".Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedThe load EQ table is configured already.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport35ADD ADJMAP(Mandatory)MOD ADJMAP(Optional)Silver user Load EQ indexMNG LISilver user load EQ index used by the current adjacent nodeADJMAPLEISLVLEISLVBSC6900NOYESWRFD-021305RAN Sharing Phase 2Interval Type0~630~63NoneNoneNoneAdjacent nodeThe load EQ table index is configured by setting the value of "LEI" in "ADD LOADEQ".Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedThe load EQ table is configured already.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport36ADD ADJMAP(Mandatory)MOD ADJMAP(Optional)Bronze user Load EQ indexMNG LIBronze user load EQ index used by the current adjacent nodeADJMAPLEIBRZLEIBRZBSC6900NOYESWRFD-021305RAN Sharing Phase 2Interval Type0~630~63NoneNoneNoneAdjacent nodeThe load EQ table index is configured by setting the value of "LEI" in "ADD LOADEQ".Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedThe load EQ table is configured already.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport37ADD ADJNODE(Mandatory)NodeB IDMNG LIID of the adjacent node to be added. The parameter is valid when Adjacent node type is set to IUB.ADJNODENODEBIDNODEBIDBSC6900NOYESWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceInterval Type0~655350~65535NoneNoneNoneAdjacent nodeWhen the value of "NODET" in "ADD ADJNODE" is set to IUB, this parameter is valid.Read & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport38ADD ADJNODE(Mandatory)SGSN FLAGMNG LIThis parameter is valid when the node type is set to IUPS. If the parameter is set to No, it indicates the GGSN. The dpx needs not to be configured.ADJNODESGSNFLGSGSNFLGBSC6900NOYESWRFD-020111One TunnelEnumeration TypeNO(GGSN), YES(SGSN)NO, YESNoneNoneNoneAdjacent nodeWhen the value of "NODET" in "ADD ADJNODE" is set to IUPS, this parameter is valid.Read & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport39ADD ADJNODE(Mandatory)DPX IndexMNG LIThis parameter is valid when the node type is set to IUR, IUCS, IUPS, or NNI_AAL2SWITCH.ADJNODEDPXDPXBSC6900NOYESWRFD-0101013GPP SpecificationsInterval Type0~1860~186NoneNoneNoneAdjacent nodeWhen the value of "NODET" in "ADD ADJNODE" is set to IUR, IUCS, or NNI_AAL2SWITCH, or the value of "NODET" in "ADD ADJNODE" is set to IUPS and "SGSNFLG" in "ADD ADJNODE" is set to YES, this parameter is valid.Read & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport40ADD ADJNODE(Mandatory)Upper AniMNG LIWhether to indicate it is the upper level adjacent node when "Is Root Node" is set to No.ADJNODEUPPERANIUPPERANIBSC6900NOYESWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceInterval Type0~45990~4599NoneNoneNoneAdjacent nodeWhen the value of "IsROOTNODE" in "ADD ADJNODE" is set to NO, this parameter is valid.Read & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport41ADD ADJNODE(Mandatory)MOD ADJNODE(Mandatory)RMV ADJNODE(Mandatory)Adjacent Node IDMNG LIUniquely identifies an adjacent nodeADJNODEANIANIBSC6900YESYESWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceInterval Type0~45990~4599NoneNoneNoneAdjacent nodeNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport42ADD ADJNODE(Mandatory)MOD ADJNODE(Optional)Adjacent Node NameMNG LIName of the adjacent nodeADJNODENAMENAMEBSC6900NOYESNoneNoneString TypeNone1~31 charactersNoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport43ADD ADJNODE(Mandatory)MOD ADJNODE(Optional)Adjacent Node TypeMNG LIType of the adjacent nodeADJNODENODETNODETBSC6900NOYESWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceEnumeration TypeIUB(Iub Interface), IUR(Iur Interface), IUCS(Iu-CS Interface), IUPS(Iu-PS Interface), UNI_AAL2SWITCH(the adjacent node of the ATM switch on the Iub interface), NNI_AAL2SWITCH(the adjacent node of ATM switch on Iur or Iu-CS interface)IUB, IUR, IUCS, IUPS, UNI_AAL2SWITCH, NNI_AAL2SWITCHNoneNoneNoneAdjacent nodeNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport44ADD ADJNODE(Mandatory)MOD ADJNODE(Optional)Transport TypeMNG LITransport typeADJNODETRANSTTRANSTBSC6900NOYESWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceEnumeration TypeATM(ATM), IP(IP), ATM_IP(ATM and IP), HYBRID_IP(HYBRID IP)ATM, IP, ATM_IP, HYBRID_IPNoneNoneNoneAdjacent nodeWhen the value of "NODET" in "ADD ADJNODE" is set to IUB, IUR, IUCS, or IUPS, this parameter is valid.Read & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport45ADD ADJNODE(Mandatory)MOD ADJNODE(Optional)Is Root NodeMNG LIWhether to indicate it is the root node when the transport type is ATM or ATM_IPADJNODEIsROOTNODEISROOTNODEBSC6900NOYESWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceEnumeration TypeNO(Not Root Node), YES(Root Node)NO, YESNoneNoneNoneAdjacent nodeWhen the value of "NODET" in "ADD ADJNODE" is set to IUB, IUR, or IUCS, and the value of "TRANST" in "ADD ADJNODE" is set to ATM or ATM_IP, this parameter is valid.Read & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport46ADD ADJNODE(Mandatory)MOD ADJNODE(Optional)Subrack No.MNG LINumber of the subrackADJNODESRNSRNBSC6900NOYESNoneNoneInterval Type0~110~11NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport47ADD ADJNODE(Mandatory)MOD ADJNODE(Optional)Slot No.MNG LIThis parameter is valid when the node type is set to UNI_AAL2SWITCH. It is the slot number of the SAAL link of the AAL2 signaling bearing the adjacent node.ADJNODESNSNBSC6900NOYESNoneNoneInterval Type0,2,4,8,10,12,14,16,18,20,22,24,260, 2, 4, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26NoneNoneNoneAdjacent nodeWhen the value of "NODET" in "ADD ADJNODE" is set to IUB, and the value of "IsROOTNODE" in "ADD ADJNODE" is set to YES, or the value of "NODET" in "ADD ADJNODE" is set to UNI_AAL2SWITCH, this parameter is valid.Read & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport48ADD ADJNODE(Mandatory)MOD ADJNODE(Optional)SAAL link No.MNG LISAAL link number of the XPU board. This number identifies an SAAL link uniquely.ADJNODESAALLNKNSAALLNKNBSC6900NOYESWRFD-050301ATM Transmission Introduction PackageInterval Type0~13990~1399NoneNoneNoneSAAL linkNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport49ADD ADJNODE(Optional)MOD ADJNODE(Optional)Qaal2 Protocol VersionMNG LIFunction set of the adjacent node supported by local BSC6900. When the parameter is set to CS1, it indicates that the local BSC6900 is interconnected to the adjacent node by using the CS1 protocol version. When the parameter is set to CS2, it indicates that the local BSC6900 is interconnected to the adjacent node by using the CS2 protocol version. The CS2 protocol version is backward compatible with the CS1. By default, the parameter is set to CS2. When the peer is not compatible with the local CS2 messages (the peer does not process the compatible domain according to protocol requirements), the protocol version is set to CS1.ADJNODEQAAL2VERQAAL2VERBSC6900NONOWRFD-05030104Dynamic AAL2 Connections in Iub/IuCS/Iur InterfaceEnumeration TypeCS1(CS1 Version), CS2(CS2 Version)CS1, CS2NoneCS2CS2Adjacent nodeWhen the value of "NODET" in "ADD ADJNODE" is set to IUB, IUR, or IUCS, and the value of "IsROOTNODE" in "ADD ADJNODE" is set to YES, or the value of "NODET" in "ADD ADJNODE" is set to UNI_AAL2SWITCH or NNI_AAL2SWITCH, this parameter is valid.Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedWhen the parameter is set to CS1, it indicates that the local RNC is interconnected to the adjacent node by using the CS1 protocol version. When the parameter is set to CS2, it indicates that the local RNC is interconnected to the adjacent node by using the CS2 protocol version. The CS2 protocol version is backward compatible with the CS1. By default, the parameter is set to CS2. When the peer is not compatible with the local CS2 messages (the peer does not process the compatible domain according to protocol requirements), the protocol version is set to CS1.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport50ADD ATMLOGICPORT(Mandatory)The bearing type of the logic portMNG LIBearer type of the logical portATMLOGICPORTCARRYTCARRYTBSC6900NOYESNoneNoneEnumeration TypeIMA, UNI, FRA, NCOPT, ATMLOGICPORTIMA, UNI, FRA, NCOPT, ATMLOGICPORTNoneNoneNoneATM logical portNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport51ADD ATMLOGICPORT(Mandatory)MOD ATMLOGICPORT(Mandatory)Type of the logic portMNG LIType of logical portATMLOGICPORTLPNTYPELPNTYPEBSC6900NOYESNoneNoneEnumeration TypeHub(Hub), Leaf(Leaf)Hub, LeafNoneNoneNoneATM logical portNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport52ADD ATMLOGICPORT(Mandatory)MOD ATMLOGICPORT(Optional)Forward bandwidth [kbps]MNG LIBackward bandwidth of the logical portATMLOGICPORTTXBWTXBWBSC6900NOYESNoneNoneInterval Type512~149000512~149000kbit/sNoneNoneATM logical portNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport53ADD ATMLOGICPORT(Mandatory)MOD ATMLOGICPORT(Optional)Backward bandwidth [kbps]MNG LIBackward bandwidth of the logical portATMLOGICPORTRXBWRXBWBSC6900NOYESNoneNoneInterval Type512~149000512~149000kbit/sNoneNoneATM logical portNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport54ADD ATMLOGICPORT(Mandatory)RMV ATMLOGICPORT(Mandatory)MOD ATMLOGICPORT(Mandatory)Subrack No.MNG LINumber of the subrackATMLOGICPORTSRNSRNBSC6900YESYESMRFD-210301Configuration ManagementInterval Type0~110~11NoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment55ADD ATMLOGICPORT(Mandatory)RMV ATMLOGICPORT(Mandatory)MOD ATMLOGICPORT(Mandatory)Slot No.MNG LIIndicates the slot number for running this commandATMLOGICPORTSNSNBSC6900YESYESNoneNoneInterval Type0~5,8~270~5, 8~27NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Equipment56ADD ATMLOGICPORT(Optional)The logic port numberMNG LILogical port numberATMLOGICPORTLPNLPNBSC6900YESNONoneNoneInterval Type0~499,512~7670~499, 512~767NoneNoneNoneNoneNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport57ADD ATMLOGICPORT(Optional)IMA group No.MNG LIIMA group number of the logical portATMLOGICPORTCARRYIMAGRPNCARRYIMAGRPNBSC6900NONONoneNoneInterval Type0~1670~167NoneNoneNoneATM logical portNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport58ADD ATMLOGICPORT(Optional)Bearing UNI link No.MNG LIUNI link numberATMLOGICPORTCARRYUNILNKNCARRYUNILNKNBSC6900NONONoneNoneInterval Type0~3350~335NoneNoneNoneATM logical portNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport59ADD ATMLOGICPORT(Optional)FRAATM link No.MNG LIFractional ATM link number of the logical portATMLOGICPORTCARRYFRAATMLNKNCARRYFRAATMLNKNBSC6900NONONoneNoneInterval Type0~310~31NoneNoneNoneATM logical portNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport60ADD ATMLOGICPORT(Optional)Optical port No.MNG LIOptical interface number of the logical portATMLOGICPORTCARRYPNCARRYPNBSC6900NONONoneNoneInterval Type0~70~7NoneNoneNoneATM logical portNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport61ADD ATMLOGICPORT(Optional)The Upper Logic port NumberMNG LIUpper number of the logical portATMLOGICPORTUPPERVPUPPERVPBSC6900NONONoneNoneInterval Type128~447,512~767128~191(AEUa), 256~383(AOUa), 384~447(UOIa_ATM), 512~767(AOUc), 512~767(UOIc)NoneNoneNoneNoneNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport62ADD ATMLOGICPORT(Optional)Resource management modeMNG LIResource management mode of logical portATMLOGICPORTRSCMNGMODERSCMNGMODEBSC6900NONONoneNoneEnumeration TypeSHARE, EXCLUSIVESHARE, EXCLUSIVENoneNoneNoneATM logical portNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport63ADD ATMLOGICPORT(Optional)CN operator indexMNG LIIndex of the operatorATMLOGICPORTCNOPINDEXCNOPINDEXBSC6900NONONoneNoneInterval Type0~30~3NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Equipment64ADD ATMLOGICPORT(Optional)Flow control parameter indexMNG LIFlow control parameter indexATMLOGICPORTFCINDEXFCINDEXBSC6900NONONoneNoneInterval Type0~19990~1999None11ATM logical portNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedFlow control function can be affected if this parameter is modified.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport65ADD ATMLOGICPORT(Optional)TRM load threshold indexMNG LITRM load threshold indexATMLOGICPORTTRMLOADTHINDEXTRMLOADTHINDEXBSC6900NONONoneNoneInterval Type0~1990~199None00NoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport66ADD ATMLOGICPORT(Optional)MOD ATMLOGICPORT(Optional)Board typeMNG LIBoard typeATMLOGICPORTBTBTBSC6900NONONoneNoneEnumeration TypeAEUa, AOUa, UOIa, AOUc, UOIcAEUa, AOUa, UOIa, AOUc, UOIcNoneNoneNoneNoneNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport67ADD ATMLOGICPORT(Optional)MOD ATMLOGICPORT(Optional)Flow control switchMNG LILogical port flow control switchATMLOGICPORTFLOWCTRLSWITCHFLOWCTRLSWITCHBSC6900NONONoneNoneEnumeration TypeOFF(OFF), ON(ON)OFF, ONNoneONONATM logical portNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedflow control function can be affected if this parameter is modified.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport68ADD ATMTRF(Mandatory)Service typeMNG LIService type in the ATMATMTRFSTSTBSC6900NOYESNoneNoneEnumeration TypeUBR, CBR, RTVBR, NRTVBR, UBR_PLUSUBR, CBR, RTVBR, NRTVBR, UBR_PLUSNoneNoneIt is recommended that the service type of signaling link be CBR, the real-time service be CBR or RTVBR, the non-real-time service be NRTVBR, and the OAM data link be UBR_PLUS.PVCNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport69ADD ATMTRF(Mandatory)RMV ATMTRF(Mandatory)MOD ATMTRF(Mandatory)Traffic indexMNG LITraffic indexATMTRFTRFXTRFXBSC6900YESYESNoneNoneInterval Type100~1999100~1999NoneNoneNoneNoneNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport70ADD ATMTRF(Optional)Rate unitMNG LIRate unitATMTRFUTUTBSC6900NONONoneNoneEnumeration TypeCELL/S, KBIT/SCELL/S, KBIT/SNoneNoneNonePVCNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport71ADD ATMTRF(Optional)Peak cell rateMNG LIPeak rate of the ATM trafficATMTRFPCRPCRBSC6900NONONoneNoneInterval Type30~35320730~353207NoneNoneNonePVCNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport72ADD ATMTRF(Optional)Sustainable cell rateMNG LIAverage rate of the ATM trafficATMTRFSCRSCRBSC6900NONONoneNoneInterval Type30~11792430~117924NoneNoneNonePVCNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport73ADD ATMTRF(Optional)Minimum cell rateMNG LIMinimum guarantee rate of the ATM trafficATMTRFMCRMCRBSC6900NONONoneNoneInterval Type30~7075430~70754NoneNoneNonePVCNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport74ADD ATMTRF(Optional)Max burst sizeMNG LIMaximum burst size (MBS)ATMTRFMBSMBSBSC6900NONONoneNoneInterval Type3~100003~10000byteNone1000PVCNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport75ADD ATMTRF(Optional)Cell delay variation toleranceMNG LITolerable delay jitterATMTRFCDVTCDVTBSC6900NONONoneNoneInterval Type1024~2120001024~212000100ns10241024PVCNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport76ADD ATMTRF(Optional)MOD ATMTRF(Mandatory)Traffic use descriptionMNG LIPurpose description of the ATM traffic recordATMTRFREMARKREMARKBSC6900NONONoneNoneString TypeNone1~250 charactersNoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport77ADD BRD(Mandatory)Board ClassMNG LIClasses of boards classified according to function modulesBRDBRDCLASSBRDCLASSBSC6900NOYESMRFD-210301Configuration ManagementConfiguration ManagementEnumeration TypeINT, DPU, XPU, OMU, SAUINT, DPU, XPU, OMU, SAUNoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment78ADD BRD(Mandatory)BackupMNG LIWhether to back up the data of the boardBRDREDREDBSC6900NOYESMRFD-210301Configuration ManagementEnumeration TypeYES(YES), NO(NO)YES, NONoneNoneNoneBoardNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment79ADD BRD(Mandatory)RMV BRD(Mandatory)MOD BRD(Mandatory)Subrack No.MNG LINumber of the subrackBRDSRNSRNBSC6900NOYESMRFD-210301Configuration ManagementInterval Type0~110~11NoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment80ADD BRD(Mandatory)RMV BRD(Mandatory)MOD BRD(Mandatory)Slot No.MNG LINumber of the slotBRDSNSNBSC6900NOYESMRFD-210301Configuration ManagementInterval Type0~270~27NoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment81ADD BRD(Optional)Board TypeMNG LIType of the boardBRDBRDTYPEBRDTYPEBSC6900NONOMRFD-210301Configuration ManagementEnumeration TypePEUa, AEUa, FG2a, GOUa, AOUa, POUa, UOIa, AOUc, POUc, UOIc, FG2c, GOUc, SPUa, SPUb, DPUb, DPUe, OMUa, OMUb, SAUaPEUa, AEUa, FG2a, GOUa, AOUa, POUa, UOIa, AOUc, POUc, UOIc, FG2c, GOUc, SPUa, SPUb, DPUb, DPUe, OMUa, OMUb, SAUaNoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment82ADD BRD(Optional)Logical function typeMNG LILogical function type of the boardOAM:Operation And Maintenance ProcessUCP:All the UCP subsystems are configured as CPUS to act as the control plane processing subsystems for UMTS RNCRUCP:Subsystem 0 of RUCP is configured as the MPU subsystem to act as the resource management subsystem. The other seven subsystems are configured as CPUS to act as the control plane processing subsystems for UMTS RNCUUP:UMTS RNC User plane ProcessATM:AEUa/ATM ATM over E1/T1/J1 interface,AOUa/ATM ATM over channelized Optical STM-1/OC-3 interface,AOUc/ATM ATM over channelized Optical STM-1/OC-3 interface,UOIa/ATM ATM over Unchannelized Optical STM-1/OC-3 interface,UOIc/ATM ATM over Unchannelized Optical STM-1/OC-3 interfaceIP:GOUc/IP IP over GE Optical interface,GOUa/IP IP over GE Optical interface,PEUa/IP IP over E1/T1/J1 interface,FG2c/IP IP over FE/GE interface,FG2a/IP IP over FE/GE interface,POUc/IP IP over channelized Optical STM-1/OC-3 interface,POUa/IP IP over channelized Optical STM-1/OC-3 interface,UOIa/IP IP over Unchannelized Optical STM-1/OC-3 interfaceSAU:System Aware UintBRDLGCAPPTYPELGCAPPTYPEBSC6900NONOMRFD-210301Configuration ManagementEnumeration TypeOAM, UCP, RUCP, UUP, ATM, IP, SAUOAM, UCP, RUCP, UUP, ATM, IP, SAUNoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment83ADD BRD(Optional)MPU Subrack No.MNG LINumber of the subrack where the MPU subsystem is locatedBRDMPUSUBRACKMPUSUBRACKBSC6900NONOMRFD-210301Configuration ManagementInterval Type0~110~11NoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment84ADD BRD(Optional)MPU Slot No.MNG LINumber of the slot where the MPU subsystem is locatedBRDMPUSLOTMPUSLOTBSC6900NONOMRFD-210301Configuration ManagementInterval Type0~270~27NoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment85ADD BRD(Optional)Support FRAMNG LIWhether to support the FRA (E1/T1 frame relay interface board)BRDISSUPPORTFRAISSUPPORTFRABSC6900NONOMRFD-210301Configuration ManagementEnumeration TypeNO(NO), YES(YES)NO, YESNoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment86ADD CAB(Mandatory)RMV CAB(Mandatory)Cabinet No.MNG LINumber of the cabinetCABCNCNBSC6900NOYESMRFD-210301Configuration ManagementInterval Type1~31~3NoneNoneNoneNoneNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Equipment87ADD CCG(Mandatory)RMV CCG(Mandatory)Command GroupMNG LICustomized command group to be processedCCGCGCGBSC6900NOYESMRFD-210305Security ManagementEnumeration TypeG_15, G_16, G_17, G_18, G_19, G_20, G_21, G_22, G_23, G_24, G_25, G_26, G_27, G_28, G_29, G_30, G_31G_15, G_16, G_17, G_18, G_19, G_20, G_21, G_22, G_23, G_24, G_25, G_26, G_27, G_28, G_29, G_30, G_31NoneNoneNoneBSC6900NoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment88ADD CCG(Mandatory)RMV CCG(Mandatory)Command NameMNG LIYou can select one or more commands.CCGCMDCMDBSC6900NOYESMRFD-210305Security ManagementString TypeNone0~128 charactersNoneNoneNoneBSC6900NoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment89ADD CFMMA(Mandatory)MD IndexMNG LIIdentifies a maintenance domainCFMMAMDIDXMDIDXBSC6900YESYESWRFD-050425Ethernet OAMInterval Type0~70~7NoneNoneNoneBoardNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport90ADD CFMMA(Mandatory)VLAN IDMNG LIVLAN of the MA in the MDCFMMAVLANIDVLANIDBSC6900NOYESWRFD-050425Ethernet OAMInterval Type2~40942~4094NoneNoneNoneEthernet portNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport91ADD CFMMA(Mandatory)MA NameMNG LIName of the MACFMMAMANAMEMANAMEBSC6900NOYESNoneNoneString TypeNone1~20 charactersNoneNoneNoneEthernet portNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport92ADD CFMMA(Mandatory)RMV CFMMA(Mandatory)Subrack No.MNG LINumber of the subrackCFMMASRNSRNBSC6900YESYESMRFD-210301Configuration ManagementInterval Type0~110~11NoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment93ADD CFMMA(Mandatory)RMV CFMMA(Mandatory)Slot No.MNG LIIndicates the slot number for running this commandCFMMASNSNBSC6900YESYESNoneNoneInterval Type0~5,8~270~5, 8~27NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Equipment94ADD CFMMA(Mandatory)RMV CFMMA(Mandatory)MA IndexMNG LIIdentifies a maintenance group.Maintenance group: maintenance alliance (MA), which is a component of the maintenance domain (MD). Maintenance domain is an Ethernet or a component of an Ethernet in which the connectivity failure management is performed. The maintenance domain is uniformly managed by one ISP. One MD can be divided into one or more maintenance group.CFMMAMAIDXMAIDXBSC6900NOYESWRFD-050425Ethernet OAMInterval Type0~4990~499NoneNoneNoneBoardNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport95ADD CFMMA(Optional)CCM Send PridMNG LITransmission period of the CCM packet in the MACFMMACCMINTERVALCCMINTERVALBSC6900NONOWRFD-050425Ethernet OAMEnumeration Type10, 100, 100010, 100, 1000ms10001000Ethernet portNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport96ADD CFMMD(Mandatory)Subrack No.MNG LIThe subrack number for running this commandCFMMDSRNSRNBSC6900YESYESNoneNoneInterval Type0~110~11NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Equipment97ADD CFMMD(Mandatory)MD NameMNG LIname of the MDCFMMDMDNameMDNAMEBSC6900NOYESNoneNoneString TypeNone1~20 charactersNoneNoneNoneEthernet portNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport98ADD CFMMD(Mandatory)RMV CFMMD(Mandatory)Slot No.MNG LIIndicates the slot number for running this commandCFMMDSNSNBSC6900YESYESNoneNoneInterval Type0~5,8~270~5, 8~27NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Equipment99ADD CFMMD(Mandatory)RMV CFMMD(Mandatory)MD IndexMNG LIIdentifies a maintenance domainCFMMDMDIDXMDIDXBSC6900YESYESWRFD-050425Ethernet OAMInterval Type0~70~7NoneNoneNoneBoardNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport100ADD CFMMD(Optional)MD LevelMNG LIClass of the maintenance domainCFMMDLevelLEVELBSC6900NONOWRFD-050425Ethernet OAMInterval Type0~70~7None00Ethernet portNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport101ADD CFMMEP(Mandatory)MEP TypeMNG LIThe type of the maintenance point added to the maintenance group. LocalMep indicates a local maintenance point and RemoteMep indicates a remote maintenance point.CFMMEPMEPTYPEMEPTYPEBSC6900YESYESWRFD-050425Ethernet OAMEnumeration TypeLocalMep(LocalMep), RemoteMep(RemoteMep)LocalMep, RemoteMepNoneNoneNoneEthernet portNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Transport102ADD CFMMEP(Mandatory)Port TypeMNG LIIndicates the type of the physical port used by the local maintenance point in the maintenance group. FE indicates the FE port and TRUNK indicates the aggregation group.CFMMEPPORTTYPEPORTTYPEBSC6900NOYESWRFD-050425Ethernet OAMEnumeration TypeETHER, TRUNKETHER, TRUNKNoneNoneNoneEthernet portNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport103ADD CFMMEP(Mandatory)Port No.MNG LIEthernet portCFMMEPPNPNBSC6900NOYESNoneNoneInterval Type0~110~7(FG2a), 0~1(GOUa), 0~11(FG2c), 0~3(GOUc)NoneNoneNoneEthernet portIf port 0 or port 4 of the FG2a board is set to the GE port, the port number can only be 0 or 4. Otherwise, the port number ranges from 0 to 7. If only port 0 is set to the GE port, ports 1-3 are unavailable. If port 4 is set to the GE port, ports 5-7 are unavailable.Read & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport104ADD CFMMEP(Mandatory)Trunk No.MNG LITRUNK group numberCFMMEPTRUNKNTRUNKNBSC6900NOYESWRFD-050425Ethernet OAMInterval Type0~110~11NoneNoneNoneEthernet portNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport105ADD CFMMEP(Mandatory)RMV CFMMEP(Mandatory)Subrack No.MNG LINumber of the subrackCFMMEPSRNSRNBSC6900YESYESMRFD-210301Configuration ManagementInterval Type0~110~11NoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment106ADD CFMMEP(Mandatory)RMV CFMMEP(Mandatory)MA IndexMNG LIIdentifies a maintenance group.Maintenance group: maintenance alliance (MA), which is a component of the maintenance domain (MD). Maintenance domain is an Ethernet or a component of an Ethernet in which the connectivity failure management is performed. The maintenance domain is uniformly managed by one ISP. One MD can be divided into one or more maintenance group.CFMMEPMAIDXMAIDXBSC6900YESYESWRFD-050425Ethernet OAMInterval Type0~4990~499NoneNoneNoneBoardNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport107ADD CFMMEP(Mandatory)RMV CFMMEP(Mandatory)MEP IDMNG LIIdentifies a maintenance point in the maintenance allianceA maintenance point is an edge node of the MA.CFMMEPMEPIDMEPIDBSC6900YESYESWRFD-050425Ethernet OAMInterval Type1~10001~1000NoneNoneNoneEthernet portNoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport108ADD CFMMEP(Mandatory)RMV CFMMEP(Mandatory)Slot No.MNG LIIndicates the slot number for running this commandCFMMEPSNSNBSC6900NOYESNoneNoneInterval Type0~5,8~270~5, 8~27NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Equipment109ADD CLKSRC(Mandatory)Clock source typeMNG LIType of the clock source.CLKSRCSRCTSRCTBSC6900NOYESMRFD-210502BSC/RNC ClockEnumeration TypeBITS1-2MHZ(2MHZ Building Integrated Timing Supply system 1), BITS2-2MHZ(2MHZ Building Integrated Timing Supply system 2), BITS1-2MBPS(2MBPS Building Integrated Timing Supply system 1), BITS2-2MBPS(2MBPS Building Integrated Timing Supply system 2), 8KHZ(8KHZ), GPS(Globe Positioning System), LINE1_8KHZ(8KHZ line1), LINE2_8KHZ(8KHZ line2), BITS1-T1BPS(T1BPS Building Integrated Timing Supply system 1), BITS2-T1BPS(T1BPS Building Integrated Timing Supply system 2)BITS1-2MHZ, BITS2-2MHZ, BITS1-2MBPS, BITS2-2MBPS, GPS, 8KHZ, LINE1_8KHZ, LINE2_8KHZ, BITS1-T1BPS, BITS2-T1BPSNoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedClock sources and priorities are in one-to-one mapping. Each backplane board 8K clock has only one clock source.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment110ADD CLKSRC(Mandatory)RMV CLKSRC(Mandatory)Clock source priorityMNG LIPriority of the clock source.CLKSRCSRCGRDSRCGRDBSC6900NOYESMRFD-210502BSC/RNC ClockInterval Type1~41~4NoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedClock sources and priorities are in one-to-one mapping.The parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment111ADD DEVIP(Mandatory)Subrack No.MNG LINumber of the subrackDEVIPSRNSRNBSC6900NOYESMRFD-210301Configuration ManagementInterval Type0~110~11NoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment112ADD DEVIP(Mandatory)Slot No.MNG LIIndicates the slot number for running this commandDEVIPSNSNBSC6900NOYESNoneNoneInterval Type0~5,8~270~5, 8~27NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Equipment113ADD DEVIP(Mandatory)Device IP Address TypeMNG LIDevice IP Address TypeDEVIPDEVTYPEDEVTYPEBSC6900NOYESNoneNoneEnumeration TypeLOGIC_IP(Logical IP Address), IPOA_CLIENT_IP(IPOA Client IP Address)LOGIC_IP, IPOA_CLIENT_IPNoneNoneNoneBSC6900NoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneBSC6900 V900R011Equipment114ADD DEVIP(Mandatory)Subnet maskMNG LISubnet mask of the boardDEVIPMASKMASKBSC6900NOYESNoneNoneIP Address TypeNone0.0.0.0~255.255.255.255NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport115ADD DEVIP(Mandatory)RMV DEVIP(Mandatory)IP addressMNG LIIP address of the boardDEVIPIPADDRIPADDRBSC6900YESYESMRFD-211502IP-Based 2G/3G Co-Transmission on MBSC SideIP Address TypeNone0.0.0.0~255.255.255.255NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport116ADD DEVIP(Optional)MTU[Byte]MNG LIMaximum transmission unitDEVIPMTUMTUBSC6900NONONoneNoneInterval Type776~1696776~1696byte16961696BSC6900NoneRead & WriteYBSC6900If the MTU configuration fails to meet the requirement of the network, the services will be adversely affected.The interconnection may be affected if this parameter is modified.The parameter modification has no impact on the equipment.NoneBSC6900 V900R011Transport117ADD DHCPRLY(Mandatory)Gateway IP address of a DHCP relayMNG LIThis parameter specifies the gateway IP address of a DHCP relay.DHCPRLYDHCPRLYGATEWAYIPDHCPRLYGATEWAYIPBSC6900NOYESNoneNoneIP Address TypeNone0.0.0.0~255.255.255.255NoneNoneNoneBSC6900NoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneBSC6900 V900R011Transport118ADD DHCPRLY(Mandatory)RMV DHCPRLY(Mandatory)ID of a DHCP relayMNG LIThis parameter specifies the ID of a DHCP relay.DHCPRLYDHCPRLYIDDHCPRLYIDBSC6900NOYESNoneNoneInterval Type0~630~63NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneBSC6900 V900R011Equipment119ADD EMSIP(Mandatory)EMS IP AddressMNG LIIP address of the NE management systemEMSIPEMSIPEMSIPBSC6900YESYESNoneNoneIP Address TypeNone0.0.0.0~255.255.255.255NoneNoneNoneBSC6900NoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment120ADD EMSIP(Mandatory)Subnet maskMNG LISubnet mask of the boardEMSIPMASKMASKBSC6900NOYESNoneNoneIP Address TypeNone0.0.0.0~255.255.255.255NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport121ADD EMSIP(Optional)OMU External Network Virtual IPMNG LIExternal virtual IP address of the OMUEMSIPOMUIPOMUIPBSC6900NONONoneNoneIP Address TypeNone0.0.0.0~255.255.255.255NoneNoneNoneBSC6900NoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment122ADD EMSIP(Optional)OMU External Network MaskMNG LISubnet mask of the OMU in the external networkEMSIPOMUMASKOMUMASKBSC6900NONONoneNoneIP Address TypeNone0.0.0.0~255.255.255.255NoneNoneNoneBSC6900NoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment123ADD EMU(Mandatory)RMV EMU(Mandatory)MOD EMU(Mandatory)Subrack No.MNG LINumber of the subrackEMUSRNSRNBSC6900NOYESMRFD-210301Configuration ManagementInterval Type0~110~11NoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment124ADD EMU(Optional)MOD EMU(Optional)Enable Alarm Reporting for 48V PowerMNG LI48V voltage alarm switchEMUVOL48_MASKVOL48_MASKBSC6900NONOMRFD-210304Faulty ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE, OPENNoneOPENNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment125ADD EMU(Optional)MOD EMU(Optional)Enable Alarm Reporting for 24V PowerMNG LI24V voltage alarm switchEMUVOL24_MASKVOL24_MASKBSC6900NONOMRFD-210304Faulty ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE, OPENNoneOPENNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment126ADD EMU(Optional)MOD EMU(Optional)Enable Temperature Alarm ReportingMNG LITemperature alarm switchEMUTEMP_MASKTEMP_MASKBSC6900NONOMRFD-210304Faulty ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE, OPENNoneOPENNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment127ADD EMU(Optional)MOD EMU(Optional)Enable Humidity Alarm ReportingMNG LIHumidity alarm switchEMUHUM_MASKHUM_MASKBSC6900NONOMRFD-210304Faulty ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE, OPENNoneOPENNoneBoardNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment128ADD EMU(Optional)MOD EMU(Optional)Enable Water Alarm ReportingMNG LIWater sensor alarm switchEMUWATER_MASKWATER_MASKBSC6900NONOMRFD-210304Faulty ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE, OPENNoneOPENNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment129ADD EMU(Optional)MOD EMU(Optional)Enable Smoke Alarm ReportingMNG LISmog alarm switchEMUSMOKE_MASKSMOKE_MASKBSC6900NONOMRFD-210304Faulty ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE, OPENNoneOPENNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment130ADD EMU(Optional)MOD EMU(Optional)Infrared alarm switchMNG LIInfrared alarm switchEMUINFRA_RED_MASKINFRA_RED_MASKBSC6900NONOMRFD-210304Faulty ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE, OPENNoneOPENNoneBoardNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment131ADD EMU(Optional)MOD EMU(Optional)Enable Door Status Alarm ReportingMNG LIDoor status alarm switchEMUDOOR_ENGINE_MASKDOOR_ENGINE_MASKBSC6900NONOMRFD-210304Faulty ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE, OPENNoneOPENNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment132ADD EMU(Optional)MOD EMU(Optional)Sensor Type of External Analog 1MNG LISensor type of extended analog signal 1EMUEX_ANO1_TYPEEX_ANO1_TYPEBSC6900NONOMRFD-210301Configuration ManagementEnumeration TypeVOLTAGE(Voltage), CURRENT(Current)VOLTAGE, CURRENTNoneCURRENTNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment133ADD EMU(Optional)MOD EMU(Optional)Sensor Type of External Analog 2MNG LISensor type of extended analog signal 2EMUEX_ANO2_TYPEEX_ANO2_TYPEBSC6900NONOMRFD-210301Configuration ManagementEnumeration TypeVOLTAGE(Voltage), CURRENT(Current)VOLTAGE, CURRENTNoneCURRENTNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment134ADD EMU(Optional)MOD EMU(Optional)Sensor Type of External Analog 3MNG LISensor type of extended analog signal 3EMUEX_ANO3_TYPEEX_ANO3_TYPEBSC6900NONOMRFD-210301Configuration ManagementEnumeration TypeVOLTAGE(Voltage), CURRENT(Current)VOLTAGE, CURRENTNoneCURRENTNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment135ADD EMU(Optional)MOD EMU(Optional)Sensor Type of External Analog 4MNG LISensor type of extended analog signal 4EMUEX_ANO4_TYPEEX_ANO4_TYPEBSC6900NONOMRFD-210301Configuration ManagementEnumeration TypeVOLTAGE(Voltage), CURRENT(Current)VOLTAGE, CURRENTNoneCURRENTNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment136ADD EMU(Optional)MOD EMU(Optional)Upper Limit of Alarm for 48V PowerMNG LIUpper limit for triggering a 48V voltage sensor alarmEMUVOL48_THD_HIGHVOL48_THD_HIGHBSC6900NONOMRFD-210304Faulty ManagementString TypeNone1~9 charactersV57NoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment137ADD EMU(Optional)MOD EMU(Optional)Lower Limit of Alarm for 48V PowerMNG LILower limit for triggering a 48V voltage sensor alarmEMUVOL48_THD_LOWVOL48_THD_LOWBSC6900NONOMRFD-210304Faulty ManagementString TypeNone1~9 charactersV42NoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment138ADD EMU(Optional)MOD EMU(Optional)Upper Limit of Alarm for 24V PowerMNG LIUpper limit for triggering a 24 V voltage sensor alarmEMUVOL24_THD_HIGHVOL24_THD_HIGHBSC6900NONOMRFD-210304Faulty ManagementString TypeNone1~9 charactersV28NoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment139ADD EMU(Optional)MOD EMU(Optional)Lower Limit of Alarm for 24V PowerMNG LILower limit for triggering a 24 V voltage sensor alarmEMUVOL24_THD_LOWVOL24_THD_LOWBSC6900NONOMRFD-210304Faulty ManagementString TypeNone1~9 charactersV20NoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment140ADD EMU(Optional)MOD EMU(Optional)Upper Limit of Temperature AlarmMNG LIUpper limit of temperatureEMUTEMP_THD_HIGHTEMP_THD_HIGHBSC6900NONOMRFD-210304Faulty ManagementString TypeNone1~9 charactersdegree Celsius45NoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment141ADD EMU(Optional)MOD EMU(Optional)Lower Limit of Temperature AlarmMNG LILower limit of temperatureEMUTEMP_THD_LOWTEMP_THD_LOWBSC6900NONOMRFD-210304Faulty ManagementString TypeNone1~9 charactersdegree Celsius0NoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment142ADD EMU(Optional)MOD EMU(Optional)Upper Limit of Humidity AlarmMNG LIUpper limit of humidity. When the humidity exceeds the upper limit, a humidity alarm is reported.EMUHUM_THD_HIGHHUM_THD_HIGHBSC6900NONOMRFD-210304Faulty ManagementString TypeNone1~9 charactersper cent80NoneBoardNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment143ADD EMU(Optional)MOD EMU(Optional)Lower Limit of Humidity AlarmMNG LILower limit of humidity. When the humidity is lower than the lower limit, a humidity alarm is reported.EMUHUM_THD_LOWHUM_THD_LOWBSC6900NONOMRFD-210304Faulty ManagementString TypeNone1~9 charactersper cent10NoneBoardNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment144ADD EMU(Optional)MOD EMU(Optional)Upper Limit of Signal Output of External Analog 1MNG LIUpper limit of extended output analog signal 1. If "Sensor Type of External Analog 1" is set to VOLTAGE, the unit of this parameter is V; if "Sensor Type of External Analog 1" is set to CURRENT, the unit of this parameter is A.EMUEX_ANO1_SIG_MAXEX_ANO1_SIG_MAXBSC6900NONOMRFD-210301Configuration ManagementString TypeNone1~9 charactersV or A0.02NoneNoneIf "Sensor Type of External Analog 1" is set to VOLTAGE, the unit of "Upper Limit of Signal Output of External Analog 1" is V; if "Sensor Type of External Analog 1" is set to CURRENT, the unit of "Upper Limit of Signal Output of External Analog 1" is A.Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment145ADD EMU(Optional)MOD EMU(Optional)Lower Limit of Signal Output of External Analog 1MNG LILower limit of extended output analog signal 1. If "Sensor Type of External Analog 1" is set to VOLTAGE, the unit of this parameter is V; if "Sensor Type of External Analog 1" is set to CURRENT, the unit of this parameter is A.EMUEX_ANO1_SIG_MINEX_ANO1_SIG_MINBSC6900NONOMRFD-210301Configuration ManagementString TypeNone1~9 charactersV or A0.004NoneNoneIf "Sensor Type of External Analog 1" is set to VOLTAGE, the unit of "Lower Limit of Signal Output of External Analog 1" is V; if "Sensor Type of External Analog 1" is set to CURRENT, the unit of "Lower Limit of Signal Output of External Analog 1" is A.Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment146ADD EMU(Optional)MOD EMU(Optional)Upper Limit of Measurement Range of External Analog 1MNG LIMaximum measurement range of extended analog signal 1. If "Sensor Type of External Analog 1" is set to VOLTAGE, the unit of this parameter is V; if "Sensor Type of External Analog 1" is set to CURRENT, the unit of this parameter is A.EMUEX_ANO1_VAL_MAXEX_ANO1_VAL_MAXBSC6900NONOMRFD-210301Configuration ManagementString TypeNone1~9 charactersV or A100NoneNoneIf "Sensor Type of External Analog 1" is set to VOLTAGE, the unit of "Upper Limit of Measurement Range of External Analog 1" is V; if "Sensor Type of External Analog 1" is set to CURRENT, the unit of "Upper Limit of Measurement Range of External Analog 1" is A.Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment147ADD EMU(Optional)MOD EMU(Optional)Lower Limit of Measurement Range of External Analog 1MNG LIMinimum measurement range of extended analog signal 1. If "Sensor Type of External Analog 1" is set to VOLTAGE, the unit of this parameter is V; if "Sensor Type of External Analog 1" is set to CURRENT, the unit of this parameter is A.EMUEX_ANO1_VAL_MINEX_ANO1_VAL_MINBSC6900NONOMRFD-210301Configuration ManagementString TypeNone1~9 charactersV or A0NoneNoneIf "Sensor Type of External Analog 1" is set to VOLTAGE, the unit of "Lower Limit of Measurement Range of External Analog 1" is V; if "Sensor Type of External Analog 1" is set to CURRENT, the unit of "Lower Limit of Measurement Range of External Analog 1" is A.Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment148ADD EMU(Optional)MOD EMU(Optional)Upper Limit of Signal Output of External Analog 2MNG LIUpper limit of extended output analog signal 2. If "Sensor Type of External Analog 2" is set to VOLTAGE, the unit of this parameter is V; if "Sensor Type of External Analog 2" is set to CURRENT, the unit of this parameter is A.EMUEX_ANO2_SIG_MAXEX_ANO2_SIG_MAXBSC6900NONOMRFD-210301Configuration ManagementString TypeNone1~9 charactersV or A0.02NoneNoneIf "Sensor Type of External Analog 2" is set to VOLTAGE, the unit of "Upper Limit of Signal Output of External Analog 2" is V; if "Sensor Type of External Analog 2" is set to CURRENT, the unit of "Upper Limit of Signal Output of External Analog 2" is A.Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment149ADD EMU(Optional)MOD EMU(Optional)Lower Limit of Signal Output of External Analog 2MNG LILower limit of extended output analog signal 2. If "Sensor Type of External Analog 2" is set to VOLTAGE, the unit of this parameter is V; if "Sensor Type of External Analog 2" is set to CURRENT, the unit of this parameter is A.EMUEX_ANO2_SIG_MINEX_ANO2_SIG_MINBSC6900NONOMRFD-210301Configuration ManagementString TypeNone1~9 charactersV or A0.004NoneNoneIf "Sensor Type of External Analog 2" is set to VOLTAGE, the unit of "Lower Limit of Signal Output of External Analog 2" is V; if "Sensor Type of External Analog 2" is set to CURRENT, the unit of "Lower Limit of Signal Output of External Analog 2" is A.Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment150ADD EMU(Optional)MOD EMU(Optional)Upper Limit of Measurement Range of External Analog 2MNG LIMaximum measurement range of extended analog signal 2. If "Sensor Type of External Analog 2" is set to VOLTAGE, the unit of this parameter is V; if "Sensor Type of External Analog 2" is set to CURRENT, the unit of this parameter is A.EMUEX_ANO2_VAL_MAXEX_ANO2_VAL_MAXBSC6900NONOMRFD-210301Configuration ManagementString TypeNone1~9 charactersV or A100NoneNoneIf "Sensor Type of External Analog 2" is set to VOLTAGE, the unit of "Upper Limit of Measurement Range of External Analog 2" is V; if "Sensor Type of External Analog 2" is set to CURRENT, the unit of "Upper Limit of Measurement Range of External Analog 2" is A.Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment151ADD EMU(Optional)MOD EMU(Optional)Lower Limit of Measurement Range of External Analog 2MNG LIMinimum measurement range of extended analog signal 2. If "Sensor Type of External Analog 2" is set to VOLTAGE, the unit of this parameter is V; if "Sensor Type of External Analog 2" is set to CURRENT, the unit of this parameter is A.EMUEX_ANO2_VAL_MINEX_ANO2_VAL_MINBSC6900NONOMRFD-210301Configuration ManagementString TypeNone1~9 charactersV or A0NoneNoneIf "Sensor Type of External Analog 2" is set to VOLTAGE, the unit of "Lower Limit of Measurement Range of External Analog 2" is V; if "Sensor Type of External Analog 2" is set to CURRENT, the unit of "Lower Limit of Measurement Range of External Analog 2" is A.Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment152ADD EMU(Optional)MOD EMU(Optional)Upper Limit of Signal Output of External Analog 3MNG LIUpper limit of extended output analog signal 3. If "Sensor Type of External Analog 3" is set to VOLTAGE, the unit of this parameter is V; if "Sensor Type of External Analog 3" is set to CURRENT, the unit of this parameter is A.EMUEX_ANO3_SIG_MAXEX_ANO3_SIG_MAXBSC6900NONOMRFD-210301Configuration ManagementString TypeNone1~9 charactersV or A0.02NoneNoneIf "Sensor Type of External Analog 3" is set to VOLTAGE, the unit of "Upper Limit of Signal Output of External Analog 3" is V; if "Sensor Type of External Analog 3" is set to CURRENT, the unit of "Upper Limit of Signal Output of External Analog 3" is A.Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment153ADD EMU(Optional)MOD EMU(Optional)Lower Limit of Signal Output of External Analog 3MNG LILower limit of extended output analog signal 3. If "Sensor Type of External Analog 3" is set to VOLTAGE, the unit of this parameter is V; if "Sensor Type of External Analog 3" is set to CURRENT, the unit of this parameter is A.EMUEX_ANO3_SIG_MINEX_ANO3_SIG_MINBSC6900NONOMRFD-210301Configuration ManagementString TypeNone1~9 charactersV or A0.004NoneNoneIf "Sensor Type of External Analog 3" is set to VOLTAGE, the unit of "Lower Limit of Signal Output of External Analog 3" is V; if "Sensor Type of External Analog 3" is set to CURRENT, the unit of "Lower Limit of Signal Output of External Analog 3" is A.Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment154ADD EMU(Optional)MOD EMU(Optional)Upper Limit of Measurement Range of External Analog 3MNG LIMaximum measurement range of extended analog signal 3. If "Sensor Type of External Analog 3" is set to VOLTAGE, the unit of this parameter is V; if "Sensor Type of External Analog 3" is set to CURRENT, the unit of this parameter is A.EMUEX_ANO3_VAL_MAXEX_ANO3_VAL_MAXBSC6900NONOMRFD-210301Configuration ManagementString TypeNone1~9 charactersV or A100NoneNoneIf "Sensor Type of External Analog 3" is set to VOLTAGE, the unit of "Upper Limit of Measurement Range of External Analog 3" is V; if "Sensor Type of External Analog 3" is set to CURRENT, the unit of "Upper Limit of Measurement Range of External Analog 3" is A.Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment155ADD EMU(Optional)MOD EMU(Optional)Lower Limit of Measurement Range of External Analog 3MNG LIMinimum measurement range of extended analog signal 3. If "Sensor Type of External Analog 3" is set to VOLTAGE, the unit of this parameter is V; if "Sensor Type of External Analog 3" is set to CURRENT, the unit of this parameter is A.EMUEX_ANO3_VAL_MINEX_ANO3_VAL_MINBSC6900NONOMRFD-210301Configuration ManagementString TypeNone1~9 charactersV or A0NoneNoneIf "Sensor Type of External Analog 3" is set to VOLTAGE, the unit of "Lower Limit of Measurement Range of External Analog 3" is V; if "Sensor Type of External Analog 3" is set to CURRENT, the unit of "Lower Limit of Measurement Range of External Analog 3" is A.Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment156ADD EMU(Optional)MOD EMU(Optional)Upper Limit of Signal Output of External Analog 4MNG LIUpper limit of extended output analog signal 4. If "Sensor Type of External Analog 4" is set to VOLTAGE, the unit of this parameter is V; if "Sensor Type of External Analog 4" is set to CURRENT, the unit of this parameter is A.EMUEX_ANO4_SIG_MAXEX_ANO4_SIG_MAXBSC6900NONOMRFD-210301Configuration ManagementString TypeNone1~9 charactersV or A0.02NoneNoneIf "Sensor Type of External Analog 4" is set to VOLTAGE, the unit of "Upper Limit of Signal Output of External Analog 4" is V; if "Sensor Type of External Analog 4" is set to CURRENT, the unit of "Upper Limit of Signal Output of External Analog 4" is A.Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment157ADD EMU(Optional)MOD EMU(Optional)Lower Limit of Signal Output of External Analog 4MNG LILower limit of extended output analog signal 4. If "Sensor Type of External Analog 4" is set to VOLTAGE, the unit of this parameter is V; if "Sensor Type of External Analog 4" is set to CURRENT, the unit of this parameter is A.EMUEX_ANO4_SIG_MINEX_ANO4_SIG_MINBSC6900NONOMRFD-210301Configuration ManagementString TypeNone1~9 charactersV or A0.004NoneNoneIf "Sensor Type of External Analog 4" is set to VOLTAGE, the unit of "Lower Limit of Signal Output of External Analog 4" is V; if "Sensor Type of External Analog 4" is set to CURRENT, the unit of "Lower Limit of Signal Output of External Analog 4" is A.Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment158ADD EMU(Optional)MOD EMU(Optional)Upper Limit of Measurement Range of External Analog 4MNG LIMaximum measurement range of extended analog signal 4. If "Sensor Type of External Analog 4" is set to VOLTAGE, the unit of this parameter is V; if "Sensor Type of External Analog 4" is set to CURRENT, the unit of this parameter is A.EMUEX_ANO4_VAL_MAXEX_ANO4_VAL_MAXBSC6900NONOMRFD-210301Configuration ManagementString TypeNone1~9 charactersV or A100NoneNoneIf "Sensor Type of External Analog 4" is set to VOLTAGE, the unit of "Upper Limit of Measurement Range of External Analog 4" is V; if "Sensor Type of External Analog 4" is set to CURRENT, the unit of "Upper Limit of Measurement Range of External Analog 4" is A.Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment159ADD EMU(Optional)MOD EMU(Optional)Lower Limit of Measurement Range of External Analog 4MNG LIMinimum measurement range of extended analog signal 4. If "Sensor Type of External Analog 4" is set to VOLTAGE, the unit of this parameter is V; if "Sensor Type of External Analog 4" is set to CURRENT, the unit of this parameter is A.EMUEX_ANO4_VAL_MINEX_ANO4_VAL_MINBSC6900NONOMRFD-210301Configuration ManagementString TypeNone1~9 charactersV or A0NoneNoneIf "Sensor Type of External Analog 4" is set to VOLTAGE, the unit of "Lower Limit of Measurement Range of External Analog 4" is V; if "Sensor Type of External Analog 4" is set to CURRENT, the unit of "Lower Limit of Measurement Range of External Analog 4" is A.Read & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment160ADD EMU(Optional)MOD EMU(Optional)Switch for Relay 1MNG LIRelay switch 1EMUPOWER_RELAY1POWER_RELAY1BSC6900NONOMRFD-210301Configuration ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE, OPENNoneCLOSENoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment161ADD EMU(Optional)MOD EMU(Optional)Switch for Relay 2MNG LIRelay switch 2EMUPOWER_RELAY2POWER_RELAY2BSC6900NONOMRFD-210301Configuration ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE, OPENNoneCLOSENoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment162ADD EMU(Optional)MOD EMU(Optional)Switch for Relay 3MNG LIRelay switch 3EMUPOWER_RELAY3POWER_RELAY3BSC6900NONOMRFD-210301Configuration ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE, OPENNoneCLOSENoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment163ADD EMU(Optional)MOD EMU(Optional)Switch for Relay 4MNG LIRelay switch 4EMUPOWER_RELAY4POWER_RELAY4BSC6900NONOMRFD-210301Configuration ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE, OPENNoneCLOSENoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment164ADD EMU(Optional)MOD EMU(Optional)Switch for Relay 5MNG LIRelay switch 5EMUPOWER_RELAY5POWER_RELAY5BSC6900NONOMRFD-210301Configuration ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE, OPENNoneCLOSENoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment165ADD EMU(Optional)MOD EMU(Optional)Switch for Relay 6MNG LIRelay switch 6EMUPOWER_RELAY6POWER_RELAY6BSC6900NONOMRFD-210301Configuration ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE, OPENNoneCLOSENoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment166ADD ETHIP(Mandatory)Subnet maskMNG LISubnet mask of the boardETHIPMASKMASKBSC6900NOYESNoneNoneIP Address TypeNone0.0.0.0~255.255.255.255NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport167ADD ETHIP(Mandatory)MOD ETHIP(Mandatory)RMV ETHIP(Mandatory)Subrack No.MNG LINumber of the subrackETHIPSRNSRNBSC6900YESYESMRFD-210301Configuration ManagementInterval Type0~110~11NoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in idle mode)Not involvedNot involvedNoneThe parameter modification has no impact on the equipment.NoneVersions earlier than BSC6900 V900R011Equipment168ADD ETHIP(Mandatory)MOD ETHIP(Mandatory)RMV ETHIP(Mandatory)Slot No.MNG LIIndicates the slot number for running this commandETHIPSNSNBSC6900YESYESNoneNoneInterval Type0~5,8~270~5, 8~27NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Equipment169ADD ETHIP(Mandatory)MOD ETHIP(Mandatory)RMV ETHIP(Mandatory)Port No.MNG LIEthernet portETHIPPNPNBSC6900YESYESNoneNoneInterval Type0~110~7(FG2a), 0~1(GOUa), 0~11(FG2c), 0~3(GOUc)NoneNoneNoneEthernet portIf port 0 or port 4 of the FG2a board is set to the GE port, the port number can only be 0 or 4. Otherwise, the port number ranges from 0 to 7. If only port 0 is set to the GE port, ports 1-3 are unavailable. If port 4 is set to the GE port, ports 5-7 are unavailable.Read & WriteNot involvedNot involvedNot involvedThe parameter cannot be modified.Not involvedNoneVersions earlier than BSC6900 V900R011Transport170ADD ETHIP(Mandatory