Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence...
Transcript of Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence...
![Page 1: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/1.jpg)
VI, March 2005
Pairwise sequence alignments
Vassilios Ioannidis(From Volker Flegel©)
![Page 2: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/2.jpg)
VI, March 2005
Outline
• Introduction
• Definitions
• Biological context of pairwise alignments
• Computing of pairwise alignments
• Some programs
![Page 3: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/3.jpg)
VI, March 2005
Importance of pairwise alignments
Sequence analysis tools depending on pairwise comparison
• Multiple alignments
• Profile and HMM making(used to search for protein families and domains)
• 3D protein structure prediction
• Phylogenetic analysis
• Construction of certain substitution matrices
• Similarity searches in a database
![Page 4: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/4.jpg)
VI, March 2005
Goal
Sequence comparison through pairwise alignments• Goal of pairwise comparison is to find conserved regions (if any)
between two sequences
• Extrapolate information about our sequence using the knowncharacteristics of the other sequence
THIO_EMENI GFVVVDCFATWCGPCKAIAPTVEKFAQTY G ++VD +A WCGPCK IAP +++ A Y ??? GAILVDFWAEWCGPCKMIAPILDEIADEY
THIO_EMENI GFVVVDCFATWCGPCKAIAPTVEKFAQTY G ++VD +A WCGPCK IAP +++ A Y ??? GAILVDFWAEWCGPCKMIAPILDEIADEY
THIO_EMENISwissProt
ExtrapolateExtrapolate
???
![Page 5: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/5.jpg)
VI, March 2005
Do alignments make sense ?Evolution of sequences
• Sequences evolve through mutation and selection Selective pressure is different for each residue position in a
protein (i.e. conservation of active site, structure, charge, etc.)• Modular nature of proteins
Nature keeps re-using domains
• Alignments try to tell the evolutionnary story of the proteins
Relationships
Same Sequence
Same 3D Fold
Same Origin Same Function
![Page 6: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/6.jpg)
VI, March 2005
Example: An alignment - textual view
• Two similar regions of the Drosophila melanogaster Slit and Notch proteins
970 980 990 1000 1010 1020 SLIT_DROME FSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFC ..:.: :. :.: ...:.: .. : :.. : ::.. . :.: ::..:. :. :. :NOTC_DROME YKCECPRGFYDAHCLSDVDECASN-PCVNEGRCEDGINEFICHCPPGYTGKRCELDIDEC 740 750 760 770 780 790
970 980 990 1000 1010 1020 SLIT_DROME FSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFC ..:.: :. :.: ...:.: .. : :.. : ::.. . :.: ::..:. :. :. :NOTC_DROME YKCECPRGFYDAHCLSDVDECASN-PCVNEGRCEDGINEFICHCPPGYTGKRCELDIDEC 740 750 760 770 780 790
: .
![Page 7: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/7.jpg)
VI, March 2005
Example: An alignment - graphical view
• Comparing the tissue-type and urokinase type plasminogen activators.Displayed using a diagonal plot or Dotplot.
Tissue-Type plasminogen Activator
Urokinase-T
ype plasminogen A
ctivator
URL: www.isrec.isb-sib.ch/java/dotlet/Dotlet.html
![Page 8: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/8.jpg)
VI, March 2005
Some definitions
IdentityProportion of pairs of identical residues between two aligned sequences.
Generally expressed as a percentage.
This value strongly depends on how the two sequences are aligned.
SimilarityProportion of pairs of similar residues between two aligned sequences.
If two residues are similar is determined by a substitution matrix.
This value also depends strongly on how the two sequences are aligned, as wellas on the substitution matrix used.
HomologyTwo sequences are homologous if and only if they have a common ancestor.
There is no such thing as a level of homology ! (It's either yes or no)• Homologous sequences do not necessarily serve the same function...
• ... Nor are they always highly similar: structure may be conserved while sequence is not.
![Page 9: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/9.jpg)
VI, March 2005
Matches
Definition example
The set of all globins and a test to identify them
True positives
True negatives
False positives
False negatives
Consider:
• a set S (say, globins: G)
• a test t that tries to detect members of S(for example, through a pairwise comparison with another globin).
Globins
G
G
G
G
G
G
G
G
X
XX
XX
![Page 10: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/10.jpg)
VI, March 2005
More definitionsConsider a set S (say, globins) and a test t that tries to detect members of S
(for example, through a pairwise comparison with another globin).
True positiveA protein is a true positive if it belongs to S and is detected by t.
True negativeA protein is a true negative if it does not belong to S and is not detected by t.
False positiveA protein is a false positive if it does not belong to S and is (incorrectly) detected by t.
False negativeA protein is a false negative if it belongs to S and is not detected by t (but should be).
![Page 11: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/11.jpg)
VI, March 2005
Even more definitions
SensitivityAbility of a method to detect positives,
irrespective of how many false positives are reported.
SelectivityAbility of a method to reject negatives,
irrespective of how many false negatives are rejected.
True positives
True negatives
False positives
False negatives
Greater sensitivity
Less selectivity
Less sensitivity
Greater selectivity
![Page 12: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/12.jpg)
VI, March 2005
Pairwise sequence alignment
Concept of a sequence alignment• Pairwise Alignment:
Explicit mapping between the residues of 2 sequences
– Tolerant to errors (mismatches, insertion / deletions or indels)– Evaluation of the alignment in a biological concept (significance)
Seq AGARFIELDTHELASTFA-TCAT||||||||||| || ||||
Seq BGARFIELDTHEVERYFASTCAT
Seq AGARFIELDTHELASTFA-TCAT||||||||||| || ||||
Seq BGARFIELDTHEVERYFASTCAT
errors / mismatches insertion
deletion
![Page 13: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/13.jpg)
VI, March 2005
Pairwise sequence alignement
Number of alignments• There are many ways to align two sequences• Consider the sequence fragments below: a simple alignment shows
some conserved portions
but also:
CGATGCAGACGTCA ||||||||CGATGCAAGACGTCA
CGATGCAGACGTCA ||||||||CGATGCAAGACGTCA
CGATGCAGACGTCA||||||||CGATGCAAGACGTCA
CGATGCAGACGTCA||||||||CGATGCAAGACGTCA
• Number of possible alignments for 2 sequences of length 1000 residues:
more than 10600 gapped alignments(Avogadro 1024, estimated number of atoms in the universe 1080)
![Page 14: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/14.jpg)
VI, March 2005
Alignement evaluation
What is a good alignment ?• We need a way to evaluate the biological meaning of a given alignment
• Intuitively we "know" that the following alignment:
is better than:
CGAGGCACAACGTCA||| ||| ||||||CGATGCAAGACGTCA
CGAGGCACAACGTCA||| ||| ||||||CGATGCAAGACGTCA
ATTGGACAGCAATCAGG| || | |ACGATGCAAGACGTCAG
ATTGGACAGCAATCAGG| || | |ACGATGCAAGACGTCAG
• We can express this notion more rigorously, by using ascoring system
![Page 15: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/15.jpg)
VI, March 2005
Scoring system
Simple alignment scores• A simple way (but not the best) to score an alignment is to count 1 for each
match and 0 for each mismatch.
Score: 12
CGAGGCACAACGTCA||| ||| ||||||CGATGCAAGACGTCA
CGAGGCACAACGTCA||| ||| ||||||CGATGCAAGACGTCA
ATTGGACAGCAATCAGG| || | |ACGATGCAAGACGTCAG
ATTGGACAGCAATCAGG| || | |ACGATGCAAGACGTCAG
Score: 5
![Page 16: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/16.jpg)
VI, March 2005
Introducing biological information
Importance of the scoring systemdiscrimination of significant biological alignments
• Based on physico-chemical properties of amino-acids Hydrophobicity, acid / base, sterical properties, ... Scoring system scales are arbitrary
• Based on biological sequence information Substitutions observed in structural or evolutionary alignments of well
studied protein families Scoring systems have a probabilistic foundation
Substitution matrices• In proteins some mismatches are more acceptable than others• Substitution matrices give a score for each substitution of one amino-acid by
another
![Page 17: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/17.jpg)
VI, March 2005
Substitution matrices (log-odds matrices)
Example matrix
PAM250From: A. D. Baxevanis, "Bioinformatics"
(Leu, Ile): 2
(Leu, Cys): -6...
• Positive score: the amino acids are similar,mutations from one into the other occur more oftenthen expected by chance during evolution
• Negative score: the amino acids aredissimilar, the mutation from one into the otheroccurs less often then expected by chance duringevolution
chancebyexpected
observedlog
• For a set of well known proteins:• Align the sequences• Count the mutations at each position• For each substitution set the score to the log-odd
ratio
![Page 18: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/18.jpg)
VI, March 2005
Matrix choice
Different kind of matrices• PAM series (Dayhoff M., 1968, 1972, 1978)
Percent Accepted Mutation.A unit introduced by Dayhoff et al. to quantify the amount of evolutionary changein a protein sequence. 1.0 PAM unit, is the amount of evolution which will change,on average, 1% of amino acids in a protein sequence. A PAM(x) substitutionmatrix is a look-up table in which scores for each amino acid substitution havebeen calculated based on the frequency of that substitution in closely relatedproteins that have experienced a certain amount (x) of evolutionary divergence.
Based on 1572 protein sequences from 71 families Old standard matrix: PAM250
![Page 19: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/19.jpg)
VI, March 2005
Matrix choice
Different kind of matrices• BLOSUM series (Henikoff S. & Henikoff JG., PNAS, 1992)
Blocks Substitution Matrix.A substitution matrix in which scores for each position are derived fromobservations of the frequencies of substitutions in blocks of local alignments inrelated proteins. Each matrix is tailored to a particular evolutionary distance. In theBLOSUM62 matrix, for example, the alignment from which scores were derivedwas created using sequences sharing no more than 62% identity. Sequences moreidentical than 62% are represented by a single sequence in the alignment so as toavoid over-weighting closely related family members.
Based on alignments in the BLOCKS database Standard matrix:BLOSUM62
![Page 20: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/20.jpg)
VI, March 2005
Matrix choice
Limitations• Substitution matrices do not take into account long range interactions
between residues.
• They assume that identical residues are equal ( whereas in reallife aresidue at the active site has other evolutionary constraints than the sameresidue outside of the active site)
• They assume evolution rate to be constant.
![Page 21: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/21.jpg)
VI, March 2005
Alignment score
Amino acid substitution matrices• Example: PAM250• Most used: Blosum62
Raw score of an alignment
TPEA_| |
APGA
TPEA_| |
APGA
Score = 1 = 9+ 6 + 0 + 2
![Page 22: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/22.jpg)
VI, March 2005
Gaps
Insertions or deletions• Proteins often contain regions where residues have been inserted or deleted
during evolution• There are constraints on where these insertions and deletions can happen
(between structural or functional elements like: alpha helices, active site,etc.)
Gaps in alignments
GCATGCATGCAACTGCAT|||||||||GCATGCATGGGCAACTGCAT
GCATGCATGCAACTGCAT|||||||||GCATGCATGGGCAACTGCAT
can be improved by inserting a gap
GCATGCATG--CAACTGCAT||||||||| |||||||||GCATGCATGGGCAACTGCAT
GCATGCATG--CAACTGCAT||||||||| |||||||||GCATGCATGGGCAACTGCAT
![Page 23: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/23.jpg)
VI, March 2005
Gap opening and extension penalties
Costs of gaps in alignments• We want to simulate as closely as possible the evolutionary mechanisms
involved in gap occurence.Example
• Two alignments with identical number of gaps but very different gapdistribution. We may prefer one large gap to several small ones(e.g. poorly conserved loops between well-conserved helices)
CGATGCAGCAGCAGCATCG|||||| |||||||CGATGC------AGCATCG
CGATGCAGCAGCAGCATCG|||||| |||||||CGATGC------AGCATCG
CGATGCAGCAGCAGCATCG|| || |||| || || |CG-TG-AGCA-CA--AT-G
CGATGCAGCAGCAGCATCG|| || |||| || || |CG-TG-AGCA-CA--AT-G
gap opening
Gap opening penalty• Counted each time a gap is opened in an alignment
(some programs include the first extension into this penalty)
gap extension
Gap extension penalty• Counted for each extension of a gap in an alignment
![Page 24: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/24.jpg)
VI, March 2005
Gap opening and extension penalties
Example• With a match score of 1 and a mismatch score of 0• With an opening penalty of 10 and extension penalty of 1,
we have the following score:
CGATGCAGCAGCAGCATCG|||||| |||||||CGATGC------AGCATCG
CGATGCAGCAGCAGCATCG|||||| |||||||CGATGC------AGCATCG
CGATGCAGCAGCAGCATCG|| || |||| || || |CG-TG-AGCA-CA--AT-G
CGATGCAGCAGCAGCATCG|| || |||| || || |CG-TG-AGCA-CA--AT-G
gap opening gap extension
13 x 1 - 10 - 6 x 1 = -3 13 x 1 - 5 x 10 - 6 x 1 = -43
![Page 25: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/25.jpg)
VI, March 2005
Statistical evaluation of results
Alignments are evaluated according to their score• Raw score
It's the sum of the amino acid substitution scores and gap penalties(gap opening and gap extension)
Depends on the scoring system (substitution matrix, etc.) Different alignments should not be compared based only on the raw
score
• It is possible that a "bad" long alignment gets a better raw score than a very good shortalignment.
We need a normalised score to compare alignments !We need to evaluate the biological meaning of the score (p-value, e-value).
• Normalised score Is independent of the scoring system Allows the comparison of different alignments Units: expressed in bits
![Page 26: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/26.jpg)
VI, March 2005
...
Statistical evaluation of results
Distribution of alignment scores - Extreme Value Distribution• Random sequences and alignment scores
Sequence alignment scores between random sequences aredistributed following an extreme value distribution (EVD).
score
obs
AlaVal...Trp
Random sequences Pairwise alignments Score distribution
low score
low score
low score
low score
high score
high score due to "luck"
![Page 27: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/27.jpg)
VI, March 2005
score y: our alignment isvery improbable to obtainwith random sequences
Statistical evaluation of results
Distribution of alignment scores - Extreme Value Distribution• High scoring random alignments have a low probability.• The EVD allows us to compute the probability with which our biological
alignment could be due to randomness (to chance).• Caveat: finding the threshold of significant alignments.
scorescore x: our alignment hasa great probability ofbeing the result of randomsequence similarity
Thresholdsignificant alignment
![Page 28: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/28.jpg)
VI, March 2005
Statistical evaluation of results
Statistics derived from the scores• p-value
Probability that an alignment with this score occurs by chance in adatabase of this size
The closer the p-value is towards 0, the better the alignment
• e-value Number of matches with this score one can expect to find by chance in a
database of this size The closer the e-value is towards 0, the better the alignment
• Relationship between e-value and p-value: In a database containing N sequences
e = p x N
100%
0%
N
0
![Page 29: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/29.jpg)
VI, March 2005
Diagonal plots or Dotplot
Concept of a Dotplot• Produces a graphical representation of similarity regions.• The horizontal and vertical dimensions correspond to the compared
sequences.• A region of similarity stands out as a diagonal.
Tissue-Type plasminogen Activator
Urokinase-T
ype plasminogen A
ctivator
![Page 30: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/30.jpg)
VI, March 2005
Dotplot construction
Simple example• A dot is placed at each position where two residues match.
The colour of the dot can be chosen according to the substitution valuein the substitution matrix
THEFATCATTHEFASTCAT
THEFA-TCAT||||| ||||THEFASTCAT
THEFA-TCAT||||| ||||THEFASTCAT
Note• This method produces dotplots with too much noise to be useful
The noise can be reduced by calculating a score using a window ofresidues
The score is compared to a threshold or stringency
![Page 31: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/31.jpg)
VI, March 2005
Dotplot construction
Window example• Each window of the first sequence is aligned (without gaps) to each window
of the 2nd sequence• A colour is set into a rectangular array according to the score of the aligned
windows
THEFATCATTHEFASTCAT
THE|||THE
THE|||THE
Score: 23
THE
HEF
THE
HEF
Score: -5
CAT
THE
CAT
THE
Score: -4
HEF
THE
HEF
THE
Score: -5
![Page 32: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/32.jpg)
VI, March 2005
Dotplot limitations It's a visual aid.
The human eye can rapidly identify similar regions in sequences. It's a good way to explore sequence organisation. It does not provide an alignment.
Tissue-Type plasminogen Activator
Urokinase-T
ype plasminogen A
ctivator
![Page 33: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/33.jpg)
VI, March 2005
Relationship between alignment and dotplot• An alignment can be seen as a path through the dotplot diagramm.
Creating an alignment
Seq B A-CA-CA| || |
Seq A ACCAAC-
Seq B A-CA-CA| || |
Seq A ACCAAC-
Seq B ACA--CA|
Seq A A-CCAAC
Seq B ACA--CA|
Seq A A-CCAAC
![Page 34: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/34.jpg)
VI, March 2005
Finding an alignment
Alignment algorithms• An alignment program tries to find the best alignment between two
sequences given the scoring system.• This can be seen as trying to find a path through the dotplot diagram
including all (or the most visible) diagonals.
Alignement types• Global Alignment between the complete sequence A and the
complete sequence B• Local Alignment between a sub-sequence of A an a sub-
sequence of B
Computer implementation (Algorithms)• Dynamic programing• Global Needleman-Wunsch• Local Smith-Waterman
![Page 35: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/35.jpg)
VI, March 2005
Global alignment (Needleman-Wunsch)
Example Global alignments are very sensitive to gap penalties Global alignments do not take into account the modular nature of proteins
Tissue-Type plasminogen Activator
Urokinase-T
ype plasminogen A
ctivator
Global alignment:
![Page 36: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/36.jpg)
VI, March 2005
Local alignment (Smith-Waterman)
Example Local alignments are more sensitive to the modular nature of proteins They can be used to search databases
Tissue-Type plasminogen Activator
Urokinase-T
ype plasminogen A
ctivator
Local alignments:
![Page 37: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/37.jpg)
VI, March 2005
Optimal alignment extension
How to extend optimaly an optimal alignment• An optimal alignment up to positions i and j can be extended in 3 ways.• Keeping the best of the 3 guarantees an extended optimal alignment.
Seq A a1 a2 a3 ... ai-1 ai
Seq B b1 b2 b3 ... bj-1 bj
Seq A a1 a2 a3 ... ai-1 ai
Seq B b1 b2 b3 ... bj-1 bj
• We have the optimal alignment extended from i and j by one residue.
Seq A a1 a2 a3 ... ai-1 ai
Seq B b1 b2 b3 ... bj-1 bj
Seq A a1 a2 a3 ... ai-1 ai
Seq B b1 b2 b3 ... bj-1 bj
ai+1
bj+1
ai+1
bj+1Score = Scoreij + Substij
Seq A a1 a2 a3 ... ai-1 ai
Seq B b1 b2 b3 ... bj-1 bj
Seq A a1 a2 a3 ... ai-1 ai
Seq B b1 b2 b3 ... bj-1 bj
ai+1
-
ai+1
-Score = Scoreij - gap
Seq A a1 a2 a3 ... ai-1 ai
Seq B b1 b2 b3 ... bj-1 bj
Seq A a1 a2 a3 ... ai-1 ai
Seq B b1 b2 b3 ... bj-1 bj
-
bj+1
-
bj+1Score = Scoreij - gap
![Page 38: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/38.jpg)
VI, March 2005
Exact algorithms
Simple example (Needleman-Wunsch)
• Scoring system: Match score: 2 Mismatch score: -1 Gap penalty: -2
Note• We have to keep track of the origin of the score for each element in the matrix.
This allows to build the alignment by traceback when the matrix has been completelyfilled out.
• Computation time is proportional to the size of sequences (n x m).
GATTA0-2-4-6-8-10G-2A-4A-6T-8T-10C-12GATTA0-2-4-6-8-10G-220-2-4-6A-404A-6T-8T-10C-12
0 - 2
0 - 2
2 + 2
GATTA0-2-4-6-8-10G-220-2-4-6A-40420-2A-6-22312T-8-40453T-10-6-2264C-12-8-4045
F(i-1,j)
F(i,j)
s(xi,yj)
F(i-1,j-1) -d
F(i,j-1)
-d
F(i,j): score at position i, js(xi,yj): match or mismatch score (or substitution matrix
value) for residues xi and yjd: gap penalty (positive value)
GA-TTA|| ||GAATTC
GA-TTA|| ||GAATTC
![Page 39: Pairwise sequence alignments - BioinformaticsPairwise sequence alignment Concept of a sequence alignment •Pairwise Alignment: Explicit mapping between the residues of 2 sequences](https://reader031.fdocuments.in/reader031/viewer/2022013003/5fbc1de4ca7f281ff61e41b3/html5/thumbnails/39.jpg)
VI, March 2005
Algorithms for pairwise alignments
Web resources• LALIGN - pairwise sequence alignment:
www.ch.embnet.org/software/LALIGN_form.html
• PRSS - alignment score evaluation:www.ch.embnet.org/software/PRSS_form.html
Concluding remarks• Substitution matrices and gap penalties introduce biological
information into the alignment algorithms.• It is not because two sequences can be aligned that they share a
common biological history. The relevance of the alignment must beassessed with a statistical score.
• There are many ways to align two sequences.Do not blindly trust your alignment to be the only truth. Especially gappedregions may be quite variable.
• Sequences sharing less than 20% similarity are difficult to align: You enter the Twilight Zone (Doolittle, 1986) Alignments may appear plausible to the eye but are no longer statistically
significant. Other methods are needed to explore these sequences (i.e: profiles)