Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x...

21
Using the complete genome sequence of Mycobacterium ulcerans to address research priorities for the control of Buruli ulcer

Transcript of Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x...

Page 1: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

Using the complete genome sequence of Mycobacterium ulcerans

to address research priorities for the control of Buruli ulcer

Page 2: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

“Knowledge is power.”Sir Francis Bacon

Page 3: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

Genome sequence = knowledge

Page 4: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

(length of 1 bp) x(number of bp per cell) x

(number of cells in a colony)

(0.34 x 10-9 m) x (6 x 106) x (107) =

20 km

A, G, C, T……..

AGCTCTGGGCGTTTCGCAATGGCTAGCGATAGCTCTGGGCGTTTCGCAATGGCTAGCGAGT………

genes (DNA)

proteins(amino acids)

Page 5: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

muweb.millersville.edu

Page 6: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

Information

Knowledge

Wisdom

Genome sequence

Annotated genome

Hypothesis testing

Treatment

Page 7: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

MU Genome Treatment

• New drugs

• New diagnostic tools

• Vaccines

• Improved molecular epidemiology

Page 8: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

MU Genome Treatment

• New drugs

• New diagnostic tools

• Vaccines

• Improved molecular epidemiology

Page 9: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

MU MDPTIAAGALIGGGLIMAGGAIGAGIGDGIAGNALISGVARQPEAQGRLFTPFFITVGLVEAAYFINLAFMALFVFATPVK

Page 10: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

MU Genome Treatment

• New drugs

• New diagnostic tools

• Vaccines

• Improved molecular epidemiology

Page 11: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

Genome overview

5,631,606 bp

174,155 bp

5,805,761 bp

Page 12: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

pMUM001, mycolactones and virulence

mlsA1mlsA2

mlsB

Page 13: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

5,631,606 bp

174,155 bp

5,805,761 bp

• 4288 CDS

• 304 copies ISE

Genome overview

Page 14: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

5,631,606 bp

174,155 bp

5,805,761 bp

• 4288 CDS

• 304 copies ISE

• 735 pseudo

Genome overview

Page 15: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

5,631,606 bp

174,155 bp

5,805,761 bp

• 4300 CDS

• 288 copies ISE

• 690 pseudo

• MU unique- 2 prophage

- 97 PE/PPE

- 22 other

• G + C 65.47%

Genome overview

Page 16: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

M. M. ulceransulcerans--specificspecific antigen identificationantigen identification

• 41 potential antigens identified

• Rapid immunodiagnostics

• Vaccine development

Page 17: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

MU Genome Treatment

• New drugs

• New diagnostic tools

• Vaccines

• Improved molecular epidemiology

Page 18: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)
Page 19: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

http://genolist.pasteur.fr/BuruList/

Page 20: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

Monash Microbiology• Jessica Porter• Sacha Pidot• Janine Ryan• Grant Jenkin• John DaviesVictorian Bioinformatics Consortium• Torsten SeemannOthers• Paul Johnson (Austin Hospital)

Funding• Association Française Raoul Follereau• The Génopole Programme• World Health Organisation (Nippon Foundation)

• NH&MRC, Australia

• Wafa Frigui• Roland Brosch• Thierry Garnier• Melinda Pryor• Gilles Reysett• Stewart Cole

Dept. Biochemistry University of Cambridge

• Hui Hong• Peter Leadlay

The Génopole PF1

University of Tennessee

• Pamela Small

Page 21: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

“Where is the Life we have lost in living? Where is the

wisdom we have lost in knowledge? Where is the

knowledge we have lost in information?”

T.S. Eliot


85W and 90W Photovoltaic modules BP 485J - BP 490J485J+-+BP+490J.pdfbp sola r 1234567 X XXXX X Without Screw Heads 1204 [47.4] Certification Certified according to the extended version

85W and 90W Photovoltaic modules BP 485J - BP 490J485J+-+BP+490J.pdfbp sola r 1234567 X XXXX X Without Screw Heads 1204 [47.4] Certification Certified according to the extended version

From Deep BP-Learning to Internal X-Learning

From Deep BP-Learning to Internal X-Learning

Rpp revisi 2016 pai & bp x rpp diva pendidikan

Rpp revisi 2016 pai & bp x rpp diva pendidikan

Treatment of Mycobacterium ulcerans disease (Buruli ulcer)

Treatment of Mycobacterium ulcerans disease (Buruli ulcer)

The World Bank FOR OFFICIAL USE ONLY · Pest Management OP 4.09 X Physical Cultural Resources OP/BP 4.11 X Indigenous Peoples OP/BP 4.10 X Involuntary Resettlement OP/BP 4.12 X Safety

The World Bank FOR OFFICIAL USE ONLY · Pest Management OP 4.09 X Physical Cultural Resources OP/BP 4.11 X Indigenous Peoples OP/BP 4.10 X Involuntary Resettlement OP/BP 4.12 X Safety

Mycobacterium ulcerans low infectious dose and atypical ...

Mycobacterium ulcerans low infectious dose and atypical ...

Persistence of Mycobacterium ulcerans in Acanthamoeba · 2018. 9. 17. · M. ulcerans persistence within Acanthamoeba sp. Q-PCR results for M. ulcerans in Acanthamoeba sp 106 a lents

Persistence of Mycobacterium ulcerans in Acanthamoeba · 2018. 9. 17. · M. ulcerans persistence within Acanthamoeba sp. Q-PCR results for M. ulcerans in Acanthamoeba sp 106 a lents

Mycobacterium ulcerans Population Genomics To Inform on ... · IMPORTANCE Buruli ulcer is a destructive skin and soft tissue infection caused by Mycobacterium ulcerans. The disease

Mycobacterium ulcerans Population Genomics To Inform on ... · IMPORTANCE Buruli ulcer is a destructive skin and soft tissue infection caused by Mycobacterium ulcerans. The disease

The World Bank FOR OFFICIAL USE ONLY...Environmental Assessment OP/BP 4.01 X Natural Habitats OP/BP 4.04 X Forests OP/BP 4.36 X Pest Management OP 4.09 X Physical Cultural Resources

The World Bank FOR OFFICIAL USE ONLY...Environmental Assessment OP/BP 4.01 X Natural Habitats OP/BP 4.04 X Forests OP/BP 4.36 X Pest Management OP 4.09 X Physical Cultural Resources

The World Bank · PDF fileNovember 26, 2014 ... A. Economic Analysis ... Pest Management OP 4.09 X Physical Cultural Resources OP/BP 4.11 X Indigenous Peoples OP/BP 4.10 X

The World Bank · PDF fileNovember 26, 2014 ... A. Economic Analysis ... Pest Management OP 4.09 X Physical Cultural Resources OP/BP 4.11 X Indigenous Peoples OP/BP 4.10 X

World Bank Document · 2016. 7. 15. · Physical Cultural Resources OP/BP 4.11 X Indigenous Peoples OP/BP 4.10 X ... Brent G. Hampton Sr. Energy Specialist Technical Analysis AFTEG

World Bank Document · 2016. 7. 15. · Physical Cultural Resources OP/BP 4.11 X Indigenous Peoples OP/BP 4.10 X ... Brent G. Hampton Sr. Energy Specialist Technical Analysis AFTEG

Paratuberculosis - Clinical Microbiology Reviewsgenomes of closely related mycobacteria: 3.5 x 106 bp for M. avium, 3.0 x 106 to 4.2 x 106 bp forM. tuberculosis, and 2.0 x 106 to 3.3

Paratuberculosis - Clinical Microbiology Reviewsgenomes of closely related mycobacteria: 3.5 x 106 bp for M. avium, 3.0 x 106 to 4.2 x 106 bp forM. tuberculosis, and 2.0 x 106 to 3.3

The World Bank€¦ · Forests OP/BP 4.36 X Pest Management OP 4.09 X Physical Cultural Resources OP/BP 4.11 X Indigenous Peoples OP/BP 4.10 X Involuntary Resettlement OP/BP 4.12

The World Bank€¦ · Forests OP/BP 4.36 X Pest Management OP 4.09 X Physical Cultural Resources OP/BP 4.11 X Indigenous Peoples OP/BP 4.10 X Involuntary Resettlement OP/BP 4.12

World Bank Document · Environmental Assessment OP/BP 4.01 X Natural Habitats OP/BP 4.04 X Forests OP/BP 4.36 X Pest Management OP 4.09 X Physical Cultural Resources OP/BP 4.11 X

World Bank Document · Environmental Assessment OP/BP 4.01 X Natural Habitats OP/BP 4.04 X Forests OP/BP 4.36 X Pest Management OP 4.09 X Physical Cultural Resources OP/BP 4.11 X

Document of The World Bank · Environmental Assessment OP/BP 4.01 X Natural Habitats OP/BP 4.04 X Forests OP/BP 4.36 X Pest Management OP 4.09 X Physical Cultural Resources OP/BP

Document of The World Bank · Environmental Assessment OP/BP 4.01 X Natural Habitats OP/BP 4.04 X Forests OP/BP 4.36 X Pest Management OP 4.09 X Physical Cultural Resources OP/BP

World Bank Document - Africa Energy Portal · 2019-12-26 · Environmental Assessment OP/BP 4.01 X Natural Habitats OP/BP 4.04 X Forests OP/BP 4.36 X Pest Management OP 4.09 X Physical

World Bank Document - Africa Energy Portal · 2019-12-26 · Environmental Assessment OP/BP 4.01 X Natural Habitats OP/BP 4.04 X Forests OP/BP 4.36 X Pest Management OP 4.09 X Physical

Project Appraisal Document - Mena Transition Fund€¦ · Web viewInvoluntary Resettlement OP/BP 4.12 X Safety of Dams OP/BP 4.37 X Projects on International Waterways OP/BP 7.50

Project Appraisal Document - Mena Transition Fund€¦ · Web viewInvoluntary Resettlement OP/BP 4.12 X Safety of Dams OP/BP 4.37 X Projects on International Waterways OP/BP 7.50

Basidiobolomycosis Simulating a Mycobacterium ulcerans …downloads.hindawi.com/journals/cridm/2017/6905783.pdf · CaseReport Basidiobolomycosis Simulating a Mycobacterium ulcerans

Basidiobolomycosis Simulating a Mycobacterium ulcerans …downloads.hindawi.com/journals/cridm/2017/6905783.pdf · CaseReport Basidiobolomycosis Simulating a Mycobacterium ulcerans

Buruli Ulcer: Diagnosis of Mycobacterium ulcerans disease - K4Health

Buruli Ulcer: Diagnosis of Mycobacterium ulcerans disease - K4Health

EFFECTIVE ATMOSPHERIC DISTILLATION IN LIQUID SAMPLES … · 2018. 7. 12. · BP BP BP BP BP BP BP BP BP BP BP BP BP BP Introduction ASTM D86 Alternative Ethanol Blending Gasoline

EFFECTIVE ATMOSPHERIC DISTILLATION IN LIQUID SAMPLES … · 2018. 7. 12. · BP BP BP BP BP BP BP BP BP BP BP BP BP BP Introduction ASTM D86 Alternative Ethanol Blending Gasoline