Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd...
Transcript of Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd...
![Page 1: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/1.jpg)
Multiplex assay detection of immunoglobulin G antibodies that recognize 1
Babesia microti antigens 2
3
4
Jeffrey W. Priest1*, Delynn M. Moss1, Kimberly Won2, Charles W. Todd2, Leslie Henderson2, 5
Cara C. Jones2, 3, and Marianna Wilson2 6
7
Division of Foodborne, Waterborne, and Environmental Diseases1 and Division of Parasitic 8
Diseases and Malaria2, Centers for Disease Control and Prevention, Atlanta, Georgia; Atlanta 9
Research and Education Foundation, Decatur, Georgia3 10
11
*Author to whom correspondence should be addressed: 1600 Clifton Road, Mail Stop D-66, 12
Atlanta, GA 30329; email [email protected]; Tel. (404) 718-4172; FAX (404)718-4197. 13
14
Running title: Antibody recognition of Babesia antigens 15
Keywords: Babesia, immunodominant, infection, antibody, Luminex 16
17
Copyright © 2012, American Society for Microbiology. All Rights Reserved.Clin. Vaccine Immunol. doi:10.1128/CVI.00313-12 CVI Accepts, published online ahead of print on 1 August 2012
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 2: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/2.jpg)
2
Abstract 18
Human babesiosis, a blood borne infection caused by several species of Babesia including B. 19
microti, is an emerging disease that is endemic in the Northeast, Upper Midwest, and Pacific 20
Northwest regions of the US. Risk factors for babesiosis include exposure to the infected tick 21
vector and blood transfusions from infected donors. In this work, we cloned and expressed two 22
of the immunodominant antigens from B. microti and used them in a multiplex bead format assay 23
(MBA) to detect parasite-specific IgG responses in human sera. The MBA using recombinant 24
BmSA1 protein was more specific (100%) and slightly more sensitive (98.7%) than the assay 25
using a truncated recombinant BMN1-17 construct (97.6% and 97.4%, respectively). Although 26
some antibody reactivity was observed among sera from confirmed malaria patients, only one 27
Plasmodium falciparum sample was simultaneously positive for IgG antibodies to both antigens. 28
Neither antigen reacted with sera from babesiosis patients who were infected with Babesia 29
species other than B. microti. Both positive and negative MBA results were reproducible 30
between assays and between instruments. Additional studies of these recombinant antigens and 31
of the multiplex bead assay using blood samples from clinically defined babesiosis patients and 32
from blood donors are needed to more clearly define their usefulness as a blood screening assay. 33
34
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 3: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/3.jpg)
3
Introduction 35
Babesia spp (phylum Apicomplexa, order Piroplasmorida) are intraerythrocytic protozoan 36
parasites that infect a wide range of mammalian hosts including rodents, dogs, livestock, and 37
humans (21). Babesiosis in humans is a zoonotic disease that is transmitted from animal 38
reservoirs to humans by ticks of the Ixodes genus (21, 25, 52). The first human infections were 39
identified among asplenic patients in Europe (1957) and among normosplenic residents of 40
Nantucket Island in the US (1970) (11, 16, 51, 55). More recently, blood transfusions from 41
otherwise healthy donors who harbor occult infections have been recognized as an important 42
potential risk factor in disease transmission (1, 12, 19, 23, 32, 53). 43
Depending upon the immunologic status of the host and the species or strain of the parasite, 44
babesiosis can vary from a mild and self-limiting flu-like illness to one with severe, life-45
threatening complications (21). Severe symptoms resulting from high parasitemia and the 46
ensuing circulatory complications are more commonly encountered among the splenectomized, 47
the immunocompromised, and the elderly (15, 48, 56). Asymptomatic infections have been well 48
documented, and seroprevalence estimates in endemic regions have ranged from 0 - 10% 49
depending on the year, location, and season of blood collection (10, 20, 24, 26-28, 33, 49). In 50
the US, endemic Babesia microti infections have been identified in the Northeast (in 51
Connecticut, Massachusetts, Rhode Island, New York, and New Jersey) and in the upper 52
Midwest (in Minnesota and Wisconsin), while B. duncani infections have been found in 53
Washington and California and infections with a B. divergens-like parasite have been found in 54
Washington, Kentucky, and Missouri (2, 6, 14, 17, 18, 41, 54). Some evidence suggests that the 55
geographic range and prevalence of babesiosis infections may be increasing in the US due to an 56
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 4: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/4.jpg)
4
expansion of white-tailed deer populations and the concomitant increases in tick vector densities 57
(25). 58
The US Food and Drug Administration has recognized the increasing threat posed to the blood 59
supply by the lack of a sensitive and specific blood product screening assay for babesiosis (13, 60
14). The current ‘gold standard’ diagnostic assay for babesiosis, visual detection of Babesia 61
organisms in blood films, lacks sensitivity, especially in early and subclinical infections (14). 62
Infected individuals can also be identified by using a PCR-based nucleic acid detection assay or 63
by antibody detection using Babesia-infected hamster blood as antigen in an 64
immunofluorescence assay (IFA), a Western blot assay, or an ELISA (14). Although the 65
reported sensitivities and specificities have ranged from 88% to 100% and from 90% to 100%, 66
respectively, none of these assays are ideally suited for blood product screening campaigns (3, 67
14, 29, 30, 34, 50). Antibody assays can identify asymptomatically infected individuals and 68
individuals in the chronic late phase of infection (14, 28). However, antibody responses among 69
the three dominant human pathogens of humans, B. microti, B. duncani, and B. divergens, appear 70
to be species-specific (7, 14, 17, 18, 41), and three separate assays would be required to 71
conclusively rule out a diagnosis infection with Babesia sp. PCR, while more sensitive than 72
slide microscopy (29), has a reported limit of detection of 10 piroplasms per milliliter of whole 73
blood (50% confidence interval) (57), and cases of transfusion-transmitted babesiosis have been 74
documented from PCR-negative, antibody-positive blood donors (23, 33, 53). 75
The development of sensitive, specific, and scalable screening assays for babesiosis would be 76
facilitated by the identification of Babesia-specific peptide and protein antigens. In 2000, Lodes 77
et al. (35) used a randomly sheared B. microti DNA expression library to identify potential 78
antigens of interest. Three families of proteins and two additional, unrelated proteins showed 79
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 5: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/5.jpg)
5
promising results by ELISA and Western blot (35), and epitopes from the two most reactive 80
antigens were later mapped (22). Cross-reactivity with malaria sera was noted with some of the 81
B. microti peptides (22). More recently, Luo et al. (36) screened a cDNA expression library with 82
sera from infected hamsters and identified one clone, BmSA1, that showed diagnostic potential 83
in a limited human study. BmSA1 shared 75% of its coding sequence with a clone previously 84
identified as BMN1-9 by Lodes et al. (35, 36). BmSA1 antigen appeared to be secreted into the 85
serum of the host and was not recognized by serum from animals infected with B. bovis, B. 86
bigemina, B. equi, or B. gibsoni (37). 87
In the current work, we use classical antigen identification techniques to demonstrate that the 88
BMN1-9/ BmSA1 antigen is membrane-associated and is commonly recognized by sera from 89
humans infected with B. microti. We then compare the BmSA1 antigen to the one of the 90
immunodominant antigen families identified by Lodes et al., BMN1-17 (22, 35), in a multiplex 91
bead format assay. The identification of sensitive and specific antibody assay antigens may help 92
in the development of suitable screening tools for at-risk blood donations. 93
94
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 6: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/6.jpg)
6
Materials and methods 95
Growth of B. microti, protein extraction, and analysis of proteins by Western blot. Animal 96
protocols were approved by the CDC Animal Use Committee. Adult female golden hamsters 97
were inoculated with B. microti Gray strain cells. When the parasitemia reached 10% to 40% (3-98
6 weeks after inoculation), the animals were euthanized and infected blood was collected in 99
heparinized tubes by heart puncture. The blood was stored on ice until it could be processed 100
(usually < 1h). After a 10 min centrifugation at 650 x g, the serum and buffy coat were removed, 101
and the packed red blood cells (RBCs) were resuspended and washed twice with ice-cold buffer 102
containing 0.85% NaCl and 10 mM Na2HPO4 at pH7.2 (phosphate-buffered saline [PBS]). 103
To make a total cell protein fraction, the washed RBC pellet was resuspended in 104
approximately 10 vol of 0.01% saponin in water and incubated for 30 min at 37 oC. The 105
hypotonic saponin lysate was centrifuged at 3000 x g for 10 min at 4 oC. The pellet was washed 106
repeatedly with ice-cold PBS until the majority of the hemoglobin was removed. The resulting 107
white-colored pellet was resuspended in 1.5 ml of 10 mM Tris (pH 8.0) with 1 mM PMSF, 5 108
mM N-ethylmaleimide (NEM), 10 μM E-64, 10 μM Leupeptin, and 1 μM Pepstatin A, and then 109
sonicated on ice for 15 sec (Heat Systems model W-225 sonicator with a microtip at setting # 6). 110
The protein concentration was determined using the BCA micro-assay (Pierce, Rockford, IL). 111
Alternatively, the washed RBC pellet was resuspended in approximately 10 vol of ice cold 112
PBS with protease inhibitors and sonicated for 1 min on ice as described above. Membranes and 113
other large debris were collected by centrifugation at 25,000 x g for 20 min at 4 oC. The pellet 114
was resuspended in 1 ml of ice cold PBS with protease inhibitors and sonicated on ice (1 min) in 115
the presence of 2% Triton X-114. Insoluble material was removed by centrifugation for 10 min 116
at 25,000 x g. After overnight storage at -20 oC, a membrane-associated protein fraction was 117
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 7: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/7.jpg)
7
isolated by repeated Triton X-114 phase partition extraction using 20 mM HEPES buffer (pH 118
7.4), 150 mM NaCl, and 2% Triton X-114 as previously described (44). When the aqueous 119
phase was no longer tinted with hemoglobin, the proteins in the detergent phase were collected 120
by acetone precipitation, resuspended in buffer containing 0.5% SDS and 20 mM HEPES at pH 121
7.4, and heated at 95 oC for 5 min (44). After a 5 min centrifugation at 17,000 x g to remove 122
insoluble material, the protein concentration was determined using the BCA micro-assay 123
(Pierce). As a negative control, a Triton X-114 extract was made from uninfected, washed 124
hamster RBCs using the protocol given above. 125
Prior to electrophoresis, each protein preparation was diluted with 1 volume of 2X sodium 126
dodecylsulfate (SDS) sample loading buffer with 10% β-mercaptoethanol (31) heated at 95 oC 127
for 5 min, and centrifuged at 17,000 x g for 5 min to remove insoluble material. Proteins were 128
resolved on 15% SDS-polyacrylamide gels (SDS-PAGE) using the discontinuous electrophoresis 129
buffer system of Laemmli (31). Resolved proteins were then electrotransferred onto 130
polyvinylidene difluoride (PVDF) membrane (Immobilon P; Millipore Corp, Bedford, MA) and 131
exposed to serum dilutions as previously described (1:100 in 0.3% Tween-20/ PBS) (44). 132
Western blots to detect human IgG antibodies (mouse monoclonal anti-human IgG clone 133
HP6017; Zymed, South San Francisco, CA) were conducted using the biotin-streptavidin-134
alkaline phosphatase system previously described (44). Mouse, hamster, and rabbit IgG 135
antibodies were detected using a biotinylated monoclonal rat anti-mouse IgG (Zymed), a 136
biotinylated rabbit anti-hamster IgG (Southern Biotech, Birmingham, AL), and a biotinylated 137
goat anti-rabbit IgG (Zymed), respectively. 138
To determine whether epitopes were protein or carbohydrate in nature, sodium periodate and 139
proteinase K treatments were performed on blotted B. microti antigens as previously described 140
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 8: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/8.jpg)
8
(45). Treated blots were then reacted with a strong positive human serum as described above to 141
detect antigens that were insensitive to digestion. 142
B. microti peptide sequencing. Approximately 140 μg of Triton X-114 extracted proteins from 143
B. microti infected RBC membranes was resolved under reducing conditions on a 13.5% SDS 144
polyacrylamide gel using the buffer system of Laemmli (31). After brief staining (20 min) with 145
Coomassie Brilliant Blue R-250 (Bio-Rad), the protein band of interest at approximately 45 kDa 146
was excised, destained, and submitted to the Harvard Microchemistry Facility for trypsin 147
digestion and MS/MS peptide sequence analysis. Digestion products were analyzed by 148
microcapillary reverse-phase HPLC nano-electrospray tandem mass spectrometry (μLC/MS/MS) 149
on a Finnigan LCQ DECA XP Plus quadrapole ion trap mass spectrometer. MS/MS spectral 150
data were correlated with sequence databases using published algorithms (5, 9). 151
A similar amount of Triton X-114 extracted protein was resolved under reducing conditions 152
on a 12% SDS polyacrylamide gel and electrotransferred onto PVDF membrane. The blot was 153
stained with Coomassie Blue, and the protein of interest was excised and submitted to the 154
Biotechnology Core Facility at the Centers for Disease Control and Prevention for amino-155
terminal peptide sequencing using the Procise protein sequencing system (Applied Biosystems, 156
Foster City, CA). 157
Isolation of B. microti nucleic acids and antigen cloning. Genomic DNA was isolated from a 158
hypotonic saponin preparation of B. microti by lysis in buffer containing 10mM Tris (pH 8.0), 1 159
mM EDTA, 0.5% SDS, and 1 mg/ml proteinase K digestion (Fisher, Fair Lawn, NJ) followed by 160
phenol-chloroform extraction, Ribonuclease A digestion, proteinase K digestion, and ethanol 161
precipitation (38). 162
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 9: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/9.jpg)
9
Total RNA was isolated from 2 ml of washed, infected red blood cells using 10 vol of Trizol 163
reagent as directed by the manufacturer (Invitrogen, Carlsbad, CA). The RNA was digested with 164
RQ1 RNase-free DNase for 1 h at 37 oC (Promega Corp., Madison, WI) , digested with 165
proteinase K for 1 h at 37 oC, extracted with phenol-chloroform, and precipitated with ethanol. 166
Poly A+ mRNA was selected using oligo (dT) magnetic particles (Absolutely mRNA purification 167
kit, Stratagene, LaJolla, CA). First and second strand cDNA were made using the Universal 168
Riboclone cDNA synthesis kit (Promega) and an oligo (dT)20 primer with an EcoR1 restriction 169
endonuclease site (underlined): 5’-GCG GAA TTC TTT TTT TTT TTT TTT TTT TT-3’. 170
The BMN1-9 sequence of Lodes et al. (35) (Accession # AF 206252) was PCR amplified from 171
double stranded cDNA using AmpliTaq gold DNA polymerase (Perkin-Elmer Cetus, Foster 172
City, CA) and the amplification protocol previously described by Priest et al. (44). The 5’ 173
primer was based on the published BMN1-9 sequence (5’-GCT TTT GGG AAT ATC TCA CCT 174
G-3’) while the 3’ primer was the EcoR1 oligo (dT)20 described above. A ~1 kb product, 175
purified from a 1.5% agarose gel in TBE buffer (38), was then used in a semi-nested PCR 176
reaction with the EcoR1 oligo (dT)20 primer and a primer based upon the mature amino terminus 177
of the BMN1-9 protein sequence (BamH1 restriction endonuclease site underlined): 5’-CGC 178
GGA TCC GCT GGT GGT AGT GGT GGT AAT G-3’. The annealing temperature for the 179
nested PCR reaction was increased from 55 oC to 60 oC. The final PCR product was purified, 180
double digested with EcoR1 and BamH1 restriction endonucleases (New England Biolabs, 181
Ipswich, MA), ligated into EcoR1/ BamH1 digested pGEX4T-2 vector (GE Healthcare, 182
Piscataway, NJ) that had been dephosphorylated with shrimp alkaline phosphatase (Roche 183
Chemical, Indianapolis, IN), and cloned into HB101 E. coli cells (Promega) as previously 184
described (46). The plasmid from the HB101 E. coli cell clone was purified, sequenced in both 185
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 10: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/10.jpg)
10
directions, and subcloned into E. coli BL21 Gold cells (Stratagene) for glutathione-S-transferase 186
(GST) fusion protein expression. The cDNA clone of BMN1-9 was designated BmSA1 because 187
its sequence matched that reported by Luo et al. (36). 188
A fragment of the overlapping BMN1-17 and BMN1-20 coding sequences (Accession # 189
AF206526 and AF 206527) (35) that excluded the putative amino-terminal signal peptide and the 190
hydrophobic sequence at the carboxy terminus was amplified from genomic B. microti DNA 191
using the PCR protocol described above (55 oC annealing temperature) with the following 192
forward and reverse primers: 5’-CGC GGA TCC GGG GAT GTA TAT GAG ATA TCT TC-3’; 193
5’-GCG GAA TTC TTA ATG AGT GGA TGT TTC AGT CTT GAG-3’. The primers included 194
restriction endonuclease sites for directional cloning (underlined) as well as a translation stop 195
codon (italics). The resulting PCR product was cloned into E. coli and sequenced as described 196
above. 197
Purification of recombinant parasite antigens. BL21 E. coli cultures containing the BmSA1 198
and Bm17N plasmids were grown, induced, and lysed as previously described (39, 44). 199
Recombinant GST-linked BmSA1 (rBmSA1/GST) and Bm17N (rBm17N/GST) fusion proteins 200
were initially purified on a glutathione sepharose 4B affinity column as directed by the 201
manufacturer (GE Healthcare) using a lysis buffer containing PBS, 1 mM PMSF, 10 μM 202
Leupeptin, 1 μM Pepstatin A, 5 mM EDTA, 0.3% Tween-20, and 10 mg/ml lysozyme. 203
Glutathione-eluted rBmSA1/GST protein was desalted into 25 mM Tris buffer at pH 8.0 using 204
a 50 ml Sephadex G-25 desalting column (GE Healthcare) at a flow rate of 2 ml/ min. Protein 205
was bound on a Mono Q HR 5/5 strong anion exchange column (GE Healthcare) and eluted with 206
a 20 ml linear gradient from 0 to 0.4 M NaCl in 25 mM Tris at pH 7.4. Pooled protein-207
containing fractions were concentrated using Centricon-50 centrifugal filter devices (Millipore 208
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 11: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/11.jpg)
11
Corporation, Bedford, MA) and then dialyzed against 2000 volumes of PBS overnight at 4 oC 209
(Spectra/Por3, 3,500 Dalton cutoff; Spectrum Laboratories, Rancho Dominguez, CA). Protein 210
concentrations were determined using the BCA micro-assay (Pierce). 211
Glutathione-eluted rBm17N/GST protein samples were concentrated using Centricon-30 212
centrifugal filter devices (Millipore) and then desalted into 25 mM Tris/ 8 M urea buffer at pH 213
8.0 using a 5 ml HiTrap desalting column as directed by the manufacturer (GE Healthcare). 214
Protein was bound on a Mono Q HR 5/5 column (GE Healthcare) and eluted with a 20 ml linear 215
gradient from 0 to 0.4 M NaCl in 25 mM Tris/ 8 M urea buffer at pH 8.0. Pooled protein-216
containing fractions were dialyzed against 1000 volumes of PBS with 4 M urea overnight at 4 oC 217
(Spectra/Por3). Protein concentrations were determined using the BCA micro-assay (Pierce). 218
Schistosoma japonicum GST protein was expressed and purified as previously described (39, 219
44). 220
Monoclonal antibody. Recombinant BmSA1 protein lacking the GST fusion partner was 221
generated by cleavage with thrombin (GE Healthcare) while the protein was bound to a 222
glutathione sepharose 4B affinity column. Cleavage conditions were as directed by the 223
manufacturer. A mouse monoclonal IgG1 isotype antibody to the purified recombinant BmSA1 224
protein (designated as 3A6D) was generated by Southern Biotech (Birmingham, AL). 225
Antigen coupling to beads. Antigen coupling to SeroMap beads (Luminex Corporation, Austin, 226
TX) using 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide (Calbiochem/ EMD Biosciences, 227
LaJolla, CA) and N-hydroxysulfosuccinimide (Pierce) has been previously described (39, 40). 228
For both recombinant B. microti proteins and the GST control, 120 µg of protein was used for 229
coupling to 12.5 x 106 beads. To assess the efficiency of the coupling reactions, beads were 230
assayed (procedure described below) using a goat anti-GST antibody (GE Healthcare) and a 231
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 12: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/12.jpg)
12
biotinylated rabbit anti-goat IgG secondary antibody (Invitrogen). GST control, rBmSA1/GST, 232
and rBm17N/GST (two reactions) coupled beads had anti-GST MFI-BG values of 29,374, 233
28,451, and 23,153/ 28,580, respectively. Coupled beads from both rBm17N/GST reactions 234
behaved similarly with Babesia positive control sera (average MFI-BG values of 26,178 versus 235
26,039 and 13,587 versus 12,662), and both bead sets were used in the study. After coupling, the 236
beads were quantified by hemocytometer and stored at 4oC in PBS containing 1.0% bovine 237
serum albumin (BSA), 0.05% Tween 20, 0.02% sodium azide, and protease inhibitors as follows: 238
200 μg/ ml Pefabloc (Roche Diagnostics, Indianapolis, IL), 200 µg/ ml EDTA, and 1 µg/ ml each 239
of leupeptin and pepstatin A. 240
Multiplex bead assay (MBA). A 1:400 dilution of serum in PBS containing 0.5% BSA, 0.05% 241
Tween 20, 0.02% sodium azide, 0.5% poly(vinyl alcohol), and 0.8% polyvinylpyrrolidone was 242
incubated for 1 hr at 37oC and stored overnight at 4oC. In order to reduce non-specific binding, 243
extract from an IPTG-induced culture of pGEX4T-2 in BL21 E. coli cells was included in each 244
serum diluent at a final concentration of 3 μg/ml (40). After centrifugation at 17,000 x g for 5 245
min, 50 µL of the clarified serum dilution was added to each well of a 96-well filtered-bottom 246
plate (Millipore, Bedford, MA). All sera were assayed in duplicate using approximately 2500 247
beads from each antigen coupling reaction/ well. The beads were suspended in the serum 248
dilutions and allowed to gently shake for 1.5 h at room temperature. The development protocol 249
using biotinylated, monoclonal anti-IgG (clone H4; Southern Biotech) and anti-IgG4 (clone 250
HP6025; Zymed) antibodies and R-phycoerythrin-labeled streptavidin (Invitrogen) has been 251
previously described (40). After the final wash step, the beads in each well were suspended in 252
125 µL PBS, and the plate was analyzed using Bio-Plex 200 or 100 instruments (Bio-Rad, 253
Hercules, CA) equipped with Bio-Plex Manager 6.0 software (Bio-Rad). Gated data were 254
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 13: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/13.jpg)
13
acquired on at least 100 monodispersed beads of each spectral classification, and the median 255
fluorescence intensity for each analyte was calculated. After subtraction of the background 256
blank, the mean of the duplicate wells was reported as the median fluorescence intensity minus 257
background (MFI-BG). Two positive control sera, one with a high fluorescence intensity and 258
one with a mid-range fluorescence intensity, were included on each plate along with a negative 259
control. A sample having a positive response was repeated if the standard deviation values for 260
the duplicate wells of both the rBmSA1/GST and rBm17N/GST assays were >15% of the 261
respective mean values. After the completion of the initial Bio-plex analysis of the positive 262
control plates, assay wells were evacuated, the beads in each well were resuspended in 125 µL 263
PBS, and the plates were reanalyzed using a different instrument (intra assay repeats; same plate 264
read twice). Samples used in the specificity study were assayed on two separate occasions 265
(approximately two weeks apart) for rBmSA1/GST IgG reactivity (inter assay repeats). 266
Human serum specimens. Endemic babesiosis caused by B. microti has been reported in the 267
Northeast and upper Midwest regions of the US (54). As likely negative controls, we used sera 268
from two US cryptosporidiosis outbreaks: 44 from adult TX residents collected in 1998 and 8 269
from adult KS residents collected in 2003. Blood samples were collected from donors by 270
venipuncture, and the resulting sera were stored at -20oC. Written, informed consent was 271
obtained from these US study participants, and the protocol was approved by the Centers for 272
Disease Control and Prevention Institutional Review Board. Also included in the negative panel 273
were 30 anonymous samples from healthy adult Haitian blood donors collected in 1998 from a 274
region with a low prevalence of P. falciparum malaria. 275
Residual serum specimens that had been submitted to the Centers for Disease Control and 276
Prevention for babesiosis and malaria diagnostic testing between 1985 and 2011 were aliquoted 277
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 14: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/14.jpg)
14
and stripped of personal identifiers prior to testing. Serum samples from 78 confirmed B. microti 278
infected individuals who were positive by both slide microscopy and by B. microti IFA antibody 279
testing (3) (n = 4, 14, 37, 23 at IFA titers of 1: 64, 1:256, 1:1024, and >1:4096, respectively) 280
were used in the sensitivity analysis. IFA negative/ microscopy positive babesiosis samples were 281
not available for testing. To address issues of species specificity, 10 sera from B. duncani and B. 282
duncani-like infected individuals (CA and WA isolates) (6, 47) and 15 sera from B. divergens 283
and B. divergens-like infected individuals (MO1 and EU isolates) were tested in the recombinant 284
protein MBA (7, 17). All of the B. duncani group sera and 53% of the B. divergens group sera 285
were previously shown to have Babesia species-specific antibody responses by IFA with titers > 286
1:64. To determine whether cross-reactivity with malaria was present (4), we assayed 81 sera 287
from microscopy positive patients infected with P. malariae (n = 6), P. ovale (n = 7), P. 288
falciparum (n = 33), or P. vivax (n = 35). 289
Data analysis. Statistical analyses were conducted using the Wilcoxon signed-rank test, the 290
Kruskal-Wallis test or the Spearman rank correlation test (SigmaStat for Windows version 291
2.03.0, SPSS, Inc., Chicago, Ill.). Statistical significance was set at an alpha level of 0.05. 292
Reagents. Unless otherwise stated, reagents were purchased from Sigma Chemicals (St. Louis, 293
MO). 294
295
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 15: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/15.jpg)
15
Results 296
Identification of an immunodominant B. microti antigen. In a preliminary experiment, a 297
small panel of 10 presumed negative sera and 10 sera from confirmed B. microti patients was 298
used to screen Western blots of total B. microti proteins for immunodominant antigen candidates. 299
As shown by arrows in Fig. 1, unique B. microti antigens bands were detected in the 90 kDa, 50 300
kDa, 46 kDa, and 24 kDa regions of the IgG Western blots with the 46 kDa antigen band being 301
the most consistent. To determine whether any of these antigens were membrane associated, a 302
Triton X-114 detergent phase extraction was performed on an infected hamster red blood cell 303
particulate fraction. As shown in Fig. 2, both an infected hamster serum (Fig. 2A) and a human 304
patient serum (Fig. 2B) reacted strongly with a detergent-extracted antigen at approximately 40 305
kDa. The slight downward shift in the apparent molecular weight of the native antigen (from 306
approximately 46 kDa on the 12% polyacrylamide gel to approximately 40 kDa on the 10-22.5% 307
gradient polyacrylamide gel) was reproducible on laboratory prepared gels (data not shown). 308
We determined that the epitopes on the detergent-extracted antigen were likely protein rather 309
than carbohydrate in nature: proteinase K (24 h at 37 oC) completely degraded the epitopes 310
recognized by human serum while sodium periodate treatment (25 mM for 24 h at room 311
temperature) had no effect on IgG antibody recognition (data not shown). Aurodye staining of a 312
blot strip (Fig. 2C) suggested that the detergent-extracted antigen band was sufficiently isolated 313
to allow for peptide sequencing. The region containing the band of interest was excised from a 314
PVDF blot for amino-terminal Edman degradation sequencing and from a Coomassie-blue 315
stained polyacrylamide gel for trypsin digestion and mass spectral analysis. The 46/40 kDa 316
protein was identified as BMN1-9/ BmSA1 (35, 36) with an amino-terminal sequence of 317
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 16: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/16.jpg)
16
AlaGlyGlySer. This mature amino-terminus was correctly predicted by the SignalP cleavage 318
analysis described by Luo et al. (36). 319
Cloning and expression of immunodominant B. microti antigens. Because the BMN1-9-320
containing clone reported by Lodes et al. (35) appeared to contain two overlapping open reading 321
frames (GenBank Accession # AF206252), we decided to PCR amplify the gene from oligo(dT)-322
primed cDNA using two sequence-specific 5’ primers and a 3’ primer to the poly A tail. Except 323
at the 3’ end (where we identified an additional 5’-TG(A)20-3’ sequence) the 1014 bp product we 324
obtained from the semi-nested cDNA amplification (GenBank Accession # JX112361) was 325
identical in sequence to the BmSA1 clone recently reported by Luo et al. (36). The predicted 326
302 amino acid protein (from the mature amino terminus to the cDNA-encoded stop codon) had 327
a calculated molecular weight of 32.7 kDa and included a carboxy-terminal sequence consistent 328
with the addition of a glycosylphosphatidylinositol (GPI) anchor. DGPI (J. Kronegg and D. 329
Buloz; http://129.194.185.165/dgpi/), PredGPI (42), and bigPI Predictor (8) all indicated the 330
presence of a GPI anchor addition signal, but differed in the predicted location of the ω GPI 331
anchor attachment site. Highly charged amino acids made up 32% of the predicted BmSA1 332
protein sequence, and the predicted pI was 5.1. 333
Purified recombinant BmSA1 protein that was cleaved with thrombin to remove the GST 334
fusion partner was used to immunize mice for monoclonal antibody production. The apparent 335
molecular weight of the cleaved product was approximately 45 kDa on a 12% polyacrylamide 336
gel (data not shown). We obtained one IgG1 subclass monoclonal antibody, designated 3A6D, 337
and used it to probe a Western blot of Triton X-114 detergent extracts from uninfected and B. 338
microti-infected red blood cell membranes. The monoclonal antibody and a babesiosis patient 339
serum both reacted with an antigen band found only in the infected RBC detergent extract 340
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 17: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/17.jpg)
17
(indicated by arrow, Fig. 3). The apparent molecular weight of the native antigen on the Western 341
blot of an 8-16% polyacrylamide gel was 44 kDa. 342
In addition to the BmSA1 protein, we cloned and expressed a fragment of the antigen 343
previously reported to have the highest signal/ noise ratio with human sera, BMN1-17 (35). 344
Because the protein coding sequence reported by Lodes et al. was shared between two 345
overlapping clones from a gene family (35), we designed a forward primer using the BMN1-20 346
sequence that deleted the predicted 22 amino acid signal peptide and a reverse primer using the 347
BMN1-17 sequence that deleted a stretch of 22 hydrophobic amino acids from the carboxy 348
terminus. The 1221 bp PCR product should have resulted in a GST fusion protein with a 349
predicted size of 72 kDa. In fact, we obtained two types of clones, each with an insert size of 350
~1200 bp. One clone, Bm17, weakly expressed a GST fusion protein doublet in the 105 kDa 351
molecular weight range that was not easily purified to homogeneity, while the other clone, 352
Bm17N, abundantly expressed a single GST fusion protein in the 79 kDa molecular weight range 353
that was soluble and easily purified on a glutathione sepharose 4B column (data not shown). The 354
expressed proteins reacted strongly with babesiosis patient sera by ELISA, and yielded the 355
expected 26 kDa GST fragments when cleaved with thrombin (data not shown). 356
The nucleic acid sequence of the Bm17N clone (GenBank Accession # JX112362) differed 357
from published sequences at 4 base positions and contained a 96 bp deletion compared to 358
BMN1-17 (35). One of the base changes, a G to T base substitution located in the third repeat, 359
resulted in the introduction of an in-frame stop codon (GGA to TGA) that shortened the 360
expressed protein by an additional 167 amino acids. The predicted Bm17N truncated translation 361
product is a 26.8 kDa protein with a pI of 4.3 (53.1 kDa GST fusion protein; fusion protein pI of 362
4.7). The predicted protein sequence (Fig. 4) includes two of the 32-amino acid repeats 363
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 18: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/18.jpg)
18
identified by Lodes et al. (35) and two copies (100% and 85% sequence identity) of the 26-364
residue immunodominant peptide sequence identified by Houghton et al. (22). Because of the 365
ease of GST fusion protein production and because two-thirds (67%) of the deleted protein 366
sequence was made up of repeated sequence (Fig.4), the truncated rBm17N/GST protein was 367
used in our work. 368
Human immune responses to B. microti antigens. IgG antibody responses to both 369
recombinant B. microti antigens were assessed using the MBA. MFI-BG responses to GST 370
alone (GST coupled beads were included in each assay well as a control) ranged from 2 to 677 371
(median = 21; mean = 39) and were always below the cutoff values determined for the B. microti 372
antigens. Figure 5 shows the distributions of MBA responses for rBmSA1/GST (Panel A) and 373
rBm17N/GST (Panel B) assays for presumed negative (Control) and confirmed B. microti 374
positive sera (B. microti). Using ROC analysis (58), a cutoff value for rBmSA1/GST was 375
identified (1122 MFI-BG units) that resulted in a sensitivity of 98.7% and a specificity of 100% 376
(J-index = 0.987; 99.4% correct). The optimal cutoff value for rBm17N/GST, determined to be 377
5849 MFI-BG units, resulted in a sensitivity of 97.4% and specificity of 97.6% (J-index = 0.95; 378
97.5% correct). Using these cutoff values, one B. microti positive sample was misclassified as 379
negative by both assays (IFA titer = 1:256), while a second positive sample was misclassified 380
only by the rBm17N/GST assay (IFA titer = 1:64) (Table 1). Two presumed negative samples 381
had strongly positive responses to the rBm17N/GST but were negative in the rBmSA1/GST 382
assay (Table 1). Both of these samples were tested using the routine diagnostic B. microti IFA 383
(3) and were determined to be true negatives (titer < 1:8). Given that the maximum value of 384
each assay was approximately 29,500 MFI-BG units, the rBmSA1/GST assay had wider 385
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 19: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/19.jpg)
19
dynamic range and a higher signal/noise ratio (geomean positive signal/ geomean negative 386
signal; S/N = 994) than did the rBm17N/GST assay (S/N = 262). 387
To assess the species specificity of the recombinant protein MBA, sera from B. divergens 388
group (n = 15) and B. duncani group (n = 10) babesiosis cases and sera from 81 Plasmodium 389
spp. cases were assayed for antibody reactivity to the two recombinant B. microti antigens by 390
MBA. As expected, none of the non-B. microti babesiosis sera reacted with rBmSA1/GST or 391
rBm17N/GST proteins (Fig. 5). In contrast, one P. falciparum serum was strongly positive by 392
MBA (MFI-BG > 27,000) for both recombinant antigens. A second serum, from a P. ovale 393
patient, was weakly positive only for antibodies to rBmSA1/GST (MFI-BG = 2552), while 394
positive rBm17N/GST responses were detected for P. falciparum (n = 3), P. vivax (n = 2), and P. 395
malariae (n = 1) patient sera (Fig. 5). Overall, 2/81 (2.5%) malaria cases had positive responses 396
to rBmSA1/GST, and 7/81 (8.6%) had positive to rBm17N/GST (Table 1). Because 397
demographic data were not linked to the serum aliquots, we were unable to determine which of 398
the positive malaria cases lived in regions of the US that might be endemic for babesiosis. 399
Even though the majority of malaria MBA values were below the positive cutoff threshold, P. 400
falciparum and P. vivax MBA values for both recombinant B. microti antigens were statistically 401
greater than those of presumed negative controls (Kruskal-Wallis test with multiple comparisons; 402
P < 0.05). The P. ovale/ P. malariae MBA values were only significantly greater than control 403
values for the rBm17N/GST assay. 404
IgG MBA performance. To address concerns about the stability of the antibody/ antigen/ 405
reporter molecule complex and about the reproducibility between instruments, B. microti 406
positive sample assay plates were read consecutively using two different instruments. As shown 407
in Fig. 6A, MBA values (including controls; n = 84) obtained during primary rBmSA1/GST 408
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 20: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/20.jpg)
20
analysis on one instrument were stable upon secondary analysis of the same assay plates with a 409
different Bio-Plex instrument (Spearman correlation coefficient = 0.968). No significant 410
differences were observed by Wilcoxon analysis of the paired values for either MBA 411
(rBmSA1/GST P = 0.088; rBm17N/GST P = 0.323). The Babesia and Plasmodium specificity 412
study samples (including controls, n = 115) were used to examine the interassay stability of the 413
rBmSA1/GST MBA (Fig. 6B). The interassay correlation was quite good (Spearman correlation 414
coefficient = 0.986), and, although two borderline negative values were borderline positive in the 415
repeat analysis, the overall differences observed among the MBA results were not statistically 416
significant (Wilcoxon analysis; P = 0.633). 417
The MBA results described above were collected over the course of 8 months. During that 418
time, the rBmSA1/GST beads were stable at 4 oC in the presence of protease inhibitors. With 419
one exception (deleted from analysis, likely a dilution error as both assays were equally 420
affected), individual positive control sample values fell within +7% of their overall study mean 421
values (positive control means: 23,989 and 14,202; standard deviations: 431 and 510, 422
respectively). In contrast, the rBm17N/GST beads degraded sometime between the third month 423
and the eighth month of storage. The reason for the degradation is unclear, but we were able to 424
recouple beads with rBm17N/GST and complete the study with control value ranges comparable 425
to those obtained for the rBmSA1/GST assay (positive control means: 25,842 and 12,902; 426
standard deviations: 523 and 449, respectively). 427
428
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 21: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/21.jpg)
21
Discussion 429
The risk of acquiring human B. microti infection is likely increasing due to increasing vector 430
tick populations in endemic areas, increasing levels of recreational exposure to potentially 431
infected ticks, and the lack of a sensitive and specific high-throughput screening assay for 432
donated blood and blood products (14, 19, 25, 27, 32). In addition to traditional blood smear 433
microscopy, Western blot, ELISA, IFA, and PCR assays have been developed by various 434
laboratories for diagnosis. Unfortunately, none of these assays are 100% sensitive and specific 435
in every phase of infection: PCR and microscopy are superior to IFA in the acute infection phase 436
before an immune response has developed, but antibody-based assays are more likely to detect 437
low level infections in the late or chronic phases when parasite loads are extremely low (14, 29, 438
30, 34, 50). These low level, largely asymptomatic infections are a particular concern for 439
transfusion-transmitted babesiosis (19, 20, 23, 24, 53). 440
In an effort to develop an improved antibody detection technique, we surveyed B. microti total 441
antigen Western blots for reactive bands and identified an immunodominant antigen using 442
detergent extraction and protein sequencing techniques. The expressed recombinant protein, 443
originally named BMN1-9 by Lodes et al. (35) but more recently called BmSA1 by Luo et al. 444
(36), migrated on polyacrylamide gels with an apparent molecular weight greater than the 445
predicted molecular weight (45 kDa versus 32.7 kDa). The published polyacrylamide gels of 446
Luo et al. for the same BmSA1/GST construct as we used also suggest an apparent molecular 447
weight significantly greater than 33 kDa (36). The apparent molecular weight of the Triton X-448
114-extracted native protein was 40-46 kDa and appeared to vary with polyacrylamide gel 449
conditions. While some of the size variability of the native antigen may be the result of post-450
translational modifications (such as a GPI anchor), the majority of the unexpected size 451
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 22: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/22.jpg)
22
differential of both native and recombinant proteins may result from the high proportion of 452
charged amino acids (32%) present in the sequence. We have previously documented similar 453
aberrant gel migration patterns with another highly charged, GPI-anchored parasite surface 454
protein, the Cryptosporidium parvum 17-kDa antigen (43). 455
Host reactivity to the BmSA1 protein has been characterized using animal models, and the 456
early appearance and long duration of the specific immune response may make this antigen a 457
good target for an antibody detection assay. Hamster antibodies to BmSA1 were apparent by 458
day 4-5 of experimental B. microti infection, and an indirect ELISA using recombinant BmSA1 459
as antigen was 100% sensitive when compared to blood film microscopy (36, 37). Sera from 460
pathogen free animals or from animals infected with pathogens other than B. microti (including 461
other Babesia spp.) were uniformly negative by indirect ELISA (36, 37). Data from human 462
serum assays using this antigen, however, are limited (35). In our study, we incorporated 463
recombinant BmSA1/GST into a multiplex bead-based serologic assay for detection of specific 464
IgG antibodies and, using human samples with a wide range of IFA titers, determined that the 465
assay was both sensitive (98.7% sensitive using sera from microscopy and IFA positive B. 466
microti patients) and specific (100% specific using presumed negatives and 97.5% using malaria 467
positive sera). Because information on the relative timing of the antibody response and the 468
appearance of parasitemia in humans naturally infected by tick inoculation is lacking, additional 469
studies will be needed to assess the utility of the MBA in the early phases of infection. 470
The true power of the multiplex assay is that it allows for the simultaneous detection of 471
multiple antibody responses in a single assay well. As a benchmark for sensitivity and 472
specificity comparisons, we expressed and multiplexed a sequence related to the BMN1-17/ 473
BMN1-20 protein family previously identified as immunodominant antigens by Lodes et al. (35). 474
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 23: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/23.jpg)
23
The BMN1-17 protein contains 7 copies of a 32 amino acid repeat and has been reported to 475
migrate on polyacrylamide gels as a doublet with an apparent molecular weight greater than the 476
predicted molecular weight (81 kDa versus 49.4kDa) (35). Even though we used a different 477
expression system (GST versus 6X His), our results with the Bm17 clone confirm the presence 478
of a doublet and the aberrant gel migration of the full length protein (data not shown). We have 479
some limited evidence that points to the single 90kDa protein band on our Western blots as the 480
Bm1-17 antigen (data not shown), and would suggest that the observed recombinant protein 481
doublet is an artifact of the expression system. Our Bm17N clone contained only 6 repeats [like 482
the BMN1-20 clone of Lodes et al. (35)] and expressed a truncated recombinant protein because 483
of an in-frame stop codon within the third repeat. We have not yet determined whether the stop 484
codon is a PCR artifact. It is possible that the truncated protein coding sequence is a previously 485
unrecognized member of the gene family represented by BMN1-17 and BMN1-20 that may be 486
expressed in lower abundance. Compared to assays using the rBmSA1/GST protein, assays 487
using the truncated rBm17N/GST protein were slightly less sensitive (97.4%) and less specific 488
with presumed negative sera (97.6%) and malaria positive sera (91.3%). Although we did not 489
extensively test the full-length recombinant protein from our Bm17 clone, we think it unlikely 490
that the inclusion of the additional repeat sequences downstream of the internal Bm17N stop 491
codon would markedly improve the specificity of the assay. The issue of cross reactivity with 492
malaria positive sera (perhaps as high as 30%) has been previously documented for the full-493
length BMN1-17 antigen (22). 494
If, however, a “positive for two specific antigens” definition was adopted for the MBA, the 495
result would be a relatively sensitive (97.4%) and highly specific assay (100% for presumed 496
negatives, 100% for other Babesia spp., and 98.8% for malaria positive sera). The one malaria-497
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 24: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/24.jpg)
24
infected donor who was positive for antibodies to both B. microti antigens had very high 498
responses (>27,000). Although IFA cross reactivity between sera from malaria-infected patients 499
and antigens from B. microti has been previously reported (4), the magnitude of the responses to 500
both recombinant antigens and the fact that some of the malaria samples were submitted from 501
regions of the US where babesiosis is endemic suggest the possibility that this individual may 502
have been infected with both malaria and B. microti. We hypothesize that the use of a two-503
antigen MBA for screening of low prevalence populations would minimize the number of false 504
positives, and, in the case of blood donor screening, would detect the majority of babesiosis 505
positive donors while all but eliminating unnecessary donor deferrals. Studies with a well-506
defined, longitudinal set of sera from a babesiosis patient or from experimentally infected 507
animals are needed to confirm the timing of the IgG response and the utility of the assays in all 508
phases of Babesia infection. 509
The MBA results were reproducible on different days and using different instruments. Even 510
values well below the positive cutoff were reproduced upon repeated assay. Beads coupled with 511
the BmSA1 antigen were stable for at least 8 months, but beads coupled with the Bm17N antigen 512
appeared to degrade during long term storage. That we were able to recouple fresh 513
rBm17N/GST to beads and reproduce our MBA control values suggests that there is some 514
robustness to the process. We are currently exploring low temperature storage conditions for the 515
Bm17N/GST-coupled beads in an attempt to prevent degradation in future work. 516
Unfortunately, the strength of a highly specific MBA is also a weakness in terms of the 517
detection of individuals who are infected with other Babesia species. Cross reacting antibody 518
responses to B. microti antigens have not been reported using infection sera from other human 519
and animal Babesia species, and our results using sera from B. duncani- and B. divergens-520
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 25: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/25.jpg)
25
infected patients support those findings (14, 17, 18, 36, 37, 41, 47). Given the apparent species 521
specificity of the response, one or more antigens from both B. duncani and B. divergens would 522
be required to cover all of the potential Babesia infections that might be found in the US blood 523
supply. With an additional investment in antigen discovery, cloning, and multiplex assay 524
development, this goal is certainly achievable. 525
526
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 26: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/26.jpg)
26
Footnotes 527
Use of trade names is for identification only and does not imply endorsement by the Public 528
Health Service or by the U.S. Department of Health and Human Services. The findings and 529
conclusions in this report are those of the authors and do not necessarily represent the official 530
position of the Centers for Disease Control and Prevention. 531
532
Abbreviations: SDS, sodium dodecylsulfate; MBA, multiplex bead assay; PBS, buffer containing 533
0.85% NaCl, 10 mM Na2HPO4 at pH 7.2; PVDF, polyvinylidene difluoride; GST, glutathione-S-534
transferase; ELISA, enzyme-linked immunoassay; Buffer 1, PBS containing 0.5% BSA, 0.05% 535
Tween 20, 0.02% sodium azide, 0.5% PVA, and 0.8% PVP; Buffer 2, PBS containing 0.5% 536
BSA, 0.05% Tween 20, 0.02% sodium azide; MFI-BG, median fluorescence intensity minus 537
background; GPI, glycosylphosphatidylinositol. 538
539
540
541
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 27: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/27.jpg)
27
Figure Legends 542
Figure 1. Identification of B. microti reactive antigens. Proteins from a hypotonic saponin lysate 543
of B. microti-infected hamster red blood cells were resolved on a 12% polyacrylamide gel and 544
electrotransferred to PVDF membrane as described in the Materials and Methods. Strips of 545
membrane were incubated with sera from presumed negatives or with sera from confirmed 546
babesiosis patients at a dilution of 1:50. Bound IgG antibodies were visualized using a 547
biotinylated monoclonal mouse anti-human IgG and the streptavidin-alkaline phosphatase 548
system described in the Materials and Methods. Reactive antigen bands unique to positive sera 549
are identified with arrows. The positions of molecular weight markers (MW x 10-3) are indicated 550
on the left. 551
552
Figure 2. A membrane associated antigen identified by detergent extraction. A post-sonication 553
particulate fraction from B. microti-infected hamster red blood cells was extracted using Triton 554
X-114 detergent as described in Materials and Methods. Extracted proteins were resolved on a 555
10-22.5% polyacrylamide gel and transferred to PVDF. Strips of membrane were incubated with 556
sera from an infected hamster (Panel A), sera from a babesiosis positive patient (Panel B), or with 557
AuroDye Forte colloidal gold stain (Panel C). Bound IgG antibodies were visualized as 558
described in Fig. 1. The positions of molecular weight markers (MW x 10-3) are indicated on the 559
left. A major immunodominant band is indicated by an arrow just above the 36 kDa marker. 560
561
Figure 3. The immunodominant membrane-associated antigen is only found in B. microti-562
infected red blood cells. Triton X-114-extracted proteins (3.5 μg/ lane) from uninfected (U) and 563
B. microti infected (I) red blood cell membranes were resolved on an 8-16% polyacrylamide gel 564
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 28: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/28.jpg)
28
and transferred to PVDF. PVDF sections were incubated with either serum from a confirmed 565
babesiosis patient (Human Serum) or with a mouse monoclonal antibody raised against rBmSA1 566
protein (mAb 3A6D). Bound IgG antibodies were visualized as described in Fig. 1. The 567
positions of molecular weight markers (MW x 10-3) are indicated on the left. Monoclonal 568
antibody reactivity confirmed the identity of the immunodominant protein band in the parasitized 569
red blood cell detergent extract as BMN1-9/ BmSA1 (indicated by arrow). 570
571
Figure 4. Deduced amino acid sequence of the Bm17N clone. The deduced amino acid 572
sequence of clone Bm17N is presented in a manner to highlight the repeat structure of the 573
protein. The sequence contains two 47-amino acid repeats and a substructure of six 32-amino 574
acid repeats. Compared to the published BMN1-17 and BMN1-20 sequences (35), the Bm17N 575
sequence contained four base substitutions that resulted in three amino acid substitutions 576
(indicated in the sequence by bold italics) and the introduction of an in-frame stop codon (#, 577
position 239) in the third repeat. The immunodominant 26-amino acid peptide sequence 578
identified by Houghton et al. (22) is indicated in bold with an underline. 579
580
Figure 5. MBA detection of IgG antibodies among presumed negatives and confirmed 581
babesiosis and malaria cases. MBA was conducted as described in Materials and Methods using 582
beads coated with rBmSA1/GST (Panel A) or rBm17N/GST (Panel B). Bound IgG antibodies 583
were detected using a biotinylated mouse monoclonal anti-human IgG and R-phycoerythrin-584
labeled streptavidin. Distributions for the presumed negative sample set (Control, n = 82), B. 585
microti positives (n = 78), B. duncani and B. divergens positives (n = 25), P. ovale and P. 586
malariae positives (n = 13), P. falciparum positives (n = 33) and P. vivax positives (n = 35) are 587
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 29: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/29.jpg)
29
presented. Boxes include values between the 25th and 75th percentiles, whiskers include values 588
between the 10th and 90th percentile, and outliers are indicated by data points. The median values 589
are indicated within the box by a line. The respective cutoff values determined by ROC analysis 590
for rBmSA1/GST (MFI-BG = 1123) and rBm17N/GST (MFI-BG = 5850) are indicated by 591
horizontal lines in Panel A and Panel B, respectively. 592
593
Figure 6. Reproducibility of the rBmSA1/GST MBA assay. Panel A shows MBA values (MFI-594
BG) for assay plates that were run consecutively on two different Bio-Plex instruments on the 595
same day. Panel B shows the MBA values (MFI-BG) for samples that were independently 596
assayed approximately two weeks apart. Note that Panel B is plotted on a logarithmic scale to 597
allow visualization of a wider range of values. Least-squares regression lines are given in both 598
plots. The positive cutoff value for the rBmSA1/GST MBA was determined to be 1122 MFI-599
BG units. 600
601
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 30: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/30.jpg)
30
Table 1 602
Multiplex bead assay (MBA) results for specimens tested. 603
Number (%) positive by MBA 604
Specimens tested for sensitivity Number positive rBmSA1 rBm17N Botha 605
B. microti infected patientsb,c 78 77 (98.7) 76 (97.4) 76 (97.4) 606
607
Specimens tested for specificity 608
B. duncani infected patients 10 0 (0) 0 (0) 0 (0) 609
B. divergens infected patients 15 0 (0) 0 (0) 0 (0) 610
Plasmodium spp. infected patientsd 81 2 (2.5) 7 (8.6) 1 (1.2) 611
Presumed B. microti negativesc,e 82 0 (0) 2 (2.4) 0 (0) 612
aPositive by MBA for antibodies to both rBmSA1 and rBm17N. 613
bIFA positive (>1:64) and blood smear positive patients. 614
cUsed in the ROC analysis for determination of cutoff values. 615
dIncludes samples from patients infected with P. falciparum (n = 33), P. vivax (n = 35), P. ovale 616
(n = 7), and P. malariae (n = 6). 617
eIncludes C. parvum outbreak samples collected from residents of Texas (n = 44) and Kansas (n 618
= 8) and healthy Haitian blood donors (n = 30). 619
620
621
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 31: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/31.jpg)
31
References 622
1. Asad, S., J. Sweeney, and L. A. Mermel. 2009. Transfusion-transmitted babesiosis in 623
Rhode Island. Transfusion 49:2564-73. 624
2. Beattie, J. F., M. L. Michelson, and P. J. Holman. 2002. Acute babesiosis caused by 625
Babesia divergens in a resident of Kentucky. The New England journal of medicine 626
347:697-8. 627
3. Chisholm, E. S., T. K. Ruebush, 2nd, A. J. Sulzer, and G. R. Healy. 1978. Babesia 628
microti infection in man: evaluation of an indirect immunofluorescent antibody test. The 629
American journal of tropical medicine and hygiene 27:14-9. 630
4. Chisholm, E. S., A. J. Sulzer, and T. K. Ruebush, 2nd. 1986. Indirect 631
immunofluorescence test for human Babesia microti infection: antigenic specificity. The 632
American journal of tropical medicine and hygiene 35:921-5. 633
5. Chittum, H. S., W. S. Lane, B. A. Carlson, P. P. Roller, F. D. Lung, B. J. Lee, and D. 634
L. Hatfield. 1998. Rabbit beta-globin is extended beyond its UGA stop codon by 635
multiple suppressions and translational reading gaps. Biochemistry 37:10866-70. 636
6. Conrad, P. A., A. M. Kjemtrup, R. A. Carreno, J. Thomford, K. Wainwright, M. 637
Eberhard, R. Quick, S. R. Telford, 3rd, and B. L. Herwaldt. 2006. Description of 638
Babesia duncani n.sp. (Apicomplexa: Babesiidae) from humans and its differentiation 639
from other piroplasms. International journal for parasitology 36:779-89. 640
7. Duh, D., M. Jelovsek, and T. Avsic-Zupanc. 2007. Evaluation of an indirect 641
fluorescence immunoassay for the detection of serum antibodies against Babesia 642
divergens in humans. Parasitology 134:179-85. 643
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 32: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/32.jpg)
32
8. Eisenhaber, B., P. Bork, and F. Eisenhaber. 1998. Sequence properties of GPI-644
anchored proteins near the omega-site: constraints for the polypeptide binding site of the 645
putative transamidase. Protein engineering 11:1155-61. 646
9. Eng, J. K., A. L. McCormack, and J. R. Yates Iii. 1994. An approach to correlate 647
tandem mass spectral data of peptides with amino acid sequences in a protein database. 648
Journal of the American Society for Mass Spectrometry 5:976-989. 649
10. Filstein, M. R., J. L. Benach, D. J. White, B. A. Brody, W. D. Goldman, C. W. 650
Bakal, and R. S. Schwartz. 1980. Serosurvey for human babesiosis in New York. The 651
Journal of infectious diseases 141:518-21. 652
11. Fitzpatrick, J. E., C. C. Kennedy, M. G. McGeown, D. G. Oreopoulos, J. H. 653
Robertson, and M. A. Soyannwo. 1968. Human case of piroplasmosis (babesiosis). 654
Nature 217:861-2. 655
12. Gerber, M. A., E. D. Shapiro, P. J. Krause, R. G. Cable, S. J. Badon, and R. W. 656
Ryan. 1994. The risk of acquiring Lyme disease or babesiosis from a blood transfusion. 657
The Journal of infectious diseases 170:231-4. 658
13. Gubernot, D. M., C. T. Lucey, K. C. Lee, G. B. Conley, L. G. Holness, and R. P. 659
Wise. 2009. Babesia infection through blood transfusions: reports received by the US 660
Food and Drug Administration, 1997-2007. Clinical infectious diseases : an official 661
publication of the Infectious Diseases Society of America 48:25-30. 662
14. Gubernot, D. M., H. L. Nakhasi, P. A. Mied, D. M. Asher, J. S. Epstein, and S. 663
Kumar. 2009. Transfusion-transmitted babesiosis in the United States: summary of a 664
workshop. Transfusion 49:2759-71. 665
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 33: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/33.jpg)
33
15. Hatcher, J. C., P. D. Greenberg, J. Antique, and V. E. Jimenez-Lucho. 2001. Severe 666
babesiosis in Long Island: review of 34 cases and their complications. Clinical infectious 667
diseases : an official publication of the Infectious Diseases Society of America 32:1117-668
25. 669
16. Healy, G. R., A. Speilman, and N. Gleason. 1976. Human babesiosis: reservoir in 670
infection on Nantucket Island. Science 192:479-80. 671
17. Herwaldt, B., D. H. Persing, E. A. Precigout, W. L. Goff, D. A. Mathiesen, P. W. 672
Taylor, M. L. Eberhard, and A. F. Gorenflot. 1996. A fatal case of babesiosis in 673
Missouri: identification of another piroplasm that infects humans. Annals of internal 674
medicine 124:643-50. 675
18. Herwaldt, B. L., G. de Bruyn, N. J. Pieniazek, M. Homer, K. H. Lofy, S. B. 676
Slemenda, T. R. Fritsche, D. H. Persing, and A. P. Limaye. 2004. Babesia divergens-677
like infection, Washington State. Emerging infectious diseases 10:622-9. 678
19. Herwaldt, B. L., J. V. Linden, E. Bosserman, C. Young, D. Olkowska, and M. 679
Wilson. 2011. Transfusion-associated babesiosis in the United States: a description of 680
cases. Annals of internal medicine 155:509-19. 681
20. Herwaldt, B. L., D. F. Neitzel, J. B. Gorlin, K. A. Jensen, E. H. Perry, W. R. Peglow, 682
S. B. Slemenda, K. Y. Won, E. K. Nace, N. J. Pieniazek, and M. Wilson. 2002. 683
Transmission of Babesia microti in Minnesota through four blood donations from the 684
same donor over a 6-month period. Transfusion 42:1154-8. 685
21. Homer, M. J., I. Aguilar-Delfin, S. R. Telford, 3rd, P. J. Krause, and D. H. Persing. 686
2000. Babesiosis. Clinical microbiology reviews 13:451-69. 687
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 34: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/34.jpg)
34
22. Houghton, R. L., M. J. Homer, L. D. Reynolds, P. R. Sleath, M. J. Lodes, V. Berardi, 688
D. A. Leiby, and D. H. Persing. 2002. Identification of Babesia microti-specific 689
immunodominant epitopes and development of a peptide EIA for detection of antibodies 690
in serum. Transfusion 42:1488-96. 691
23. Johnson, S. T., R. G. Cable, and D. A. Leiby. 2012. Lookback investigations of 692
Babesia microti-seropositive blood donors: seven-year experience in a Babesia-endemic 693
area. Transfusion 52:1509-16. 694
24. Johnson, S. T., R. G. Cable, L. Tonnetti, B. Spencer, J. Rios, and D. A. Leiby. 2009. 695
Seroprevalence of Babesia microti in blood donors from Babesia-endemic areas of the 696
northeastern United States: 2000 through 2007. Transfusion 49:2574-82. 697
25. Kjemtrup, A. M., and P. A. Conrad. 2000. Human babesiosis: an emerging tick-borne 698
disease. International journal for parasitology 30:1323-37. 699
26. Krause, P. J., B. E. Gewurz, D. Hill, F. M. Marty, E. Vannier, I. M. Foppa, R. R. 700
Furman, E. Neuhaus, G. Skowron, S. Gupta, C. McCalla, E. L. Pesanti, M. Young, 701
D. Heiman, G. Hsue, J. A. Gelfand, G. P. Wormser, J. Dickason, F. J. Bia, B. 702
Hartman, S. R. Telford, 3rd, D. Christianson, K. Dardick, M. Coleman, J. E. 703
Girotto, and A. Spielman. 2008. Persistent and relapsing babesiosis in 704
immunocompromised patients. Clinical infectious diseases : an official publication of the 705
Infectious Diseases Society of America 46:370-6. 706
27. Krause, P. J., K. McKay, J. Gadbaw, D. Christianson, L. Closter, T. Lepore, S. R. 707
Telford, 3rd, V. Sikand, R. Ryan, D. Persing, J. D. Radolf, A. Spielman, and G. 708
Tick-Borne Infection Study. 2003. Increasing health burden of human babesiosis in 709
endemic sites. The American journal of tropical medicine and hygiene 68:431-6. 710
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 35: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/35.jpg)
35
28. Krause, P. J., A. Spielman, S. R. Telford, 3rd, V. K. Sikand, K. McKay, D. 711
Christianson, R. J. Pollack, P. Brassard, J. Magera, R. Ryan, and D. H. Persing. 712
1998. Persistent parasitemia after acute babesiosis. The New England journal of medicine 713
339:160-5. 714
29. Krause, P. J., S. Telford, 3rd, A. Spielman, R. Ryan, J. Magera, T. V. Rajan, D. 715
Christianson, T. V. Alberghini, L. Bow, and D. Persing. 1996. Comparison of PCR 716
with blood smear and inoculation of small animals for diagnosis of Babesia microti 717
parasitemia. Journal of clinical microbiology 34:2791-4. 718
30. Krause, P. J., S. R. Telford, 3rd, R. Ryan, P. A. Conrad, M. Wilson, J. W. 719
Thomford, and A. Spielman. 1994. Diagnosis of babesiosis: evaluation of a serologic 720
test for the detection of Babesia microti antibody. The Journal of infectious diseases 721
169:923-6. 722
31. Laemmli, U. K. 1970. Cleavage of structural proteins during the assembly of the head of 723
bacteriophage T4. Nature 227:680-5. 724
32. Leiby, D. A. 2006. Babesiosis and blood transfusion: flying under the radar. Vox 725
sanguinis 90:157-65. 726
33. Leiby, D. A., A. P. Chung, J. E. Gill, R. L. Houghton, D. H. Persing, S. Badon, and 727
R. G. Cable. 2005. Demonstrable parasitemia among Connecticut blood donors with 728
antibodies to Babesia microti. Transfusion 45:1804-10. 729
34. Loa, C. C., M. E. Adelson, E. Mordechai, I. Raphaelli, and R. C. Tilton. 2004. 730
Serological diagnosis of human babesiosis by IgG enzyme-linked immunosorbent assay. 731
Current microbiology 49:385-9. 732
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 36: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/36.jpg)
36
35. Lodes, M. J., R. L. Houghton, E. S. Bruinsma, R. Mohamath, L. D. Reynolds, D. R. 733
Benson, P. J. Krause, S. G. Reed, and D. H. Persing. 2000. Serological expression 734
cloning of novel immunoreactive antigens of Babesia microti. Infection and immunity 735
68:2783-90. 736
36. Luo, Y., H. Jia, M. A. Terkawi, Y. K. Goo, S. Kawano, H. Ooka, Y. Li, L. Yu, S. 737
Cao, J. Yamagishi, K. Fujisaki, Y. Nishikawa, A. Saito-Ito, I. Igarashi, and X. Xuan. 738
2011. Identification and characterization of a novel secreted antigen 1 of Babesia microti 739
and evaluation of its potential use in enzyme-linked immunosorbent assay and 740
immunochromatographic test. Parasitology international 60:119-25. 741
37. Luo, Y., M. A. Terkawi, H. Jia, G. O. Aboge, Y.-K. Goo, S. Cao, Y. Li, L. Yu, H. 742
Ooka, K. Kamyingkird, T. Masatani, S. Zhang, Y. Nishikawa, I. Igarashi, and X. 743
Xuan. 2012. A double antibody sandwich enzyme-linked immunosorbent assay for 744
detection of secreted antigen 1 of Babesia microti using hamster model. Experimental 745
Parasitology 130:178-182. 746
38. Maniatis, T., E. F. Fritsch, and J. Sambrook. 1982. Molecular cloning : a laboratory 747
manual. Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. 748
39. Moss, D. M., J. M. Montgomery, S. V. Newland, J. W. Priest, and P. J. Lammie. 749
2004. Detection of Cryptosporidium antibodies in sera and oral fluids using multiplex 750
bead assay. The Journal of parasitology 90:397-404. 751
40. Moss, D. M., J. W. Priest, A. Boyd, T. Weinkopff, Z. Kucerova, M. J. Beach, and P. 752
J. Lammie. 2011. Multiplex bead assay for serum samples from children in Haiti 753
enrolled in a drug study for the treatment of lymphatic filariasis. The American journal of 754
tropical medicine and hygiene 85:229-37. 755
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 37: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/37.jpg)
37
41. Persing, D. H., B. L. Herwaldt, C. Glaser, R. S. Lane, J. W. Thomford, D. 756
Mathiesen, P. J. Krause, D. F. Phillip, and P. A. Conrad. 1995. Infection with a 757
Babesia-like organism in northern California. The New England journal of medicine 758
332:298-303. 759
42. Pierleoni, A., P. L. Martelli, and R. Casadio. 2008. PredGPI: a GPI-anchor predictor. 760
BMC bioinformatics 9:392. 761
43. Priest, J. W., J. P. Kwon, M. J. Arrowood, and P. J. Lammie. 2000. Cloning of the 762
immunodominant 17-kDa antigen from Cryptosporidium parvum. Molecular and 763
biochemical parasitology 106:261-71. 764
44. Priest, J. W., J. P. Kwon, D. M. Moss, J. M. Roberts, M. J. Arrowood, M. S. 765
Dworkin, D. D. Juranek, and P. J. Lammie. 1999. Detection by enzyme immunoassay 766
of serum immunoglobulin G antibodies that recognize specific Cryptosporidium parvum 767
antigens. Journal of clinical microbiology 37:1385-92. 768
45. Priest, J. W., A. Mehlert, M. J. Arrowood, M. W. Riggs, and M. A. Ferguson. 2003. 769
Characterization of a low molecular weight glycolipid antigen from Cryptosporidium 770
parvum. The Journal of biological chemistry 278:52212-22. 771
46. Priest, J. W., D. M. Moss, G. S. Visvesvara, C. C. Jones, A. Li, and J. L. Isaac-772
Renton. 2010. Multiplex assay detection of immunoglobulin G antibodies that recognize 773
Giardia intestinalis and Cryptosporidium parvum antigens. Clinical and vaccine 774
immunology : CVI 17:1695-707. 775
47. Prince, H. E., M. Lape-Nixon, H. Patel, and C. Yeh. 2010. Comparison of the Babesia 776
duncani (WA1) IgG detection rates among clinical sera submitted to a reference 777
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 38: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/38.jpg)
38
laboratory for WA1 IgG testing and blood donor specimens from diverse geographic 778
areas of the United States. Clinical and vaccine immunology : CVI 17:1729-33. 779
48. Rosner, F., M. H. Zarrabi, J. L. Benach, and G. S. Habicht. 1984. Babesiosis in 780
splenectomized adults. Review of 22 reported cases. The American journal of medicine 781
76:696-701. 782
49. Ruebush, T. K., 2nd, D. D. Juranek, E. S. Chisholm, P. C. Snow, G. R. Healy, and A. 783
J. Sulzer. 1977. Human babesiosis on Nantucket Island. Evidence for self-limited and 784
subclinical infections. The New England journal of medicine 297:825-7. 785
50. Ryan, R., P. J. Krause, J. Radolf, K. Freeman, A. Spielman, R. Lenz, and A. Levin. 786
2001. Diagnosis of babesiosis using an immunoblot serologic test. Clinical and diagnostic 787
laboratory immunology 8:1177-80. 788
51. Skrabalo, Z., and Z. Deanovic. 1957. Piroplasmosis in man; report of a case. 789
Documenta de medicina geographica et tropica 9:11-6. 790
52. Spielman, A., C. M. Clifford, J. Piesman, and M. D. Corwin. 1979. Human babesiosis 791
on Nantucket Island, USA: description of the vector, Ixodes (Ixodes) dammini, n. sp. 792
(Acarina: Ixodidae). Journal of medical entomology 15:218-34. 793
53. Tonnetti, L., A. F. Eder, B. Dy, J. Kennedy, P. Pisciotto, R. J. Benjamin, and D. A. 794
Leiby. 2009. Transfusion-transmitted Babesia microti identified through hemovigilance. 795
Transfusion 49:2557-63. 796
54. Vannier, E., B. E. Gewurz, and P. J. Krause. 2008. Human babesiosis. Infectious 797
disease clinics of North America 22:469-88, viii-ix. 798
55. Western, K. A., G. D. Benson, N. N. Gleason, G. R. Healy, and M. G. Schultz. 1970. 799
Babesiosis in a Massachusetts resident. The New England journal of medicine 283:854-6. 800
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 39: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/39.jpg)
39
56. White, D. J., J. Talarico, H. G. Chang, G. S. Birkhead, T. Heimberger, and D. L. 801
Morse. 1998. Human babesiosis in New York State: Review of 139 hospitalized cases 802
and analysis of prognostic factors. Archives of internal medicine 158:2149-54. 803
57. Young, C., A. Chawla, V. Berardi, J. Padbury, G. Skowron, P. J. Krause, and G. the 804
Babesia Testing Investigational Containment Study. 2012. Preventing transfusion-805
transmitted babesiosis: preliminary experience of the first laboratory-based blood donor 806
screening program. Transfusion 52:1523-1529. 807
58. Zweig, M. H., and G. Campbell. 1993. Receiver-operating characteristic (ROC) plots: a 808
fundamental evaluation tool in clinical medicine. Clinical chemistry 39:561-77. 809
810
811
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 40: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/40.jpg)
N ti P itiNegatives Positives
250148
98
6464
50
36
22
16
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 41: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/41.jpg)
250148
A B C
98
64
50
36
2216
6
4
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 42: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/42.jpg)
HumanSerum
mAb3A6DSerum 3A6D
U IU I
98
64
5050
36
22
16
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 43: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/43.jpg)
1 GDVYEISSGNPPDIEPTSTSLETNVVTNYIPEPNADSESVHVEIQEHDNINPQDACDSEPLEQM
65 DSDTRVLPESLDEGVPHQFSRLGHHSDMASDINDEEPSFKIGENDIIQPSWEDTAPYHSIDDE
128 ELDNLMRLTAQETSDDHEEGNGKLNTNKSEKTERKSHDTQTPQEIYE
175 ELDNLLRLTAQEIYEERKEGHGKPNTNKSEKAERKSHDTQTTQEICE
222 ECEEGHDKINKNKSGNA#IKSYDTQTPQETSD
254 AHEEGHDEINTNKSEKAERKSHDTQTTQEICE
286 ECEEGHDKINKNKSGNAGIKSYDTQTPQETSD
318 AHEEEHGNLNKNKSGKAGIKSHNTQTPLKKKD
350 FCKEGCHGCNNKPEDNERDPSSPDDDGGCEFGMTNHFVFDYKTTLLLKSLKTETSTH#
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from
![Page 45: Multiplex assay detection of immunogl obulin G antibodies ... · The current gold standa rd diagnostic assay for babesi osis, visual detection of Babesia 62 organisms in blood films,](https://reader033.fdocuments.in/reader033/viewer/2022042309/5ed661643b12fa6dbe19299f/html5/thumbnails/45.jpg)
rBmSA1/GST Intra Assay Repeats
30000
AM
FI
- B
G)
20000
25000
Rea
d 2
(M
5000
10000
15000
Read 1 (MFI - BG)
0 5000 10000 15000 20000 25000 300000
5000
rBmSA1/GST Assay Repeats
10000
B
2 (M
FI
- B
G)
1000
10000
Ass
ay R
un
100
Assay Run 1 (MFI - BG)
10 100 1000 10000
10
on June 2, 2020 by guesthttp://cvi.asm
.org/D
ownloaded from