Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview
description
Transcript of Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview
![Page 1: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/1.jpg)
Molecular Simulations: Applications in Biology
Structure of Biomolecules: An Overview
Dr. R. SankararamakrishnanDepartment of Biological Sciences & Bioengineering
Indian Institute of Technology, Kanpur
Understanding Molecular Simulations: Theory and Applications UMS201011th November 2010
![Page 2: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/2.jpg)
Outline of this talk
What are Biomolecules?Significance of knowing the structure of a biomolecule?
Why simulate a biomolecule?
What is the current status?
Biomolecular simulation: An
example
![Page 3: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/3.jpg)
Biopolymers Building Blocks
Proteins Amino acidsNucleic acids NucleotidesCarbohydrates SugarsLipids Fatty acids
![Page 4: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/4.jpg)
Trypsin, Chmytrypsin – enzymes
Hemoglobin, Myoglobin – transports oxygenTransferrin – transports ironFerritin – stores iron
Myosin, Actin – muscle contraction
Collagen – strength of skin and bone
Rhodopsin – light-sensitive proteinAcetylcholine receptor – responsible for transmitting nerve impluses
Antibodies – recognize foreign substances
Repressor and growth factor proetins
Proteins play crucial roles in all biological processes
![Page 5: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/5.jpg)
Proteins are made up of 20 amino acids
NH2
H C COOH
R
R varies in size, shape, charge, hydrogen-bonding capacity and chemical reactivity.Only L-amino acids are constituents of proteins
![Page 6: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/6.jpg)
Nonpolar and hydrophobic
AcidicBasic
![Page 7: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/7.jpg)
20 amino acids are linked into proteins by peptide bond
![Page 8: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/8.jpg)
Peptide bond has partial double-bonded character and its rotation is restricted.
![Page 9: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/9.jpg)
Polypeptide backbone is a repetition of basic unit common to all amino acids
![Page 10: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/10.jpg)
Frequently encountered terms Frequently encountered terms in protein structurein protein structure
•Backbone
•Side chain
•Residue
![Page 11: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/11.jpg)
![Page 12: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/12.jpg)
A Ala alanineC Cys cysteineD Asp aspartic acidE Glu glutamic acidF Phe phenylalanineG Gly glycineH His histidineI Ile isoleucineK Lys lysineL Leu leucineM Met methionineN Asn asparagineP Pro prolineQ Gln glutamineR Arg arginineS Ser serineT Thr threonineV Val valineW Trp tryptophanY Tyr tyrosine
One letter and three-letter codes for amino acids
![Page 13: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/13.jpg)
Proteins can exist in two types of environments
Globular proteins
Membrane proteins – Dr. Satyavani
![Page 14: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/14.jpg)
Each protein has a characteristic three-dimensional structure which is important for
its function
![Page 15: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/15.jpg)
Protein Structure: Four Basic Levels
Primary Structure
Secondary Structure
Tertiary Structure
Quaternary Structure
![Page 16: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/16.jpg)
![Page 17: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/17.jpg)
Protein – Primary Structure•Linear amino acid sequence•Determines all its chemical and biological properties•Specifies higher levels of protein structure (secondary, tertiary and quaternary)
Most proteins contain between ~200 to ~500 residues
![Page 18: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/18.jpg)
SETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK
Histone (human)
MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVLGGFTSTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLAGWSRYIPEGLQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSAAIYNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTETSQVAPA
Rhodopsin (human)
![Page 19: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/19.jpg)
ThrombinHeavy chain:IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHVCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFY THVFRLKKWIQKVIDQFGE
Light Chain: TFGSGEADCGLRPLFEKKSLEDKTERELLESYIDGR
![Page 20: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/20.jpg)
Thrombin Structure
![Page 21: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/21.jpg)
Thrombin Structure
![Page 22: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/22.jpg)
Primary to Secondary structureImportance of Dihedral Angle
![Page 23: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/23.jpg)
Dihedral angles , and
![Page 24: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/24.jpg)
= 180; = 180 = 0; = 0
![Page 25: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/25.jpg)
![Page 26: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/26.jpg)
Limiting distances for various interatomic contacts
Types of contact Normal Limit Extreme LimitH…H 2.0 1.9H…O 2.4 2.2H…N 2.4 2.2H…C 2.4 2.2O…O 2.7 2.6O…N 2.7 2.6O…C 2.8 2.7N…N 2.7 2.6N…C 2.9 2.8C…C 3.0 2.9C…C(H) 3.2 3.0C(H)…C(H) 3.2 3.0
Ramachandran & Sasisekharan (1968) Adv. Protein Chem.
![Page 27: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/27.jpg)
![Page 28: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/28.jpg)
Ramachandran PlotData from 500 high-resolution proteins
![Page 29: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/29.jpg)
Secondary Structure-helix
![Page 30: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/30.jpg)
-helix
3.6 residues per turnTranslation per residue 1.5 ÅTranslation 5.4 Å per turnC=O (i) … H-N (i+4) = -57°; = -47° (classical value) = -62°; = -41° (crystal structures)Preference of residues in helixCan proline occur in a helix? Average helix length ~ 10 residues
![Page 31: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/31.jpg)
Antiparallel -sheet
![Page 32: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/32.jpg)
Parallel -sheet
![Page 33: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/33.jpg)
-strand
Polypeptide fully extended2.0 residues per turnTranslation 3.4Å per residueStable when incorporated into a -sheetH-bonds between peptide groups of adjacent strandsAdjacent strands can be parallel or antiparallel
![Page 34: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/34.jpg)
Turns
Secondary structures are connected by loop regionsLengths vary; shapes irregularLoop regions are at the surface of the moleculeRich in charged and polar hydrophilic residuesRole: connecting units; binding sites; enzyme active sitesLoops are often flexible; adopt different conformations
-turns: Type I, Type II etc.-turns; classical, inverse
G.D. Rose et al., Adv. Protein Chemistry 37 (1989) 1-109
![Page 35: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/35.jpg)
Structure Determination: Experimental Methods
http://www.uni-duesseldorf.de/home/Fakultaeten/math_nat/Graduiertenkollegs/biostruct/Research/BioStruct_Groups/AG_Groth/expertise.html
X-ray crystallography
NMR
http://www.dbs.nus.edu.sg/staff/henry.htm
![Page 36: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/36.jpg)
![Page 37: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/37.jpg)
Growth of Protein Data Bank
http://www.pdb.org26,880 structures (24/8/2003)32,355 structures (25/8/2005)38,198 structures (15/8/2006)45,055 structures (7/8/2007)52,402 structures (12/8/2008)59,330 structures (7/8/2009)67,131 structures (10/08/2010)
![Page 38: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/38.jpg)
Motifs
![Page 39: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/39.jpg)
Main Classes of Protein Structures
domains
domains
/ domains
+ domains
Disulfide bonds/metal atoms
-helices
Antiparallel -sheets
Combinations of -- motifs
Discrete and motifs
![Page 40: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/40.jpg)
Coiled-coil
Four-helix bundle
Large alpha-helical domain
Globin fold
Alpha-domain
![Page 41: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/41.jpg)
TIM-barrel
Rossman fold
Horseshoe foldα/β structures
![Page 42: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/42.jpg)
Up-and-down beta-barrel
Greek-keyBeta-helix
β-domain
![Page 43: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/43.jpg)
Is knowledge of 3-D structure enough to understand the function?
What we don’t know?
![Page 44: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/44.jpg)
Example 1: Myoglobin
Breathing motions in myoglobin opens up pathways for oxygen atoms to enter its binding site or diffuse out
![Page 45: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/45.jpg)
Example 2: Rhodopsin
GPCRs like rhodopsin undergo conformational changes during signal transduction
![Page 46: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/46.jpg)
Example 3: Calmodulin
Largest ligand-induced interdomain motion known in proteins
![Page 47: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/47.jpg)
Example 4: Hemagglutinin
Hemagglutinin from influenza virus undergoes large conformational changesAt low PH, the N-terminal helix moves 100 Å to bring the fusion peptide closer to the host cell membrane
Branden & Tooze
![Page 48: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/48.jpg)
Experimentally determined structures are staticThey represent the average structure of an ensemble of structuresThey do not provide the dynamic picture of a biomoleculeMolecular dynamics is one way to understand the conformational flexibility of a biomolecule and its functional relevance
Why Molecular Dynamics?
![Page 49: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/49.jpg)
•Local Motions (0.01 to 5 Å, 10-15 to 10-1 s) •Atomic fluctuations •Sidechain Motions •Loop Motions
•Rigid Body Motions (1 to 10Å, 10-9 to 1s) •Helix Motions •Domain Motions (hinge bending) •Subunit motions
•Large-Scale Motions (> 5Å, 10-7 to 104 s) •Helix coil transitions •Dissociation/Association •Folding and Unfolding
Biological molecules exhibit a wide range of time scales over which specific processes
http://cmm.info.nih.gov/modeling/guide_documents/molecular_dynamics_document.html
![Page 50: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/50.jpg)
Potential Energy Function (Equations)
• Potential Energy is given by the sum of these contributions:
)](cos1[)(
)()(
02
0
20
20
nAk
kllkRV
torsionsn
impropers
anglesbondslbonded
ijr
ji
ij
ij
ij
ij
jinonbonded r
r
r
r
rijRV
0
6min
12min
4])(2)[(()(
![Page 51: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/51.jpg)
Calculate Energy ‘E’ using the potential Energy function
Calculate Force by differentiating the potential Energy
Calculate Acceleration ‘a’ using Newton’s second Law
Calculate Velocity at a later time ‘t+dt’
Calculate Position at a later time ‘t+dt’
Calculate Energy at new position.
Create a Trajectory by repeating the above steps ‘n’ number of times.
Molecular Dynamics
http://cmm.info.nih.gov/modeling/guide_documents/molecular_dynamics_document.html
![Page 52: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/52.jpg)
Some Popular Simulation Force Fields
AMBER (Assisted Model Building with Energy Refinement)
CHARMm (Chemistry at HARvard Macromolecular Mechanics)
CVFF (Consistent-Valence Force Field)
GROMOS (GROningen MOlecular Simulation package)
OPLS (Optimized Potentials for Liquid Simulations)
![Page 53: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/53.jpg)
First Biomolecular simulation was performed in 1977
![Page 54: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/54.jpg)
Complete virus: 1 million atoms(Freddolino et al., 2006)
Arrays of light-harvesting proteins – 1 million atoms (Chandler et al., 2008)
Simulations reaching the million-atom mark
BAR domain proteins – 2.3 million atoms (Yin et al., 2009)
The flagellum – 2.4 million atoms (Kitao et al., 2006)
![Page 55: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/55.jpg)
Gumbart et al. (2009)
2.7 million atoms50 ns simulation
MD of protein-conducting channel bound to ribosome
Largest system simulated to date
Bacterial ribosomes are important targets for antibiotics
![Page 56: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/56.jpg)
Biomolecular structures should be simulated under native environment
Simulation conditions should be similar to that observed under physiological conditions
![Page 57: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/57.jpg)
Bcl-XL-Bak
340 nm
Bcl-XL-Bad
0.6 nm
Bcl-XL-Bim
9.2 nm
Bcl-XL protein has different affinities for different BH3 pro-apoptotic peptides
What are the factors that contribute to the different affinities of Bcl-XL?
![Page 58: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/58.jpg)
RMSD Analysis
Lama and Sankararamakrishnan, Proteins (2008)
![Page 59: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/59.jpg)
Distance between helix H3 and the BH3 peptide
Bak peptide moves away from helix H3 Lama and Sankararamakrishnan, Proteins
(2008)
![Page 60: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/60.jpg)
Protein-peptide interactions
Lama and Sankararamakrishnan, Proteins (2008)
![Page 61: Molecular Simulations: Applications in Biology Structure of Biomolecules: An Overview](https://reader035.fdocuments.in/reader035/viewer/2022062323/56815cb0550346895dcaae89/html5/thumbnails/61.jpg)
Anjali BansalDilraj LamaAlok JainTuhin Kumar PalPriyanka SrivastavaVivek ModiRavi Kumar VermaKrishna DeepakPhani Deep
DST, DBT, CSIR, MHRD
Acknowledgements