Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia?...

33
Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules, and biomolecules Central Dogma How DNA mutations result in abnormal proteins Protein structure classifications How to perform comparisons of protein sequences Workshops- Import cytochrome C sequences of different species. Perform Clustal W comparison Find out the molecular basis of sickle cell anemia

TAGS:

Transcript of Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia?...

Page 1: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,

Molecular Life Science Review

June 15, 2003 Learning objectives-

What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules, and biomolecules Central Dogma How DNA mutations result in abnormal proteins Protein structure classifications How to perform comparisons of protein sequences

Workshops- Import cytochrome C sequences of different species. Perform Clustal W comparison Find out the molecular basis of sickle cell anemia

Page 2: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,

Symptoms of Sickle Cell Anemia

pain episodes strokes increased

infections leg ulcers bone damage yellow eyes or

jaundice early gallstones lung blockage

kidney damage and loss of body water in urine

painful erections in men (priapism)

blood blockage in the spleen or liver (sequestration)

eye damage low red blood cell

counts (anemia) delayed growth

Page 3: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,
Page 4: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,
Page 5: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,

Hierarchy of particles

Atoms (Eg. C, H, O, N)

Molecules (Eg. H2O, CH4)

small Biomolecules (Eg. Sugars, amino acids)

large Biomolecules (Eg. polysacharrides, proteins)

Page 6: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,
Page 7: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,

Example of ionic bond

Page 8: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,

H + H H2

O + O O2

2H2O 2H2 + O2

Chemical Reactions

Page 9: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,

Covalent Bonds(electrons shared)

Page 10: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,
Page 11: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,
Page 12: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,
Page 13: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,

pH scale. A convenient methodto measure the concentrationof H+

pH = -log[H+]

Remember pH + pOH = 14M = 1 mole/liter

Page 14: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,
Page 15: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,
Page 16: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,
Page 17: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,
Page 18: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,
Page 19: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,

Amino acid characteristics

Page 20: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,

Website for Amino acid interactive Workshop Amino acids

1 2

Page 21: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,
Page 22: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,
Page 23: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,
Page 24: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,

DNA sequenceWrite the primary sequence of the DNA displayed in 3Bhttp://www.blc.arizona.edu/Molecular_Graphics/DNA_Structure/DNA_Tutorial.HTML

http://www.rothamsted.bbsrc.ac.uk/notebook/courses/guide/dnast.htm

Website for interactive workshop for DNA analysis

Page 25: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,

Interactive display of amino acid and codons

Page 26: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,

Translation exercise

Translate the following sequence using the codontable:

ATGGUGCACCUGACUCCUGAGGAGAAG

Perform same procedure using a software program:

http://us.expasy.org/tools/dna.html

Page 27: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,

Central Dogma

DNA

RNA

Protein

Page 28: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,

DNA

RNA (with ribosomes)

Page 29: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,

*

Page 30: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,
Page 31: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,

>gi|1244762|gb|AAA98563.1| p53 tumor suppressor homolog

MSQGTSPNSQETFNLLWDSLEQVTANEYTQIHERGVGYEYHEAEPDQTSLEISAYRIAQPDPYGRSESYD

LLNPIINQIPAPMPIADTQNNPLVNHCPYEDMPVSSTPYSPHDHVQSPQPSVPSNIKYPGEYVFEMSFAQ

PSKETKSTTWTYSEKLDKLYVRMATTCPVRFKTARPPPSGCQIRAMPIYMKPEHVQEVVKRCPNHATAKE

HNEKHPAPLHIVRCEHKLAKYHEDKYSGRQSVLIPHEMPQAGSEWVVNLYQFMCLGSCVGGPNRRPIQLV

FTLEKDNQVLGRRAVEVRICACPGRDRKADEKASLVSKPPSPKKNGFPQRSLVLTNDITKITPKKRKIDD

ECFTLKVRGRENYEILCKLRDIMELAARIPEAERLLYKQERQAPIGRLTSLPSSSSNGSQDGSRSSTAFS

TSDSSQVNSSQNNTQMVNGQVPHEEETPVTKCEPTENTIAQWLTKLGLQAYIDNFQQKGLHNMFQLDEFT

LEDLQSMRIGTGHRNKIWKSLLDYRRLLSSGTESQALQHAASNASTLSVGSQNSYCPGFYEVTRYTYKHT

ISYL

FASTA format

Page 32: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,

Multiple sequence alignment Human-locus number AAA35732 Dog-locus number CCDG Yeast-locus number from structure

or protein sequence database 1YCC

CLUSTAL PROGRAM

Page 33: Molecular Life Science Review June 15, 2003 Learning objectives- What is sickle cell anemia? Increased knowledge of the structure of atoms, molecules,

Workshop Find out the chromosomal location of the gene

that causes sickle cell anemia. Give the name of the gene. Find out the nucleotide change and amino acid

change that leads to sickle cell anemia (there may be more than one change that gives rise to the disease)

If sickle cell anemia is so devastating, why has it lasted in the population for such a long time? Give a molecular explanation (you may have to do a little research to get this)

Print out answers and show instructor.


Sickle-cell anemia

Sickle-cell anemia

Sickle Cell Disease SICKLE CELL DISEASE UPDATES Sickle... · Complications of Sickle Cell Disease Anemia associated with Anemia associated with hemolysishemolysis, , splenicsplenic

Sickle Cell Disease SICKLE CELL DISEASE UPDATES Sickle... · Complications of Sickle Cell Disease Anemia associated with Anemia associated with hemolysishemolysis, , splenicsplenic

Sickle cell Disorders1 Sickle Cell Anemia. Sickle cell Disorders2 Sickle Cell Anemia HbS: a 2 ß 2 6Glu Val Sickle cell disorders: sickling with o 2 Sickle.

Sickle cell Disorders1 Sickle Cell Anemia. Sickle cell Disorders2 Sickle Cell Anemia HbS: a 2 ß 2 6Glu Val Sickle cell disorders: sickling with o 2 Sickle.

Sickle Cell Anemia - Medical Diagnostic Laboratories LLCmdlab.com/forms/TechBulletin/Sickle_Cell_Anemia.pdfSickle Cell Anemia Upd: 10/2016 Sickle Cell Disease Sickle Cell Anemia is

Sickle Cell Anemia - Medical Diagnostic Laboratories LLCmdlab.com/forms/TechBulletin/Sickle_Cell_Anemia.pdfSickle Cell Anemia Upd: 10/2016 Sickle Cell Disease Sickle Cell Anemia is

SICKLE CELL ANEMIA - Sickle Cell Ministries

SICKLE CELL ANEMIA - Sickle Cell Ministries

Sickle Cell Anemia - SHSU

Sickle Cell Anemia - SHSU

6..sickle cell anemia

6..sickle cell anemia

Sickle Cell Anemia

Sickle Cell Anemia