Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&&...
Transcript of Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&&...
![Page 1: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/1.jpg)
Introduc)on to genome annota)on -‐ prac)cal informa)on
Some possibili)es and some pi7alls
![Page 2: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/2.jpg)
Prac)cal info
• Coffee breaks • Lunch • Dinner at Lingon 18.00 Svartbäcksg. 30
![Page 3: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/3.jpg)
Understanding annota)on
Some possibili)es and some pi7alls
Henrik Lantz, BILS/SciLifeLab
![Page 4: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/4.jpg)
Lecture synopsis
• What is annota)on? • Structural genome annota)on • Types of data used • Transcriptome annota)on • Func)onal annota)on
![Page 5: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/5.jpg)
What is annota)on?
• Iden)fica)on of regions of interest in sequence data
![Page 6: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/6.jpg)
From a genome…
![Page 7: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/7.jpg)
…to an annotated gene
![Page 8: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/8.jpg)
GFF file format
![Page 9: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/9.jpg)
GFF3 file format
Seqid source type start end score strand phase a2ributes
Chr1 Snap gene 234 3657 . + . ID=gene1; Name=Snap1;
Chr1 Snap mRNA 234 3657 . + . ID=gene1.m1; Parent=gene1;
Chr1 Snap exon 234 1543 . + . ID=gene1.m1.exon1; Parent=gene1.m1;
Chr1 Snap CDS 577 1543 . + 0 ID=gene1.m1.CDS; Parent=gene1.m1;
Chr1 Snap exon 1822 2674 . + . ID=gene1.m1.exon2; Parent=gene1.m1;
Chr1 Snap CDS 1822 2674 . + 2 ID=gene1.m1.CDS; Parent=gene1.m1;
start_codon
Alias, note, ontology_term …
stop_codon
![Page 10: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/10.jpg)
GTF file format
![Page 11: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/11.jpg)
GTF file format
Seqid source type start end score strand phase a2ributes
Chr1 Snap exon 234 1543 . + . gene_id “gene1”; transcript_id “transcript1”;
Chr1 Snap CDS 577 1543 . + 0 gene_id “gene1”; transcript_id “transcript1”;
Chr1 Snap exon 1822 2674 . + . gene_id “gene1”; transcript_id “transcript1”;
Chr1 Snap CDS 1822 2674 . + 2 gene_id “gene1”; transcript_id “transcript1”;
start_codon
stop_codon
![Page 12: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/12.jpg)
Why is annota)on important?
Genome
Mapped reads -‐ condi)on 1
Mapped reads -‐ condi)on 2
Example: Differen)al expression
![Page 13: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/13.jpg)
Why is annota)on important?
Genome
RNA-‐seq reads
![Page 14: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/14.jpg)
There are two major parts of annota)on
• 1) Structural: Find out where the regions of interest (usually genes) are in the genome and what they look like. How many exons/introns? UTRs? Isoforms?
• 2) Func)onal: Find out what the regions do. What do they code for?
![Page 15: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/15.jpg)
Open reading frames
![Page 16: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/16.jpg)
Difficult in prac)ce
![Page 17: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/17.jpg)
Combine data -‐ use Maker!
• External data -‐ proteins, rna-‐seq (incl. ESTs)
• Ab-‐ini)o gene finders • (Lin-‐overs from closely related genomes)
Combined annota)on
![Page 18: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/18.jpg)
Transcriptomes are different but have their own challenges
• No introns, but where are the start and stop codons?
• S)ll needs func)onal annota)on
![Page 19: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/19.jpg)
Data used -‐ Proteins
![Page 20: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/20.jpg)
Data used -‐ Proteins
• Conserved in sequence => conserved annota)on with liple noise
• Proteins from model organisms onen used => bias?
• Proteins can be incomplete => problems as many annota)on procedures are heavily dependent on protein alignments >ENSTGUP00000017616 pep:novel chromosome:taeGut3.2.4:8_random:2849599:2959678:-‐1 gene:ENSTGUG00000017338 transcript:ENSTGUT00000018018 gene_biotype:protein_coding transcript_biotype:protein_coding RSPNATEYNWHHLRYPKIPERLNPPAAAGPALSTAEGWMLPWGNGQHPLLARAPGKGRER DGKELIKKPKTFKFTFLKKKKKKKKKTFK >ENSTGUP00000017615 pep:novel chromosome:taeGut3.2.4:23_random:205321:209117:1 gene:ENSTGUG00000017337 transcript:ENSTGUT00000018017 gene_biotype:protein_coding transcript_biotype:protein_coding PDLRELVLMFEHLHRVRNGGFRNSEVKKWPDRSPPPYHSFTPAQKSFSLAGCSGESTKMG IKERMRLSSSQRQGSRGRQQHLGPPLHRSPSPEDVAEATSPTKVQKSWSFNDRTRFRASL RLKPRIPAEGDCPPEDSGEERSSPCDLTFEDIMPAVKTLIRAVRILKFLVAKRKFKETLR PYDVKDVIEQYSAGHLDMLGRIKSLQTRVEQIVGRDRALPADKKVREKGEKPALEAELVD ELSMMGRVVKVERQVQSIEHKLDLLLGLYSRCLRKGSANSLVLAAVRVPPGEPDVTSDYQ SPVEHEDISTSAQSLSISRLASTNMD
![Page 21: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/21.jpg)
Data used -‐ Proteins
• Maker will align proteins for you: Blast -‐> Exonerate
• Blast is not structure aware, Exonerate is (splice sites, start/stop codons)
• Preferred file-‐format: fasta
![Page 22: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/22.jpg)
RNA-‐seq
DNA Intron Intron Intron Exon Exon Exon Exon
UTR UTR
ATG Start codon
TAG, TAA, TGA Stop codon
Pre-‐mRNA
UTR UTR
ATG Start codon
TAG, TAA, TGA Stop codon
Transcrip)on
Splicing
UTR UTR
TAG, TAA, TGA Stop codon
ATG Start codon
mRNA
Transla)on
GT GT GT
AA AAAAA
AAAAAAAAA
AG AG AG
![Page 23: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/23.jpg)
Data used -‐ RNA-‐seq
• Should always be included in an annota)on project
• From the same organism as the genomic data => unbiased
• Can be very noisy ()ssue/species dependent), can include pre-‐mRNA
• PASA, or some other filtering method, onen needed
![Page 24: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/24.jpg)
Spliced reads
DNA Intron Intron Intron Exon Exon Exon Exon
UTR UTR
ATG Start codon
TAG, TAA, TGA Stop codon
Pre-‐mRNA
UTR UTR
ATG Start codon
TAG, TAA, TGA Stop codon
Transcrip)on
Splicing
UTR UTR
TAG, TAA, TGA Stop codon
ATG Start codon
mRNA
Transla)on
GT GT GT
AA AAAAA
AAAAAAAAA
AG AG AG
![Page 25: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/25.jpg)
RNA-‐seq -‐ Spliced reads
![Page 26: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/26.jpg)
Pre-‐mRNA
![Page 27: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/27.jpg)
Pre-‐mRNA
DNA Intron Intron Intron Exon Exon Exon Exon
UTR UTR
ATG Start codon
TAG, TAA, TGA Stop codon
Pre-‐mRNA
UTR UTR
ATG Start codon
TAG, TAA, TGA Stop codon
Transcrip)on
Splicing
UTR UTR
TAG, TAA, TGA Stop codon
ATG Start codon
mRNA
Transla)on
GT GT GT
![Page 28: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/28.jpg)
Pre-‐mRNA
![Page 29: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/29.jpg)
Includes everything that is transcribed
![Page 30: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/30.jpg)
Stranded rna-‐seq
![Page 31: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/31.jpg)
Three-‐prime bias in polyA-‐selected rna-‐seq
![Page 32: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/32.jpg)
How to use RNA-‐seq
• Maker will align transcripts (ESTs), but these need to be assembled first.
• Cufflinks: mapped reads -‐> transcripts
![Page 33: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/33.jpg)
How to use RNA-‐seq
• Maker will align transcripts (ESTs), but these need to be assembled first.
• Cufflinks: mapped reads -‐> transcripts • Trinity: assembles transcripts without a
genome
![Page 34: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/34.jpg)
Mapped Trinity-‐assembled transcripts
![Page 35: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/35.jpg)
How to use RNA-‐seq
• Maker will align transcripts (ESTs), but these need to be assembled first.
• Cufflinks: mapped reads -‐> transcripts • Trinity: assembles transcripts without a
genome • PASA can be used to improve transcript
quality
![Page 36: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/36.jpg)
Ab ini)o gene finders are used in Maker
• Commonly used programs: Augustus, Snap, Genemark-‐ES, FGENESH, Genscan, Glimmer-‐HMM,…
• Uses HMM-‐models to figure out how introns, exons, UTRs etc. are structured
• These HMM-‐models need to be trained!
![Page 37: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/37.jpg)
Linovers are very useful for orthology determina)on
• Kraken • Align the two genomes (Satsuma) and then transfer annota)ons between aligned regions
![Page 38: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/38.jpg)
General recommenda)ons
• Always combine different types of evidence! • One single method is not enough! • Use Maker!
![Page 39: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/39.jpg)
Transcript annota)on
• Here the transcript is already defined. The challenge is to find where the coding regions starts and stops
• Transdecoder
![Page 40: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/40.jpg)
Transdecoder
![Page 41: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/41.jpg)
Transdecoder
![Page 42: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/42.jpg)
Or get help -‐ BILS assembly and annota)on team
• Five people working with assembly and annota)on
• Deliver high quality annota)ons • Enable visualiza)on and manual cura)on through a web interface
• Also available for consulta)on • [email protected]
![Page 43: Introduc)on*to*genome*annotaon*/*prac)cal* informaon* · GTF*file*format* Seqid&& source&& type&& start end&& score&& strand phase&& aributes Chr1 Snap* exon* 234 1543 . + . gene_id“gene1”;*](https://reader034.fdocuments.in/reader034/viewer/2022042310/5ed80df5cba89e334c67291a/html5/thumbnails/43.jpg)
Biosupport.se