Impression Evidence.pdf

7/29/2019 Impression Evidence.pdf

1/20

26PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266

Impessin

Evience

Often thought of as a form of evidence nearly as valuable as fingerprints,impression evidence must receive priority handling. Impression evidencemay exist in the following forms:

Ftprintsinsilrnflrs,cks,tc...

Tirtracksinsil,annrivwaysrraways

Tlmarksattpintfntryrwitintcrimscn. Bitmarksntvictim.

Latent or very difficult to see impressions may also be present, includingdust prints or foot impressions left on dry floors.

A visual search for impression evidence should be made prior to anyattmptstlcatancllcttrfrmsfpysicalvinc.Tiswillhelp to prevent footprint or tire impressions from being damaged duringsubsequent searches. When impression evidence is found, secure thearea using crime scene barrier tape or other means. It may be necessaryto erect a tent or similar shelter to protect fragile impression evidenceoutdoors in bad weather.

Tabilitytmatcsmls,tirtyps,anttpattrnsisigly

valued by investigators. Impressions yield individual characteristics, suchaswarpattrns,ctmarksantraltratinstatnancmatc-ingabilitisanarinvalablwnmakingpsitivintificatinsinaninvestigation.

Lcting n Ptecting

Impessin Evience

Vis methds f

cllecting impessin

evidence hve evlve

nw ppely

peseved impessinevidence cn pvide

psitive mtch t th

shoeswn by the

pepett, the tires

n the vehicle diven

the pepett nd th

tools sed t bek

int the pemises.

Sho print fond in md. Cast mad from sho print. Sspct sho matchs cast.


2/20

Impessin

Evience

266 SIRCHIE Tradition. Expertise. Excellence. Web: www.sirchie.co

Liqi Silicne Csting

catalog no. description price

SRK800 N. 2 Silicne Casting Kit $148.25

no. 1 silicone casting Kit

Tiscnmical,spac-savingkitcntainsalltncssarymatrialsnfor casting small crime scene impressions such as single footprints, toolmarks,anbitmarks.Tliqisilicnisalstprfctmimfrliftingpowder-developed latent fingerprints from rough or textured surfaces. Easy toprepare and apply.


SRK700 N. 1 Silicne Casting Kit $65.50

no. 2 silicone casting Kit

Tiskitcntainsallftncssarymatrialsfrlargrimprssincastingapplicatins.Tkitcntains2-npnjarsfLiqiSilicnRbbrwit

Catalyst,aswllas16z.fSilicnRbbrTinnr.ApmpspraycntainrfSilicnRlasAgntisspplifrswncastingnifficltsurfaces such as deep impressions in wood or metal. Ideal for use on mostcrimscnimprssins.Allfttlsnarcntainintkit.

RK700 CONTENTS:

- 634C Liquid Silicne Rubber, 1 lb. (454g)

- TM1 Vial f Catalyst

- SRA10A Silicne Rubber Release AgentPump Spray, 4 z. (120ml)

- KCP199 Steel Spn

- KCP198 Plastic Mixing Cntainer, 1 qt.(946ml)

- KCP155 Spatula, 7 (17.8cm), Steel Blade

RK800 CONTENTS:

- 634C Liquid Silicne Rubber, 1 lb. (454g)

- 636C Silicne Rubber Thinner, 16 z.

(473ml)- TM1 Vials f Catalyst

- SRA10A Silicne Rubber Release AgentPump Spray, 4 z. (120ml)

- KCP199 Steel Spn

- KCP198 Plastic Mixing Cntainer, 1 qt.(946ml)

- KCP201 Plastic Mixing Cntainer, 1 pt.(473ml)

- KCP155 Spatula, 7 (17.8cm), Steel Blade

- SRK8001 Mlded Cplymer Carrying Case;Dimensins: 12.125 x 7.25 x 4.5(30.8cm x 18.4cm x 11.4cm);Weight: 4.92 lbs. (2.2kg)


3/20

26PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266

Impessin

EvienceLiqi Silicne Csting

liQUid silicone rUBBer

Tisistmstcnmicalmimfrprcingxactrprctinsfvirtallyanysrfacinclingftprints,tirprints,tlanjimmymarks,prints in dust, fingerprints, crash debris, firearms and the identification ofdisaster victims. It features a long shelf life and is unaffected by temperaturesfrm-70Ft+500F.Liqisilicnrbbrisqick-sttingintrtfivmints,ytitflwsasilyintairlincracksancanalsbtinntflwmrfrly.Availablina1lb.(454g)jarwitcatalyst.

silicone rUBBer tHinner

Use silicone rubber thinner with No. 634C liquid silicone rubber compound.Tisprcttinstcmpn,allwingittflwmrfrlyancvrawirara.Itissppliina16fl.z.(473ml)bttl.

silicone rUBBer release agent

Tiscnvnintlypackagprctisstaiintsparatinfcrsilicnfrmimprssinaras.Italswrkswllwitplastranntalstone casting materials. Apply a thin, even coating over the surface to be

prsrv.Availablin4.5z.arslr4z.pmpspray.


634C Liquid Silicne Rubber, 1 lb. (454g) w/TM1 Catalyst $45.95

SRA10 Silicne Rubber Release Agent, 4.5 z. (128g) aersl $9.95

SRA10A Silicne Rubber Release Agent, 4 z. (12ml) pump spray $9.95

636C Silicne Rubber Thinner, 16 z. (473ml) $26.75

liQUid silicone casting Kit

Tisisacmpltfilkitwitalltmatrialsfrmakingaccratrprctinswitliqisilicn.Spplimatrialsfacilitatcastingftirand footprints in snow, mud and sand, as well as other casting requirements.


640C Liquid Silicne Casting Kit $375.50

No. 636C

No. SRA10

No. 634C

No. SRA10A

640C CONTENTS:

2- 634C Liquid Silicne Rubber, 1 lb. (45

1- 636C Silicne Rubber Thinner, 16 z.(473ml)

2- TM1 Vials f Catalyst

1- SRA10 Aersl Silicne Rubber Relea

Agent, 4.5 z. (133ml)1- KCP142 Steel Spn

1- KCP155 Spatula, 7 (17.8cm), Steel B

1- 642C Flexible Mixing Bwl, 4.25 (10



1- SP1000 Snw Impressin Wax,Net Wt. 15 z. (425g)

1- 638CA Aersl Dust & Dirt Hardener,Net Wt. 15 z. (425g)

1- SK900 Tape Measure, English/metric,ft. (30m)

25- 608E01 Evidence Tags w/Ties

1- KCP200 Surface Brush

1- FCF100 Adjustable Casting Frame,7.25 x 12-18 (18.4cm x 30.5cm-45.7cm)

1- Technical Instructins

1- 640CC Black Mlded Cplymer Carring Case w/Flding Handle and LckinLatches; Dimensins: 17 x 13 x 7.3(43.2cm x 33cm x 18.7cm);Weight: 16.5 lbs. (7.5kg)


4/20

Impessin

Evience


STEP 1: Apply Dst and Dirt Hardnr (No.638CA)*.

STEP 2: Por watr into zip-topbag, sal.

STEP 3: Knad bag for 1-2 mints.

STEP 4: Por into imprssion*.(* Optional accssoris shown.)

Plste Csting

ZMP100 CONTENTS:

1- ZMP101 Bttle f Pre-Treated Water,24 z. (709.56ml)

1- ZMP102 Package f Plaster, 3 lbs.(1.36kg)

1- ZTE031 ZIP-MIX Mixing Bag, 13 x 18(33cm x 45.7cm)

FoUr steps to

zip-mix plaster

casting:

adJUstaBle casting

Frames

Tsall-alminm,ajstablcastingframsrestrict the flow of castingcompounds. Each sizeexpands a full six inches inlength. Manufactured out of0.060 x 1 3/4 aluminum.

casting plaster

Tisspcialfrmlaplastrisfrtiranftprint

vinc.Txtrmicrtarrslwsst-pwilmixinganrcssrinkagwilcring.Cmsina8lb.(3.6kg)cntainr.


639C1 Casting Plaster, 9 lb. (4.08kg) $16.95


ZMP100 ZIP-MIX Plaster Casting $19.95


FCF100 Adjustable Casting Frame, 7 1/4 x 12 t 18 $16.50

FCF200 Adjustable Casting Frame, 12 x 18 t 24 $24.50

zip-mix plaster casting

Eliminate the mess and difficultyfmixingplastrsZIP-MIXPlastrCasting.Castingplastrmstbe mixed uniformly and all lumpsliminat.ZIP-MIXplastrnsrsa uniform, smooth mixture everytim.Simplycmbinwatranplastrintzip-tpbaganknawith both hands until no lumps areflt.TZIP-MIXstinclsapre-measured amount of plaster andwatrngtcastafll-sizadult footprint. Everything needed isinncnvnintpackag.


5/20

26PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266

Impessin

EviencePlste Csting


641C Flexible Mixing Bwl, 3 1/2 (8.9cm) diameter $11.95




646C Flexible Mixing Bwls, 4 piece set $68.95

FlexiBle mixing BoWls

Tsiglyflxibl,slf-claningmixingbwlsarialfrmixingliqisilicone rubber, plaster, and hARd-CoRe.Tbwlsfatrann-sticksurface that is resistant to chemicals and petroleum products.

tire and Footprint plaster casting Kit

Tiscmpltkitisialfrcastingxactrprctinsfftprintsantire prints in snow, mud, sand and dirt. It is excellent for field investigations.Comes complete with application procedures and instructions.


639C Tire and Ftprint Plaster Casting Kit $279.50

Cast mad sing casting plastrincldd in th No. 639C kit.

No. 644C No. 643C No. 642C No. 641C

639C CONTENTS:


1- 639C2 Water Cntainer, 24 z. (709.5


1- SRA10 Aersl Silicne Rubber ReleaAgent, 4.5 z. (133ml)

1- KCP142 Steel Spn





1- KCP114 Retractable Measuring Tape

1- KCP154 Pipette with Suctin Bulb


1- 639C15 Tire and Ftprint Casting Pla3 lbs. (1.36kg)

1- 639C5 Wire Mesh Reinfrcement, 2 (5.1cm x 10.2cm), 10 each

1- STM1003 Mdeling Clay, 1/4 lb. (1131- FCF100 Adjustable Casting Frame,

7.25 x 12-18 (18.4cm x 30.5cm-45.7cm)

24- 608E01 Evidence Tags, Pre-printed

1- Technical Infrmatin

1- 639CC Black Mlded Cplymer Carring Case w/Flding Handle and LckinLatches, Includes Mlded Inserts;Dimensins: 17 x 13 x 7.375(43.2cm x 33cm x 18.7cm);Weight: 18 lbs. (8.2kg)


6/20

Impessin

Evience



SNC42 Shake-N-Cast Impressin Kit $14.50

SNC428 Shake-N-Cast Impressin Kit, 8 each $108.00

shk-n-c impression casting Kit

Tisincriblysimpltskitliminatsalltmssangsswrkinrntwitmsttrcastingmts.Sak-N-Castcntains42z.(1191.7g)fprpritarygypsmcastingmatrialpackagwitanintrnalprmasrwatrcapsl.Tmixtrisalwaystcrrctcnsistncy!

dtitsxcptinalstrngt,Sak-N-Castisfastbcmingtprfrrcicfcrimscnspcialistsancrimlabratryprsnnl.Typicalcastsarnly0.5t0.75(13mmt19mm)tick.Nrinfrcmntisneeded.

eackitissfficintfrcastingafll-sizaltsprintin4asystps:

1) Applyprssrtbraktintrnalwatrcapsl.

2) Sakanknatpcfrabt2mints.3) Ctffacrnrftpc.

4) Prtmixtrinttimprssin.*

Its Tht Esy!

*Whn working in loos, dry soil or sand, w rcommnd sing or No. 638CA Dst and Dirt Hardnr to prpar thimprssion prior to casting.

STEP 1: Prpar imprssion with 638CADst and Dirt Hardnr*.

STEP 2: Brak intrnal watr capsl.

STEP 3: Shak, thn knad bag p to2 mints.

STEP 4: Por mixd casting matrialinto imprssion*.

(* Optional accssoris shown.)

FEaTuRES:

Acompleteimpressioncastingkit

Nomoremess,nomoremeasuring,nomre mixing bwls, n mreguess wrk

Simpletouse

Superiorresults

FoUr easy steps:

Tie n Ftpint Csting

Rsltant cast singNo. SNC100 Shak-N-Cast

Imprssion Kit


7/20

27PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266

Impessin

Evience


SNC100 Master Shake-N-Cast Impressin Kit $257.95

TLK700 Tactical Master Shake-N-Cast impressin Kit $249.95

master shk-n-c impression Kit

TisisSIRCHIEscmpltfilkitwitalltncssarymatrialsnfrmakingaccratimprssinstilizingrSak-N-Castmt.AlngwitfivpcsfSak-N-Cast,tiskitcntainstwcansfrdstandirtharnrfrprparingimprssinsinlsrsanysilantwcansfrSnwImprssinWaxfrcastinginsnwanic.Twcastingframsarinclfrcastingftprintsantirtracks.

FEaTuRES:

Nomoreguessingathowmuchwaterplaster t use

Makecastsinallkindsofconditionsmud, dirt, sand, even snw!

Nomessymixingbowlsorbuckets

Kitcontainsallmaterialsandtoolsfortbest pssible results

The ltimte in

cnvenience nd

tilitythe SNC100

nd TLK700 kits

cntin the mstften needed

mteils f tie n

ftwe csting.

CONTENTS:

5- SNC42 Shake-N-Cast Impressin KitNet Wt. 42 z. (1191.7g)

1- FCF100 Adjustable Casting Frame,7.25 x 12-18 (18.4cm x 30.5cm-45.

1- FCF200 Adjustable Casting Frame,12 x 18-24 (30.5cm x 45.7cm-61cm


2- SP1000 Snw Impressin Wax, Net Wz. (425g)

1- SRA10 Aersl Silicne Rubber ReleasAgent, 4.5 z. (133ml)

1- KCP142 Steel Spn

1- ESP30W Pht Scales, 10 pk.

1- 608E1 Evidence Tags w/ties, 100 pk.

1- Technical Instructins

1- SNC100CC Heavy Duty, Mlded CarryiCase; Dimensins: 17 x 13 x 7.375(43.2cm x 33cm x 18.7cm);Weight: 26.2 lbs. (11.9kg)

Tie n Ftpint Csting

No. TLK700 Tactical Mastr Shak-N-Cast Kit incldsall th sam contnts in a drabl tactical bag.

TaCTiCal CaSE dESCRiPTiON:

16.5X12.5X5.5insidemaincompart

Twofrontpocketsmeasuring7X10X2

Largebackpocketmeasuring16.5X10.5X2

Molle/Aliceinteriorpanel

Madefrom1000-deniertexturednylon

Luggagehandlepanel

Nametapeholder

LargehiddenpocketwithfullBackUpSystem

Lightcoloredinteriorforeasyaccesst

Expandablesidepockets

Moldedhandle


8/20

Impessin

Evience



638CA Aersl Dust and Dirt Hardener, 15 z. (425g) can $16.95

Tie n Ftpint Csting

Rsltant cast (abov)sing No. 638CA and

No. SNC42.

aerosol dUst and dirt Hardener

Tisfficintmtfrprparingftprintsantirtracksfninlsrsanysilisnwlypackaginaerosol form.

ordstandirtharnrfatrs

aqick-rying,claracrylicfrmlathat adds superior strength toimprssinslssningtcancof detail damage due to the weightof the casting material. Use it withplastr-f-paris,hARd-CoRe,rSak-N-Castmatrials.on15-nccanf638CAdstandirtharnrisngtmakpto 30 full-size adult shoe impressionapplications.

snoW impression Wax

Impression evidence found in snow or ice presents a

niqstfifficltisfrrcvry.dttfactthat most gypsum-based casting materials generateheat during the curing process, it is necessary toprvianinslatingmim.SpraySnwImprssinWax into the impression to prepare the surface for

casting.Tislckstimprssintailto avoid melting when the castingmedium is applied. It is supplied inan aerosol can.


SP1000 Snw Impressin Wax, 15 z. (425g) can $15.95

Ung snw impn Waxv a dua pup:

1. It pvides insltin fm the

cing het f the csting medim.

2.It hdens the impessin,peventing it fm being cshedby the weight f the cstingmedim.

Rslting imprssion castsing Snow ImprssionWax.

STEP 1: Rmov loos dbris and plac acasting fram arond th imprssion.

STEP 2 : Apply svral light coats of Dst andDirt Hardnr allowing 2-3 min. drying tim

btwn coats.

STEP 3: Mix and por casting matrial intoimprssion braking th fall with spoon or

spatla to 1/2-3/4 thicknss. Allow 30 min.to cr.

tHree easy steps:

HoW to Use:

Apply 2 coats of Snow Imprssion Wax from10-12. Thn, spray 6 mor coats from 6.

Allow 1-2 min. drying tim btwn coats.

Prpar a sfficint amont of casting matrialto mak th cast 1/2-3/4 thick. Can b sd

with all casting matrials.


9/20

27PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266

Impessin

Evience

Stp 2

Hard-CorE BLuE

Csting Techniqes

casting WitH Hard-core BlUe

hARd-CoReBLueissintsammannrascastingplastr.Fllwthese procedures for consistently good casts: 1.Rmvanybris,twigsrlavsfnlyingntpftimprssin.doNoTrmvanybjctimbedded in the impression. 2. Placacastingfram(N.FCF100)arnthe impression and prepare the surface by adding several light coatings ofstanirtarnr(N.638CA).Allwtwttrmintsfryingtime between coatings. Hard soil or clay generally will not require hardening.Applyaligtcatingfsilicnrlasagnt(N.SRA10)ttimprssin.

3.PrtrqiramntfmixingsltininttbagwitthARd-CoReBLuecasting material. 4. Knead the mixture until thoroughlybln(apprximatlytwmints).Tntirmixtrslbanifrmcolor. 5. Printtimprssin.Bcrtaintbraktfallftmixtrsingastick,spnrspatla.Bginpringarntgsanallwtmixtrtflwvrtimprssin.Gnrally,tcastslb1/2t3/4tick.Nrinfrcmntisrqir.

casting in standing Water

Itispssibltmakacastfanimprssintatisfnnrwatrsing

the following procedure.

Stp 1 Stp 2 Stps 3 and 4

1. Carefully place a casting frame around the impression. If possible, theframe should be wide enough so that it stands above the surface of thewater.

2.LigtlysprinklhARd-CoReBLue compound to completely cover theimprssintaticknsspnntntwatrpt.

3. Mix a quantity of hARd-CoReBLuewith mixing solution and pour themixtrntpftcmpncvringtimprssin.Bcrtaintbraktfallftmixtrwitastick,spnrspatla.

4.Allwatlast30mintsfrstp.Rmvtcastanallwatlast24rsfryingtimbfranyfrtrxaminatinranling.

De t thei size, tie ndftpint impessins eqidiffeent csting medim thtl mks. F mny yes,cime scene investigts

pefeed Plste f Piss thei fist chice f

ecveing lge impessinIn ecent yes, investigthve switched t die stne dentl stne mteils.

Die stne dentl stnefms vey dble cst,eqies n einfcement demnsttes n ppent

shinkge.

Stp 1 Stp 3 Stp 4 Stp 5

Footwar imprssion shownprior to casting.

HARD-CORe BLue is pordonto th srfac to mak a cast

of th imprssion.


10/20

Impessin

Evience


aBoUt Hard-core

BlUe dental stone

casting material

HarD-CorE BLuE is nll-ppse, gypsm-bsed

sting mteil tht ffesHeclen stength, ccteepdctins, simplicity f

se nd lng-tem ecnmy.t is dentl stne csting

mteil pven t be the mstfficient nd pcticl methd csting tie nd ftpintmpessins. Its speitength elimintes the need einfcement. Typiclsts e 1/2 t 3/4 thickcmped with sevel inches

hick sing plste), nd ffeme mzing ppeties. It

hs been sted f mnths nnd in the tnk f vehicle

with n ppent lss ffficiencyfm sbfeezing tempetes in excess f 100

F (38 C). It sets p in shteime nd hs nly minxthemic ectin. only

ge impessins eqiedmming flw estictin.

zip-mix Hard-

core casting

comBinations

Prmasrar-crcastingmaterial and hARd-CoReBLue

solution ensure a uniform mixturevrytim.Simplyatblsolution to the zip-top baganknawitbtansntilsmt.Tn,printprepared impression area.


HCB2001 HARD-COREBLUECastingMaterial,3lbs.(1.36kg) $16.95

HCB2002 HARD-COREBLUESolution,24fl.oz.(709.56ml) $4.95HCB3001 HARD-COREBLUECastingMaterial,9lbs.(4.08kg) $29.25

HCB3002 HARD-COREBLUESolution,72fl.oz.(2.13L) $7.75

HCB4001 HARD-COREBLUECastingMaterial,50lbs.(22.68kg) $69.95


HCB100Z ZIP-MIX Casting Cmb (3 lbs. material, 24 z. slutin) $13.95

HCB100 ZIP-MIX Casting Cmb (6 lbs. material, 48 z. slutin) $25.95

HCB100Z CONTENTS:

- HCB100Z2.2 HARD-CoRE Casting Material,3 lbs. (1.36kg)

- HCB400Z HARD-COREBLUESlutin,24 fl. z. (709.56ml)

This cmbinatin is enugh fr tw ftprintsr a partial tire track)

Hard-CorE BLuE

Pcts

Hard-core BlUe dental stone casting material

hARd-CoReBLue casting material and solution are sold in premeasuredamounts required for mixing.

HCB100 CONTENTS:

- N. HCB100Z 4.4 HARD-CoRE CastingMaterial, 6 lbs. (2.72kg)

- N. HCB2002 HARD-COREBLUESlutin,48 fl. z. (1.42L)

No.HCB3001

No. HCB2002

No. HCB2001

No.HCB3002


11/20

27PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266

Impessin

Evience


639HCB HARD-CoREBLUETireandFootprintCastingKit $306.50

Hard-core BlUe tire and Footprint casting Kit

Tiscmpltkitinclstmatrialsanspplisfrcastingtiranfootprint impressions at the crime scene. hARd-CoReBLuecastingmaterial is provided to permit detailed reproduction of impression evidence.Rsltingcastsarrck-aranrqirnrinfrcmnt.ustiskitfrrecovery of impressions found in snow, mud, sand and soil.

A cast mad with HARD-CORe BLue casting matrial is flly-crdin approximatly 30-45 mints.

639HCB CONTENTS:

1-HCB2001HARD-COREBLUECastinMaterial, 3 lbs. (1.36kg)

1-HCB2002HARD-COREBLUEMixinSlutin, 24 fl. z. (709.56ml)


1- EPS30W Pht Evidence Rulers, 10 e25- 608E01 Evidence Tags with Ties

1- STM1003 Mdeling Clay, 1/4 lb. (113


1- SRA10 Aersl Silicne Rubber ReleaAgent, 4.5 z. (133ml)





1- FCF100 Adjustable Casting Frame,7.25 x 12-18 (18.4cm x 30.5cm-45.7cm)

2- 639C4 Base Builder, 8 z. vl. (236ml


1- SK900 Tape Measure, English/metric ft. (30m)

1- KCP142 Steel Mixing Spn

1- 639HCBC Black Mlded CplymerCarrying Case w/Flding Handle, LckLatches; Dimensins: 17 x 13 x 7.3(43.2cm x 33cm x 18.7cm);Weight: 22 lbs. (10kg)

Shp online t:

www.sichie.cm

Emil us t:

[email protected]

Hard-CorE BLuE

Pcts


12/20

Impessin

Evience



CSP1000 Master HARD-CoREBLUEandLiquidSiliconeCastingKit $339.95

Silicon cast of a sho printfond at a crim scn.

master Hard-core BlUe and

liQUid silicone casting Kit

Tiscmpltfilkitcntainsalltmaterials necessary to recover most forms ofimpression evidence found at crime scenes.Frmtlmarksttirtracks,tiskitffrsfficint,trgvinccllctin.Tflxibilityftiskitbcmsvintwnconfronting various environmental situations.

Hard-CorE BLuE

Pcts

CSP1000 CONTENTS:

1-HCB2001HARD-COREBLUECastingMaterial, 3 lbs. (1.36kg)

1-HCB2002HARD-COREBLUEMixingSlutin, 24 fl. z. (709.56ml)

1- KCP155 Spatula, 7 (17.8cm), Steel Blade

1- EPS30W Pht Evidence Rulers, 10 ea.1- EIL01R SIRCHSEAL Label Rll

5- 608E01 Evidence Tags with Ties

1- STM1003 Mdeling Clay, 1/4 lb. (113g)


1- 634C Liquid Silicne Rubber, 1 lb. (454g)

1- SRA10 Aersl Silicne Rubber ReleaseAgent, 4.5 z. (133ml)

1- TM1 Vial f Catalyst

1- 636C Silicne Rubber Thinner, 16 z.(473ml)

1- 642C Flexible Mixing Bwl, 4.25 (10.8cm)

1- 643C Flexible Mixing Bwl, 4.75 (12.1cm)

1- 644C Flexible Mixing Bwl, 5.25 (13.3cm)1- SP1000 Snw Impressin Wax,

Net Wt. 15 z. (425g)

2- 639C4 Base Builder, 8 z. vl. (236ml)

1- FCF100 Adjustable Casting Frame,7.25 x 12-18 (18.4cm x 30.5cm-45-.7cm)


1- SK900 Tape Measure, English/metric100 ft. (30m)

1- KCP142 Steel Mixing Spn

1- CSP1000C Black Mlded CplymerCarrying Case w/Flding Handle, LckingLatches; Dimensins: 17 x 13 x 7.375(43.2cm x 33cm x 18.7cm);

Weight: 24 lbs. (10.9kg)

Shp online t:

www.sichie.cm

Emil us t:

[email protected]


13/20

27PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266

Impessin

Evience

No. uPS100(camra not incldd).

Th No. uPS100 otprforms cmbrsotripodsand th ntir nit disassmbl

sconds!

uPS100 SPECiFiCaTiONS:

Frame Interir Area:12.75 x 14.875(32.4cm x 37.8cm)

Adjustable Extensin Arm:9.5-16 (21.4cm-40.6cm)

Ttal Weight: 5.9 lbs. (2.7kg)


BIF100 BIo-FoAM Impressin Kit $5.95

BIF101 BIo-FoAM Impressin Kits (case f 24) $135.95Rslting cast mad with

No. SNC42 Shak-N-Cast.

Bio-Foam impression system

hrsaqickanasysystmfmakingfootwear impressions without damaging orcntaminatingtftwar.Simplyprssthe footwear onto the BIo-FoAMsurface, spray on a thin coating ofArsldst&dirtharnr(Cat.N.638CA),antnmixanprinSak-N-Cast(N.SNC42)ray-

to-use casting material.Tismaksaprmanntimprssinftftwar.Thigh-density foam provides extremelyfintailancmspackaginaslf-storing cardboard container.

Tie n Ftpint Csting

Universal evidence pHoto stand

SIRCHIEsunivrsalPtevincStanisanxcllntaltrnativttraitinalcmbrsmcamratrips.Tisptstanliminatstproblem of tripod legs showing up in evidential photographs. It featuresfll-lngtenglis(N.uPS100)rMtric(N.uPS100M)ptscalson all four sides.

Ttrframiscnstrctfstrystlwitamattblackwrinklcatfinis,antajstablptscalmntsarplisstl.Tnitalsfatrsatlscpingprfssinal-tycamramnt.TunivrsalPtevincStanisstryngtspprtmstigitalananalgcamraspt2.5lbs.(1.1kg).Tunit can be assembled and disassembled in seconds for easystorage and transport.

Tvincscalsarprintnmagnticstripsfrasyrplacmnt.Tfrntanbackscalsarmntnsliingscalmntsfrasyajstmnttcvrtevidence being photographed.


UPS100 UniversalEvidencePhotoStandw/EnglishScales $249.50

UPS100M UniversalEvidencePhotoStandw/MetricScales $249.50

UPS101W MagneticScaleSet,White,English,4each $5.95

UPS102W MagneticScaleSet,White,Metric,4each $5.95

UPS101B MagneticScaleSet,Black,English,4each $5.95

UPS102B MagneticScaleSet,Black,Metric,4each $5.95


14/20

searcH rUBBer/gel Footprint liFters

TSeARChRbbr/GeLFtprintLiftrsarniqlysigntallwfor an accurate transfer of foot or footwear prints from dusty and/or dirtysrfacs.Tyarparticlarlysflwnalingwitligtlycvrsrfacsbcastyntgnratstaticlctricitylikstanarliftingtaps.Tw6x15rbbrftprintliftrsnblackannwit.

Ftpint Csting n Lifting

Footprint residUe liFters

Tsniqliftingvicsarcatwitspr-snsitivacrylicasivfrliftingtmstmintparticls.Simplyrmvtasivprtctr,applyttara,liftanmntnbackingmatrialsppliwitacliftr.Liftrsar6x15anarsppliinapackagf12.Liftrsarsppliwittwlv6x15x0.010transparntplasticbackingsts.


FR001 Ftprint Residue Lifters, 12 each $24.25


647C100 Rubber/GEL Ftprint Lifters (1 white, 1 black) $19.95

No. FR001

No. 647C100

Impessin

Evience


sircHtraK tire tread and FootWear

print-oUt system

Taccratlycmpartirprintvinc,ttracklftbytsspcttirslbrcrnrtprssrftvicl.SIRChTRAKisaneasy-to-use drive over system that gives a permanent record of the tirenrla,makingcmparisnstcastsan/rptgrapsmrrliablanliminatingstingrinkingftirstbxamin.

HOW IT WORKS:SimplylayastfSIRChTRAKntimprssinbaranrivtviclvrit.Tprssrfttirnrlacasstintrlavcarbncarrirttransfrttasiv-catrcivrst.Simplypl

off the carbon carrier and discard.

BENEFITS:unlikcnvntinalmtsfmakingtsttracks,ttirtread imprints are exact, uniform, high-contrast reproductions which becomeanaccratsignatrftsspcttir.TSIRChTRAKprinttisperfect for comparison purposes and ultimate courtroom presentations.

1.Driv th vhicl with th sspcttir trad ovr a sht of SIRCHTRAK

attachd to th imprssion board.

2.Prssr of th tir ndr load transfrsth carbon carrir to th adhsiv-coatd

rcivr sht. Simply pl off carrir anddiscard.

HoW sircHtraK

WorKs:

POiNTS OF COMPaRiSON:

IRCHTRAK enables the investigatr tmre precisely examine the fllwing pints fmparisn:

. overall tread design

. Dimensins between ridges and sectins

. Psitins f ridges relative t ne anther

.Unusualwear,markingsanddistinctivefeatures

. Amunt and type f wear

STT100 CONTENTS:

0- STT103 SIRCHTRAK Print-out Sheets

1- STT102 SIRCHTRAK Impressin Bard,13 x 19 (33cm x 48.3cm)

1- STT101 Sheet f Fam Rubber Material frshe print impressins, 11 x 17 (27.9cmx 43.2cm)


STT100 SIRCHTRAK System $99.50


15/20

ezid stainFree FootWear system

Up until now the choices for recording actual shoe print evidence tocmparagainstliftimprssinsavbnlimit.Twftmrpplarmtsinvlvrllingfingrprintinkntslftsantransfrringittpaprrapplyingblackfingrprintpwrttsl,antntransfrringittanasiv-catsrfac.Btmtscratqitamssbtbfrtakingtimprssinanclaning-paftrwar.

After months of research, development and testing a completely newformulation,SIRCHIE is proud to introduce the new EZID StainfreeFootwear Sste asystmtatprcsqalityimprssinswitttmssyclan-p!

TnweZIdsystmcnsistsof a pre-impregnated stainfreepad and pre-sensitized impression

cars.Mrtan200ftwarimprssinscanbtaknfrmasingleZIdstainfrpa.Ansincninkisvisiblntsurface it is applied to, no cleanupisncssary.Pls,trvrssiof the impression cards are printedwith an impression evidencereport for recording all pertinentinformation.

TeZId400kitistialtlfruse in the crime laboratory or atthe crime scene and is excellent for

elimination of prints on-the-spot.It is simple to use and can recordeven the smallest details of wearantarfnnftwar.Tmost outstanding feature is thatthere is no messy cleanup afterimprssinsartakn.


EZID400 EZID Stainfree Ftwear Impressin System $79.50

EZID402C Inkless Impressin Cards, 5 1/2 x 16 1/2, 200 each $44.95

Info Sid

The Dst Pint Lifte Cmpnin!

EZid400 CONTENTS:

1- EZID402 Pre-impregnated Inkless ImprePad, 6 3/4 x 16 3/4 (17.1cm x 42.5cmGd fr 250-300 Impressins

1- EZID402C Preprinted Inkless She Impsin Cards, 5 1/2 x 16 1/2, (14cm x 4200/pack

1- KCP212 Mlded Plyprpylene CarryinCase; Dimensins: 17 1/2 x 7 3/4 x 2(44.5cm x 19.7cm x 6cm)

Stp 2. Plac clan sho on top ofimprssion pad, rolling from hl to t

The EZID STAINFRE

FOOTWEAR

ImPRESSION SySTEm

pvides spei es

with bsltelyNo MESS!

Stp 1. Fill ot information sid of car

Stp 3. Plac card with nprintdsid p on a smooth srfac. Plac

sho on top of imprssion card androll from hl to to. Allow p to

5 mints for dvlopmnt.

Imprssion Sid

Ftpint Csting n Lifting

27PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266

Impessin

Evience


16/20

dst Pint Lifting

No. eSP900 elctrostaticDst Print Liftr

tHe electrostatic dUst print liFter

onftmstvrlkfrmsfpysicalvincattcrimscn

isimprssinvinc.Tisislarglytalackfspcifictrainingintproper search, collection and preservation techniques and procedures.

Locating and recovering obvious impressions from mud, dirt or blood areusually accomplished, but dust prints found in many indoor crime scenes areftnvrlkanmanytimsamagrblitrat.

BysingtelctrstaticdstPrintLiftr,printslftintstfaflr,ligtsilfrmacriminalsss,rimprssinsmanvrlkarasscas

dusty walls or doors can be recovered.

TelctrstaticdstPrintLiftrcnsistsfaigvltagpwrspply/cntrlnit,anickl-platstlgrnplananamtalizliftingmim.olrlctrstaticmlsrqirtsftwliftingmatsnpsitivlycharged and one negatively charged. Our latest electrostatic lifter uses only

one metalized plastic sheet and a metal ground plane. As high voltage isapplittliftingmat,ittaksnangativcargantgrnplanbcmspsitiv.Anystprsntnrtmatwilltaknapsitivcharge and will then be attracted to the negatively charged collection mat. Adust print that is transferred to the lifting mat will appear as a precise mirrorimage of the original print and lifts made from rough-surfaced floor tile orirrglarflringfanykinarfacilitatsingtismt.

Prints from vrtical srfacs,as sn abov, can also b liftd

with th No. eSP900.

Th typical st-p for liftingdst prints lik th rslting on abov is

dpictd to th right sing thNo. eSP900 on a vrtical srfac.


ESP900 Electrstatic Dust Print Lifter Kit $619.00

ESP901 Lifting Mats, 2 x 3, 5 each $15.50

ESP902 Lifting Mats, 2 x 3, 10 each $29.50

ESP905 Rll Lifting Material, 12 x 25 rll $16.25

ESP906 Rll Lifting Material, 12 x 50 rll $26.00

ESP909 Evidence Bx, Lifting Mat, 39 x 27 x 1, 10 each $29.95

The Electsttic Dst Pint Lifte Pdcing mzing

eslts n viety f sfces.

No. eSP900 Kit

SP900 CONTENTS:

-ElectrostaticVoltageControlUnit- Grund Plane, nickel-plated steel, 4 x 6

(10.2cm x 15.2cm)

- Grund Plane Plycarbnate InsulatingSheet, 5 x 7 (12.7cm x 17.8cm)

- Insulated Rller

- 9V Alkaline Battery

- Technical Infrmatin

- Static Discharge Cable

- ESP901T Metallized Lifting Mats in prtec-tive tube, 5 ea.

- Black Mlded Cplymer Case; Dimensins:12.25 x 9 x 3.875 (31.1cm x 22.9cm x9.8cm)

Impessin

Evience



17/20

28PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266

Impessin

Evience

dUrocast impression

comp0Und

Frcntryfanyprmisssallyisaccomplished with the aid of toolsrjimmyingvics.Tinntatinslftby these tools should be preserved usingSIRCHIEs duRoCAST ImpressionCmpn.Tptty-likcnsistncyenables impression castings on vertical orhorizontal surfaces. Castings may be madeftlmarks,firingpinmarksanbrcfacmarks,witxacttail.

Tisisnftmstaccratprctsavailable for impression reproductions andiscapablfrprcingtinkptfu.S.paper currency. It is ideal for reproducing impressions in metals,wood, plastic and paper.No rELEaSE aGENT rEQuIrED For SEParaTIoN.Itsslflifismrtan2yarsinatigtlysalcntainr.Cmpn

inclsaN.doC100Smasringscp.Castingsrmainflxiblinfinitly.Nn-txicwitast-ptimf8-12mints.

Actal cast of th ink dpthof a $20-bill.


DOC1000 DUROCASTImpressionCompoundKit $89.50

Tl Mk Impessin

recvey

Cast of hammr claw.


DoC101 Cmpund w/Catalyst and scp, 23.28 z. (660g) $69.50

DoC330 Cmpund w/Catalyst and scp, 11.64 z. (330g) $25.50

2.Flattn bas matrial in palm ofhand and mak indntation with ovrtr

scoop.

3. Sqz a lin of catalyst th lngthindntation and mix thoroghly with ha

4.Prss compond into th imprssioRmov aftr 8-12 mints.

mixing procedUre

1. us on lvl scoop of bas matria

dUrocast

impression

compoUnd Kit

duRoCASTimprssin

casting compound highlightstiscnvnintfilkit.Extremely fine detail isavailable for impressionsranging from striations on abullet casting to a footprint inhardened concrete.

dOC1000 CONTENTS:

1-DOC1001CDUROCASTImpressionCpund, 23.28 z. (660g)

1-DOC100CDUROCASTImpressionCopund Catalyst, 5g

1- DoC100S Plastic Measuring Spn

1- DoC1 Carrying Case, Texturized MldePlastic; Dimensins: 12.125 x 7.25 x (30.8cm x 18.4cm x 14cm);Weight: 3.72 lbs. (1.7g)


18/20

Impessin

Evience


miKrosil casting material Kit

When casting small details that need high-contrast for microscopicexaminations, use the MIKRoSIL Casting Material method. It consists of twoasy-t-stbs,mixingpaanwnspatla.Tlargtbcntainsputty material (availablinbrwn,gray,blackanwit)antsmallrtbcntainscatalyst.Brwnangrayarprfrrbytlmarkxaminrswilwitanblackarstliftstlatntfingrprintsfrmrgrtextured surfaces.


MCM100B MIKRoSIL Casting Material Kit, Brwn $26.95

MCM100BL MIKRoSIL Casting Material Kit, Black $26.95

MCM100G MIKRoSIL Casting Material Kit, Gray $26.95

MCM100W MIKRoSIL Casting Material Kit, White $26.95

MCM100CA MIKRoSIL Catalyst $5.95

MIKROSIL sd to lift latnt prints from a txtrdvinyl srfac.

MIKROSIL sd to cast a door jam whr a pry bar wassd to gain ntry.

1.Masr ot lngths of bas andcatalyst. (Not that catalyst is slightly

shortr than bas).

2.Mix thoroghly.

3.Apply to th srfacth cast will b mad from.

HoW to Use

miKrosil:

Tool mark fond at crim scn.

4.Aftr pling th cast from th srfac,compar with sspctd tool.

Tl Mk Impessin

recvey

CONTENTS:

1- MCM100 Mikrsil Casting Material, 7 0z.(198g), Spcify color whn ordring

1- MCM100CA Catalyst5- Wden applicatr sticks

5- White plastic mixing cards


19/20

28PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266

Impessin

Evience


DSP100 TexturLift MIKRoSIL Kit $116.50

textUrliFt miKrosil Kit

dvlpinglatntprintsntxtrsrfacsissallyntaifficlttask,btliftingtsprintsis.TTxtrLiftKitprvisasimpl-t-smttatpermits lifting prints from difficult surfaces such as computers, automobileassanintrirsipanls,latrgs,lggag,tc.Tkitalssimplifies lifting prints left in soft material such as wet paint, putty aroundwindows, clay, etc.

TTxtrLiftKitcnsistsfawitMikrsilKit,mixingmatrials,acmbinatinfingrprintpwr(N.SB201L)sablnvirtallyanysrfac,a PrintMaticInkPa(N.PFP602)anakit-sizFibrglassBrs(N.122L1).

HoW to liFt print

From textUred

sUrFaces:

1. Latnts ar dstd on crmpldplastic bag.

2. Lifting compond is mixd and applidlatnts. Allow 10-15 mints to st p.

3. Rsltant lift.

dSP100 CONTENTS:

1- SB201L Silver/Black Latent Print Pwd2 z. (59ml)

1- 122L1 Fiberglass Brush

1- MCM100W Mikrsil (white putty),7 z. (23ml) w/MCM100CA MikrsilCatalyst

1- PFP602 PrintMatic Ink Pad

1- LB002 Glss White Backing Card Pad, x 4 (5.7cm x 10.2cm), 50 sheets

5- Wden Applicatr Sticks

5- White Plastic Mixing Surface Cards

1- DSP100C Black Mlded Cplymer CaCase w/Flding Handle, Lcking Latcheand Mlded Inserts;Dimensins: 12.6875 x 8.9375 x 4.75(32.2cm x 22.7cm x 12.1cm);Weight: 2.6 lbs. (1.2kg)

Tl Mk Impessin

recvey

t M smp--U Md f

lfng Pn fm Dffcu sufac!


20/20

Impessin

Evience

all-pUrpose evidence recovery Kit

TAll-PrpsevincRcvryKitffrsaniqmtfmixinganapplyingliqisilicnfrtcllctinftlmarks,bitmarks,blprints and even developed latent fingerprints.

TPVS200liminatstmssangsswrkbyatmaticallymixingt

exact proportions needed. Just squeeze the trigger and the two compoundsare forced through a mixing tip and dispensed onto the surface.

Tisincriblfrmlaistprfctmtfrliftingpwrlatntprintsfrmtxtr,irrglarrcrvsrfacs.Ttransparntfrmlaenables direct viewing of the print. Opaque formulas produce a reversedimage. In many instances, transparent prints may be placed directly onto a

flatbed scanner and scanned into a computer.


PVS200 All-Purpse Evidence Recvery Kit $199.50

PVS200W Replacement White Dual Cartridge, 75ml $27.50

PVS200B Replacement Brwn Dual Cartridge, 75ml $27.50

PVS200T Replacement Transparent Dual Cartridge, 75ml $27.50

PVS200NT Replacement Spreader Tips, 40 ea. $36.67

PVS200N Replacement Nzzles, 40 ea. $34.76

HoW pvs200

WorKs:

STEP 1:Latnt print is dvlopdon a soda can with SB201L

Silvr/Black Latnt Print Powdr.

STEP 2:Apply th siliconmatrial to th srfac with thextrdr Gn and allow to stp

4-6 mints.

STEP 3: Th rsltant lift pldfrom th can. Print will not rb

off th lift.

Powdr dvlopd latnt print is liftd from qartr withintricat dtail.

Tool mark lft bhind in wood is cast sing th browncompond of PVS200.

Tl Mk Impessin

recvey

PVS200 CONTENTS:1- PVS200EG Extruder Gun

4- PVS200N1 Mixing Nzzles

2- PVS200NT1 Spreader Tips

1- PVS200W White Dual Cartridge, 75ml

1- PVS200B Brwn Dual Cartridge, 75ml

1- PVS200T Transparent Dual Cartridge, 75ml

0- PVS200AS Applicatr Sticks

1- Mlded Plastic Carrying Case w/pre-cutinsert; Dimensins: 14 x 10 x 3 5/8(35.5 x 25.4cm x 9.2cm)Weight: 2.85 lbs. (1.3kg)

Impression Evidence.pdf

Documents

Transcript of Impression Evidence.pdf