Genomics-based tools for the American mink Bernhard Benkel Nova Scotia Agricultural College.
-
Upload
katrina-oliver -
Category
Documents
-
view
215 -
download
0
Transcript of Genomics-based tools for the American mink Bernhard Benkel Nova Scotia Agricultural College.
Genomics-based tools for the Genomics-based tools for the American minkAmerican mink
Bernhard BenkelBernhard BenkelNova Scotia Agricultural CollegeNova Scotia Agricultural College
BackgroundBackground• Breed improvementBreed improvement• Traditional vs DNA marker-assistedTraditional vs DNA marker-assisted
Genomics toolsetGenomics toolset• What is it and how do we get thereWhat is it and how do we get there
ApplicationsApplications• DNA markersDNA markers• Whole genome selectionWhole genome selection
ImplementationImplementation• Who, when, and whereWho, when, and where
Genomics-based Tools for the Genomics-based Tools for the American MinkAmerican Mink
Breed ImprovementBreed Improvement
Breed ImprovementBreed Improvement
28 days
Broilers: days to market from Broilers: days to market from 34 d34 d in 1998 to in 1998 to 28 d28 d in 2008 in 2008
Breed ImprovementBreed Improvement
Milk production: from Milk production: from 7,500 kg7,500 kg per cow per cow in 1990 to in 1990 to 10,000 kg10,000 kg today today
Traditional versus Genomics-Traditional versus Genomics-assistedassisted
Classical selection can be very Classical selection can be very effective, but takes timeeffective, but takes time
Molecular markers preferred for:Molecular markers preferred for:• Late onset traitsLate onset traits• Traits that are expensive to measureTraits that are expensive to measure• Low heritability traitsLow heritability traits• Speed, costSpeed, cost
GenomicsGenomics
Source: DOE/HGMIS
DNA SequenceDNA Sequence
Genome Information ContentGenome Information Content
Size (bp)Size (bp) GenesGenes
HumanHuman 3.2 x 103.2 x 1099
(Billion)(Billion)~35,000~35,000
MouseMouse 2.6 x 102.6 x 1099 ~34,000~34,000
Fruit flyFruit fly 1.8 x 101.8 x 1088 ~14,000~14,000
WormWorm 1.2 x 101.2 x 1088 ~20,000~20,000
YeastYeast 1.2 x 101.2 x 1077 ~6,000~6,000
How Much is 1 Billion bp?How Much is 1 Billion bp?
300 volumes of 300 volumes of “Methods in “Methods in EnzymologyEnzymology””
300 volumes of 300 volumes of “Methods in “Methods in EnzymologyEnzymology””
Genome Mapping ToolsGenome Mapping Tools
Single Nucleotide Polymorphism (SNP) Single Nucleotide Polymorphism (SNP) mapping panelsmapping panels
• coverage, density, economy/automationcoverage, density, economy/automation
Single Nucleotide Polymorphism (SNP)
ATT GGA CAG AAC CGG - QATT GGA CAC AAC CGG – H *
1 million SNPs
Complete Genome Complete Genome SequencesSequences
SpeciesSpecies Genome SeqGenome Seq SNPs submittedSNPs submitted
HumanHuman Assembly v36Assembly v36 11.9 million11.9 million
ChimpanzeeChimpanzee Assembly v2Assembly v2 1.5 million1.5 million
MacaqueMacaque Assembly v1Assembly v1 780780
CowCow Assembly v4Assembly v4 2.2 million2.2 million
PigPig In prepIn prep 8,4008,400
ChickenChicken Assembly v2Assembly v2 3.2 million3.2 million
DogDog Assembly v2Assembly v2 3.3 million3.3 million
Cat Cat In prepIn prep 327,000327,000
Mouse Mouse Assembly v37Assembly v37 14.4 million14.4 million
RatRat Assembly v3Assembly v3 44,00044,000
SNPsSNPs
• Find the SNPs…. 1/1000 in humans = 3 million between individuals
• Find the ‘causative’ SNPs… a single SNP in some cases
A Home-grown ExampleA Home-grown Example
NS mink rancher imports NS mink rancher imports black male(s) with ‘silky’ furblack male(s) with ‘silky’ fur
Silky males bred to NS black Silky males bred to NS black females for a number of yearsfemales for a number of years
Eventually litters containing Eventually litters containing black and ‘marbled’ pups black and ‘marbled’ pups appearappear
Himalayan minkHimalayan mink
HM: IFEQWLRRHHPLQEVYPEANHM: IFEQWLRRHHPLQEVYPEAN WT: IFEQWLRRHHPLQEVYPEANWT: IFEQWLRRHHPLQEVYPEAN HM: APIGHM: APIGQQNRESYMVPFIPLYRNNRESYMVPFIPLYRN WT: APIGWT: APIGHHNRESYMVPFIPLYRNNRESYMVPFIPLYRN HM: GDFFISSRDLGYDYSNLQESHM: GDFFISSRDLGYDYSNLQES WT: GDFFISSRDLGYDYSNLQESWT: GDFFISSRDLGYDYSNLQES
SNP in exon 4 of tyrosinase SNP in exon 4 of tyrosinase gene… gene… one nucleotide out of 2.5 one nucleotide out of 2.5 billionbillion
Simple vs Complex TraitsSimple vs Complex Traits
SimpleSimple = most of genetic variation in = most of genetic variation in trait due to a single genetrait due to a single gene
ComplexComplex = trait controlled by a = trait controlled by a number of genes each… major and number of genes each… major and minor genesminor genes
Distribution TailsDistribution Tails
High versus low performersHigh versus low performers• Size, color, behaviour, etcSize, color, behaviour, etc
Human2001$1 billion
Mouse2002$200 million
Cow2005$50 million
2010$100,000
2015$10,000
Cost of Sequencing a Complex GenomeCost of Sequencing a Complex Genome
Next Generation SequencingNext Generation Sequencing
Massively parallelMassively parallel• SolexaSolexa• SolidSolid
Single molecule Single molecule • HelicosHelicos• MobiusMobius
Archon X-prize = $10 millionArchon X-prize = $10 million• 10 human genomes for < $10K per genome10 human genomes for < $10K per genome
Toward DNA-based Selection in Toward DNA-based Selection in MinkMink
Mink genome sequencingMink genome sequencing• Reference genome assemblyReference genome assembly
Re-sequencing on divergent minkRe-sequencing on divergent mink• SNP marker discoverySNP marker discovery
SNP panels (whole genome/targeted)SNP panels (whole genome/targeted)• Primary tools for association studiesPrimary tools for association studies
DNA Tests: Beef CattleDNA Tests: Beef Cattle Company Test Name Trait Date of validation
Igenity www.igenity.com
Profile® Fat Thickness 12/2008
Profile® Marbling Score 12/2008
Profile® Quality Grade (% ≥ Choice) 12/2008
Profile® Rib Eye Area 12/2008
Profile® Yield Grade 12/2008
Profile® Average Daily Gain 12/2008
Profile® Tenderness 12/2007
Profile® Residual Feed Intake (RFI) (for Bos indicus influenced cattle)
12/2007
Profile® Residual Feed Intake (RFI) (for Bos taurus cattle)
6/2008
Profile® Dry matter intake (DMI) (for Bos indicus influenced cattle)
12/2007
Profile® Heifer Pregnancy Rate
Profile® Stayability (longevity)
Profile® Maternal Calving Ease
Profile® Docility
Pfizer Animal Genetics (Bovigen) www.bovigen.com
GeneSTAR® Tenderness Tenderness 2/2009
GeneSTAR® Marbling % IMF (Feedlot cattle) 2/2009
GeneSTAR® Feed Efficiency
Net Feed Intake (NFI)2/2009
MMI genomics www.metamorphixinc.com
Tru-Marbling™ Marbling Score and Quality Grade
Tru-Tenderness™ Tenderness
Genomic evaluations have arrived for Holsteins!Genomic evaluations have arrived for Holsteins!
Canadian Dairy Network (CDN) has released the August 2009 genetic Canadian Dairy Network (CDN) has released the August 2009 genetic evaluations for all breeds that can be easily accessed by clicking on evaluations for all breeds that can be easily accessed by clicking on the Genetic Evaluation link and selecting the preformatted pdf files for the Genetic Evaluation link and selecting the preformatted pdf files for printing reports, top lists, etc. or by going further and clicking on Data printing reports, top lists, etc. or by going further and clicking on Data Files to choose files to download to your computer.Files to choose files to download to your computer.
For genotyped Holsteins, a new Genomic Evaluation Details page is For genotyped Holsteins, a new Genomic Evaluation Details page is linked to their Genetic Evaluation Summary and all genomic linked to their Genetic Evaluation Summary and all genomic evaluations are labelled with a “G” prefix to the proof type label of PA, evaluations are labelled with a “G” prefix to the proof type label of PA, EBV or MACE.EBV or MACE.
CDN is pleased to provide the information accessible on this web site CDN is pleased to provide the information accessible on this web site as part of its continued commitment to providing valuable genetic as part of its continued commitment to providing valuable genetic evaluation and selection information.evaluation and selection information.
Applications in MinkApplications in Mink
Breed improvement in minkBreed improvement in mink• Disease resistanceDisease resistance
e.g. Aleutian Diseasee.g. Aleutian Disease
• Coat qualityCoat quality Hair density, length, colorHair density, length, color
• ReproductionReproduction• Feed efficiencyFeed efficiency
Budget & Time LinesBudget & Time Lines
NGS sequencing for prototype genome sequence developmentNGS sequencing for prototype genome sequence development• Library construction: 3 paired-end libraries each with a different Library construction: 3 paired-end libraries each with a different
fragment size at $1,200 per library = $3,600fragment size at $1,200 per library = $3,600• NGS sequencing: 5 slides x 7 lanes/slide = 35 lanes at $2,250/lane = NGS sequencing: 5 slides x 7 lanes/slide = 35 lanes at $2,250/lane =
$78,750$78,750 Sequence assembly for prototype genome sequence Sequence assembly for prototype genome sequence
developmentdevelopment• Bioinformatics, sequence assembly = $25,000 Bioinformatics, sequence assembly = $25,000
NGS sequencing for SNP discoveryNGS sequencing for SNP discovery• Library construction: 4 libraries at $1,100 each = $4,400Library construction: 4 libraries at $1,100 each = $4,400• NGS sequencing: 20 lanes at $1,200 each = $24,000NGS sequencing: 20 lanes at $1,200 each = $24,000
SNP discovery SNP discovery • Bioinformatics, SNP discovery = $10,000 Bioinformatics, SNP discovery = $10,000
Total budget: approximately $175,000 CDN over 18 to 24 Total budget: approximately $175,000 CDN over 18 to 24 months with 20% from NS Dept of Agriculture; 40% from the months with 20% from NS Dept of Agriculture; 40% from the mink industry and 40% from Canadian granting agency, mink industry and 40% from Canadian granting agency, NSERCNSERC
CollaboratorsCollaborators
NSAC (Bernhard Benkel)NSAC (Bernhard Benkel)
NIH/Laboratory of Genomic NIH/Laboratory of Genomic Diversity (Stephen O’Brien)Diversity (Stephen O’Brien)
Université de Montréal (Bruce Université de Montréal (Bruce Murphy)Murphy)
Your RoleYour Role
Six months down the road... Six months down the road... provide financial support provide financial support
Immediately… start collecting Immediately… start collecting phenotypes and samplesphenotypes and samples
FollowupFollowup Whole genome association in livestockWhole genome association in livestock
• How does it work, what does it cost, why is How does it work, what does it cost, why is it popular?it popular?
• (www.semex.com/downloads/(www.semex.com/downloads/Genomaxbrocure_ART_LR.pdf)Genomaxbrocure_ART_LR.pdf)
Genome sequencingGenome sequencing• Implications for medicine of the $1000 Implications for medicine of the $1000
genome sequence?genome sequence?• Complex traits and prediction of phenotype Complex traits and prediction of phenotype
from genome sequence infofrom genome sequence info
Applications Applications
SpeciesSpecies SNP SNP Markers Markers (validated)(validated)
SNP Map SNP Map Panel Panel
(comm)(comm)
HumanHuman 6.2 million6.2 million 10,00010,000
100,000100,000
500,000500,000
MouseMouse 6.5 million6.5 million 1,5001,500
5,0005,000
9,000**9,000**
CattleCattle 14,50014,500 10,00010,000
25,00025,000
50,00050,000
ChickenChicken 3.2 million3.2 million 50,000*50,000*
MinkMink handfulhandful NANA
Whole Genome Scan to Whole Genome Scan to identify genes controlling identify genes controlling important traits important traits
coronary artery disease in humanscoronary artery disease in humans type 2 diabetes in humanstype 2 diabetes in humans feed efficiency in cattlefeed efficiency in cattle
Whole Genome SelectionWhole Genome Selection black box approachblack box approach marker assisted selectionmarker assisted selection
Gene Order ValidationGene Order Validation
Using Genomic Info for Breed Using Genomic Info for Breed ImprovementImprovement
Discover genetic variation by sequencingDiscover genetic variation by sequencing• Single nucleotide polymorphisms (SNPs)Single nucleotide polymorphisms (SNPs)
1/1000 between individuals (human)1/1000 between individuals (human)
Develop SNP panels for:Develop SNP panels for:• Whole genome association studiesWhole genome association studies
Shotgun or black box approachShotgun or black box approach
• Functional candidate gene approachFunctional candidate gene approach Surgical strike - do you feel lucky?Surgical strike - do you feel lucky?