Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the...
Transcript of Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the...
![Page 1: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/1.jpg)
Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City,
Using the Results of a Stated Preference Survey and Air Pollution Modelling
By
SHARIF Rayhan SIDDIQUE
A thesis presented for the degree of Doctor of Philosophy
Business School The University of Western Australia
Perth WA, Australia
December 2006
![Page 2: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/2.jpg)
Abstract
i
AAbbssttrraacctt
Air pollution is increasingly perceived to be a serious intangible threat to humanity,
with air quality continuing to deteriorate in most urban areas. The main sources of inner
city pollution are motor vehicles, which generate emissions from the tail pipe as well as
by evaporation. These contain toxic gaseous components which have adverse health
effects. The major components are carbon monoxide (CO), nitrogen dioxide (NO2),
nitric oxide (NO), sulphur dioxide (SO2), particulates (PM10), and volatile organic
compounds (VOC). CO and oxides of nitrogen (NOx) are major emissions from cars.
This study focuses on pollutant concentration in Perth city and has sought to develop
measures to improve air quality. To estimate concentrations, the study develops air
pollution models for CO and NOx; on the basis of the model estimates, effective policy
is devised to improve the air quality by managing travel to the city.
Two peaks, due to traffic, are observed in hourly CO and NOx concentrations. Unlike
traffic, however, the morning peak does not reach the level of the afternoon peak. The
reasons for this divergence are assessed and quantified.
Separate causal models of hourly concentrations of CO and NOx explain their
fluctuations accurately. They take account of the complex effects of the urban street
canyon and winds in the city. The angle of incidence of the wind has significant impact
on pollution level; a wind flow from the south-west increases pollution and wind from
the north-east decreases it. The models have been shown to be equivalent to
engineering and scientific models in estimating emission rate in the context of street
canyons. However the study models are much more precise in the Perth context.
A number of existing transport and environmental policies and regulations applied in
various cities could be applicable in Perth. Four broad policy categories are fixed
charge, variable charges, parking fee, and lane restriction measures. Initial analysis
indicated that these measures could appreciably improve air quality in Perth.
Perth city is unlike Sydney and Melbourne in that about 70% of sampled travellers use
private transport to the city and only 30% use public transport, which indicates the
potential for car suppression policies. The study identified the factors which influence
travellers’ mode choice decisions by developing a nested logit model using discrete
choice analysis with existing survey (RP) data.
![Page 3: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/3.jpg)
Abstract
ii
Whereas other studies have used the stated preference method to assess travel mode
selection, trip destination or parking preference, the next step in this study was to use
penalising attributes to determine the impact on car use. The responses from a stated
preference (SP) survey showed about 72% of the sample taking the car to the city for
purposes other than work. Among these about 25% go to shop and 33% for personal
business or recreation. Another significant observation is that about 71% of the sample
are willing to switch to public transport if taking a car to the city is not convenient. This
indicates the potential for imposing measures to reduce car use.
Binary logit models with and without socio-demographic variables explain the
respondents’ reaction to potential policies. Separate work and non-work models were
developed. The models are used to calculate the marginal effects for all attributes and
elasticity for fuel price. In almost all attributes the non-work group is more responsive
than the work group.
Finally, the SP model results are integrated into an econometric model for the purpose
of prediction. The travel behaviour prediction is used to estimate the policy impact on
air quality. The benefit from the air quality improvement is reported in terms of life
saved. The estimated relationships between probability of death and air pollution
determines the number of lives that could be saved under various policy scenarios. A
ratio of benefits to the financial and perceived sacrifices by drivers is calculated to
compare the effectiveness of the suggested policies. A car size charge policy was
found to be the most cost effective measure to ameliorate the environmental impact of
cars in Perth, with a morning peak entry time charge being almost as cost effective.
The study demonstrates the need for appropriate modelling of air pollution and travel
behaviour. It brings together analytical methods at three levels of causality, vehicle to
air pollution, charge to travel response, and air pollution to health.
![Page 4: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/4.jpg)
Acknowledgement
iii
AAcckknnoowwlleeddggeemmeennttss
My deep gratitude and sincere appreciation to my supervisor, Professor John H. E.
Taplin, for his invaluable advice, enormous support, important suggestions,
accessibility, and continuous encouragements in conducting this research work. I would
also like to thank him for taking the burden of correcting my writing and helping me
improves my English. I am very fortunate to have him as my supervisor. I believe his
direction provides the positive turning point of my life.
I would also express my thanks to my co-supervisor Dr. Min Qiu for his help in
understanding analytical aspects of this research work. Mr. Brett Smith and Dr. Doina
Olaru have extended their patient help in specifying models and providing
interpretations.
I gratefully acknowledge the Planning and Transport Research Centre (PATREC) for
awarding me a scholarship to complete the degree. The PATREC scholarship helped
me concentrate on my research and avoid effort of earning other financial support.
I would also thank the Department of Environment, Main Roads Western Australia,
Bureau of Meteorology, and Department for Planning and Infrastructure for providing
data for this research.
Finally, I would thank my friends and family for their support in completing this
research. My wife Sayma and daughters Saba and Samarah always support me by
sacrificing their time with me. My mother, father-in-law and mother-in-law are the
main source of encouragement to complete this research. I am really grateful to them
for their emotional support.
![Page 5: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/5.jpg)
Table of content
iv
TTaabbllee ooff CCoonntteenntt
Abstract ......................................................................................................................... i
Acknowledgements ..................................................................................................... iii
List of Tables .............................................................................................................. ix
List of Figures ........................................................................................................... xiii
Acronyms .................................................................................................................. xvi
CHAPTER ONE ....................................................................................................... 1
Introduction to the Research .......................................................................... 1 1.1 CARS AND AIR QUALITY........................................................................ 1
1.2 PROBLEM STATEMENT IN RELATION TO PREVIOUS WORK......... 2
1.3 PUBLIC POLICY MEASURES AND INSTITUTIONS............................. 3
1.4 AIR COMPOSITION AND POLLUTION .................................................. 5
1.4.1 Health and environmental impact of pollutants .................................... 6
1.4.2 Sources of pollutants in Perth ............................................................... 7
1.5 CLIMATE AND OTHER CHARACTERISTICS OF PERTH.................. 10
1.6 AIM OF THE RESEARCH ........................................................................ 13
1.7 ORGANISATION OF THE THESIS ......................................................... 15
CHAPTER TWO .................................................................................................... 17
Previous analysis and policies on air pollution and travel behaviour ...... 17 2.1 APPROACHES TO AIR POLLUTION AND TRANSPORT .................. 17
2.2 HEALTH IMPACT OF AIR POLLUTION ............................................... 20
2.3 AIR POLLUTION MODELS..................................................................... 22
2.3.1 The STREET Model .................................................................... 24
2.3.2 The OSPM Model ........................................................................ 25
2.3.3 The CALINE4 Model .................................................................. 26
2.3.4 Factors influencing vehicle emission rate .................................... 26
2.4 AIR POLLUTION CONTROL POLICY ................................................... 28
2.4.1 Technology Measures .................................................................. 30
2.4.2 Pricing Measures.......................................................................... 30
2.4.3 Car Manufacturing Industry Measures ........................................ 31
2.4.4 Vehicle Maintenance Measures ................................................... 31
2.4.5 Awareness Measures.................................................................... 32
![Page 6: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/6.jpg)
Table of content
v
2.5 AIR POLLUTION CONTROL IN PERTH, WESTERN AUSTRALIA ... 33
2.6 DISCRETE CHOICE ANALYSIS............................................................. 36
Appendix 2A: The Gaussian Plume Model ............................................................ 38
Appendix 2B: The STREET Model........................................................................ 40
Appendix 2C: The OSPM Model............................................................................ 42
Appendix 2D: The MOBILE6 Emission Model and the AusVeh 1.0 emission
Model .............................................................................................. 44
CHAPTER THREE ................................................................................................. 47
Causal relationships between traffic and air pollution in a Perth city canyon 3.1 INTRODUCTION ...................................................................................... 47
3.2 AIR POLLUTION DEVELOPMENT IN PERTH CITY........................... 48
3.2.1 Factors in the formation of pollutants ................................................. 48
3.2.1.1 Meteorology ...................................................................... 48
3.2.1.2 Street geometry ................................................................ 51
3.2.1.3 Perth city pollution monitoring station............................ 53
3.2.1.4 Traffic volume and emission factor.................................. 54
3.3 DATA STRUCTURE ................................................................................. 55
3.3.1 Air quality data............................................................................. 55
3.3.2 Meteorological data...................................................................... 58
3.3.3 Traffic data ................................................................................... 60
3.4 AIR POLLUTION MODEL ....................................................................... 61
3.4.1 ARIMA Model ............................................................................. 62
3.4.2 Causal Model ............................................................................... 65
3.5 COMPARISON WITH PREVIOUSLY DEVELOPED MODELS ............. 76
3.6 CONCLUSION........................................................................................... 78
Appendix 3A: ARIMA (111) Model – CO.......................................................... 80
Appendix 3B: ARIMA (111) Model – NOx......................................................... 81
Appendix 3C: CM1CO and CM3CO Models...................................................... 82
Appendix 3D: CM1NOx and CM3NOx Models .................................................. 83
CHAPTER FOUR ................................................................................................... 84
Traffic Control Policies to Reduce Pollution in Perth City: a first assessment based on previously estimated elasticities.................................................... 84
4.1 INTRODUCTION ...................................................................................... 84
4.2 MEASURES TARGETED TO THE CITY................................................ 86
![Page 7: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/7.jpg)
Table of content
vi
4.3 ELASTICITY ESTIMATION .................................................................... 86
4.3.1 Response to a Fixed Charge......................................................... 87
4.3.2 Responses to Variable Charges.................................................... 89
4.3.3 Responses to Parking Measures ................................................... 91
4.3.4 Responses to Lane Restriction ..................................................... 93
4.3.5 Average Elasticities...................................................................... 93
4.4 IMPACT ON AIR QUALITY .................................................................... 95
4.4.1 Impact of a Fixed Charge............................................................. 95
4.4.2 Impact of Variable Charges ......................................................... 97
4.4.3 Impact of Parking Measures......................................................... 99
4.4.4 Impact of Lane Restriction......................................................... 100
4.4.5 Combined Impact ....................................................................... 102
4.5 CONCLUSION......................................................................................... 104
CHAPTER FIVE ................................................................................................... 105
Factors Influencing Car Use: A Revealed Preference Analysis .............. 105 5.1 A TWO-PHASE MODELLING APPROACH......................................... 106
5.2 METHODOLOGY.................................................................................... 108
5.2.1 The Revealed Preference (RP) Model........................................ 108
5.2.2 Elasticities .................................................................................. 112
5.2.3 Value of travel time savings (VTTS) ......................................... 113
5.3 DATA STRUCTURE ............................................................................... 113
5.4 ASSUMPTIONS FOR DATA IMPUTATION ........................................ 115
5.5 MODEL ESTIMATION ........................................................................... 117
5.5.1 Multinomial Logit (MNL) Model .............................................. 118
5.5.2 Nested Logit (NL) Model .......................................................... 119
5.5.3 Nested Logit Model with different time parameters (NLDT).... 120
5.5.4 Elasticity Estimation .................................................................. 123
5.5.5 Value of Travel Time Savings (VTTS) Estimation ................... 124
5.6 DISCUSSION AND CONCLUSION....................................................... 124
Appendix 5A: Monthly average unleaded petrol price ...................................... 126
Appendix 5B: Public Transport Fares................................................................ 127
Appendix 5C: Example of Data set.................................................................... 128
Appendix 5D: MNL model without socio-demographic variable ..................... 129
Appendix 5E: MNL model with socio-demographic variable........................... 130
Appendix 5F: NL model with socio-demographic variable............................... 131
![Page 8: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/8.jpg)
Table of content
vii
Appendix 5G: NL model with socio-demographic variable and different time parameter.................................................................................... 132
CHAPTER SIX ..................................................................................................... 133
Stated Preference Survey of car travel to Perth city .......................................... 133 6.1 INTRODUCTION .................................................................................... 133
6.2 POLICY REACTION MODEL................................................................ 134
6.2.1 The Model .................................................................................. 135
6.2.2 Inapplicability of combined SP-RP............................................ 137
6.3 DESIGNING THE SP MODEL ............................................................... 138
6.3.1 Experimental design................................................................... 138
6.3.2 Data collection instrument ......................................................... 140
6.3.3 Sampling frame and sample size................................................ 142
6.3.4 Data collection ........................................................................... 143
6.4 SURVEY OUTCOMES............................................................................ 143
6.5 SUMMARY .............................................................................................. 148
Appendix 6A: Car Trip Response Survey 2005 Questionnaire ......................... 150
CHAPTER SEVEN ............................................................................................... 160
Modelling the reactions of car travellers to Perth city............................. 160 7.1 INTRODUCTION .................................................................................... 160
7.2 REACTIONS TO ATTRIBUTE LEVELS............................................... 161
7.3 MODEL ESTIMATION ........................................................................... 162
7.3.1 Binary logit model for Q1: Whether to take the car .................. 163
7.3.2 Panel Data Model....................................................................... 166
7.3.3 Latent Class Model .................................................................... 167
7.3.4 Binary logit model for work and non-work groups ................... 174
7.4 MARGINAL EFFECTS ANALYSIS ...................................................... 176
7.5 FUEL PRICE ELASTICITY .................................................................... 177
7.6 BINARY LOGIT MODEL FOR Q2 ........................................................ 178
7.7 SUMMARY AND CONCLUSION.......................................................... 179
Appendix 7A: Q1SP Model ............................................................................... 181
Appendix 7B: Q1SPSD Model .......................................................................... 183
Appendix 7C: Q1SPP Model ............................................................................. 185
Appendix 7D: Q1LC Model .............................................................................. 187
Appendix 7E: Q1SPSDW and Q1SPSDNW Models ........................................ 189
![Page 9: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/9.jpg)
Table of content
viii
Appendix 7F: Q2SP Model................................................................................ 192
Appendix 7G: Q2SPSD Model .......................................................................... 194
CHAPTER EIGHT ................................................................................................ 196
Modelling the impact of policy measures on air quality in Perth...................... 196 8.1 INTRODUCTION .................................................................................... 196
8.2 MODEL IMPLEMENTATION................................................................ 197
8.2.1 Estimation of policy impacts...................................................... 197
8.3 MODELLED IMPACT ON TRAFFIC .................................................... 198
8.3.1 Combined SP and RP................................................................. 199
8.3.2 Application of the SP model alone............................................. 203
8.4 ESTIMATED TRAFFIC IMPACT ON AIR QUALITY ......................... 204
8.5 HEALTH IMPACT OF AIR QUALITY IMPROVEMENT ................... 207
8.5.1 Mortality and morbidity from air pollution................................ 207
8.5.2 Health impact of policy implementation.................................... 210
8.6 BENEFIT-SACRIFICE RATIO ............................................................... 212
8.7 CONCLUSION......................................................................................... 215
Appendix 8A: Base case model ........................................................................ 217
Appendix 8B: Fuel price change simulation model........................................... 219
Appendix 8C: Parking charge simulation model ............................................... 220
CHAPTER NINE .................................................................................................. 221
Conclusions ............................................................................................ 221 9.1 RESEARCH FINDINGS ......................................................................... 222
9.1.1 The pollution models ................................................................. 223
9.1.2 The behavioural models ............................................................. 224
9.2 IMPLICATIONS AND INFERENCES.................................................... 226
9.2.1 Financial assessment .................................................................. 226
9.2.2 Other implications and inferences.............................................. 227
REFERENCES......................................................................................................... 229
![Page 10: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/10.jpg)
List of tables
ix
LLiisstt ooff TTaabblleess
Table 1.1: Sea level air composition
Table 2.1: Comparison of key environmental and transport policy approaches
Table 3.1: Comparative results of ARIMA models for CO level
Table 3.2: Comparative results of ARIMA models for NOx level
Table 3.3: Correlations between CO & explanatory variables
Table 3.4: Correlations between NOx & explanatory variables
Table 3.5: Comparative results of regression models for CO
Table 3.6: Coefficients of the explanatory variables for first difference of hourly CO level
Table 3.7: Comparative results of regression models for NOx
Table 3.8: Coefficients of the explanatory variables for first difference of hourly NOx level
Table 3.9: A comparison of CO/NOx ratio between present study and other studies
Table 3.10: A comparison of emission factors between this study and other studies
Table 3C1: Coefficients of the explanatory variables for hourly CO level for CM1CO model
Table 3C2: Coefficients of the explanatory variables for hourly Ln CO level for CM3CO model
Table 3D1: Coefficients of the explanatory variables for hourly NOx level for CM1NOx model
Table 3D2: Coefficients of the explanatory variables for hourly Ln NOx level for CM3NOx model
Table 4.1: Summary of potential measures for ameliorating air pollution
Table 4.2: Policies applicable to Perth City
Table 4.3: Comparative performance of cordon pricing for Norwegian cities
Table 4.4: Estimates of elasticity of fuel consumption with respect to fuel price
Table 4.5: Travel demand elasticity
Table 4.6: Peak and off-peak travel demand elasticity
![Page 11: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/11.jpg)
List of tables
x
Table 4.7: Demand elasticities of car and public transport for work trips
Table 4.8: Parking price elasticity
Table 4.9: Average elasticities for four suggested measures
Table 4.10: Impact of fixed charge
Table 4.11: Impact of variable charge by time of days (peak/between peaks/rest of day)
Table 4.12: Impact of parking measure (peak/off-peak)
Table 4.13: Impact of lane restriction
Table 4.14: Combined impact of policy measures
Table 4.15: Annual reduction of pollution in tonnes in the Perth airshed
Table 5.1: Characteristics of sampled travellers to Perth city (from PARTS survey 2002-03)
Table 5.2: Estimated results: MNL model with socio-demographic variables
Table 5.3: Estimated results with NL model
Table 5.4: Success table for NL model
Table 5.5: Estimated results with NL model with different travel time parameter (NLDT)
Table 5.6: Success table for NL model with different travel times
Table 5.7: Comparative results from different models
Table 5.8: Direct and Cross-elasticities with respect to the trip cost
Table 5A1: Monthly average unleaded petrol price
Table 5B1: Public Transport Fares
Table 5C1: First 16 observations of the data set
Table 6.1: Attributes and their levels used for the decision process
Table 6.2: Orthogonal main effect design profiles
Table 6.3: Respondents profile from their last car trip to Perth city
Table 6.4: Summery of metric variables
Table 6.5: Classification by purpose
Table 6.6: Relation between trip purpose and selected alternative if not taking a car
Table 6.7: Car size and trip purpose
![Page 12: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/12.jpg)
List of tables
xi
Table 6.8: Responses to SP profiles: Proportion of respondents who would take their car to the city
Table 6.9: Responses to SP profiles for work and non-work groups
Table 7.1: Odds ratios for the attributes
Table 7.2: Odds ratios of attributes for two groups
Table 7.3: Binary logit model for Q1 with only SP data (Q1SP)
Table 7.4: Binary logit model for Q1 with SP and socio-demographic data (Q1SPSD)
Table 7.5: Panel data model for Q1 with only SP data (Q1SPP)
Table 7.6: Latent class model with SP and socio-demographic data (Q1LC)
Table 7.7: Cross tabulation of class members and choice alternatives
Table 7.8: Mean values of selected variables for class 1 and class 2
Table 7.9: Latent class and purpose group membership
Table 7.10: Latent class and selected variables
Table 7.11: Responses to SP profiles for work and non-work groups
Table 7.12: Binary logit model for the work (Q1SPSDW) and the non-work (Q1SPSDNW) purpose group with SP and socio-demographic data
Table 7.13: Marginal effects of attributes for the work and non-work groups
Table 7.14: Fuel price elasticities for various models
Table 7.15: Binary logit model for Q2 with only SP data (Q2SP)
Table 7.16: Binary logit model for Q2 with SP and work purpose (Q2SPSD)
Table 8.1: Potential policies and charges assessed
Table 8.2: Model coefficients of various charges
Table 8.3: Conversion of policy measures to parking fee equivalents
Table 8.4: Estimated impact on car use to the city
Table 8.5: Policy responses on car use using SP models
Table 8.6: Relative Risks of death from individual studies
Table 8.7: Relative Risks for respiratory and cardiovascular deaths from individual studies
Table 8.8: Annual value of statistical life saved from different policies or charges
![Page 13: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/13.jpg)
List of tables
xii
Table 8.9: Benefit-Sacrifice Ratio calculation for various policies
Table 9.1: Relative contributions of variables explaining CO and NOx levels
Table 9.2: Coefficients of the RP model for trips by all modes and the binary SP models for car only: trips to Perth city
![Page 14: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/14.jpg)
List of figures
xiii
LLiisstt ooff FFiigguurreess
Figure 1.1: Pollutants emitted in Perth and Sydney airsheds in 2003-04
Figure 1.2: Sources of pollutants in Perth in 2003-2004
Figure 1.3: Monthly average temperature in Perth
Figure 1.4: Monthly average rainfall in Perth
Figure 1.5: Monthly average wind speed in Perth
Figure 1.6: Average wind direction in Perth at 9am and at 3pm
Figure 1.7: Research framework
Figure 2.1: Two cross-sections of a Gaussian plume
Figure 2A1: The Gaussian Plume Model
Figure 2B.1: Schematic of cross-street circulation between buildings
Figure 3.1: Morning emissions lost out at sea
Figure 3.2: Morning emissions are trapped in the city
Figure 3.3: Inland event showing emission flows
Figure 3.4: Kwinana event showing emission flows
Figure 3.5: Schematic diagram of flow and dispersion condition in street canyon
Figure 3.6: Dimensions of a street canyon
Figure 3.7: The flow regimes associated with air flow over building and aspect ratio
Figure 3.8: Air quality monitoring stations in Perth Metropolitan area
Figure 3.9: Queens Building monitoring station
Figure 3.10: Hourly CO level in Perth City from October 2003 to June 2005
Figure 3.11: Hourly NO2 level in Perth City from October 2003 to June 2005
Figure 3.12: Hourly NOx level in Perth City from October 2003 to June 2005
Figure 3.13: Hourly variation in an average day, (a) for CO, and (b) for NOx in Perth city
Figure 3.14: Monthly average Temperature, wind speed and pollution level in Perth city over 2003 to 2005
![Page 15: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/15.jpg)
List of figures
xiv
Figure 3.15: Wind directions in Perth
Figure 3.16: Average hourly traffic in the city for the period between October 2003 and March 2004
Figure 3.17: Pollutant levels for a) a week in late October ’03, and b) a week in late December ‘03
Figure 3.18: ACF and PACF for CO levels for 16 hours lag periods
Figure 3.19: ACF and PACF after first differencing of CO levels for 16 hours lag periods
Figure 3.20: Residual plots for a) ‘seasonal’ model and b) ‘non-seasonal’ model
Figure 3.21: ACF and PACF after first differencing of NOx levels for 16 hours lag periods
Figure 3.22: Residual plots for a) ‘seasonal’ and b) ‘non-seasonal’ models of NOx
Figure 3.23: Traffic and a) average hourly CO level, b) average hourly NOx level in Perth city during Oct 2003 to Mar 2004
Figure 3.24: Residual plots for models a) CM1CO, b) CM2CO, and c) CM3CO
Figure 3.25: Residual plots for models a) CM1NOx, b) CM2NOx, and c) CM3NOx
Figure 3.26: Comparison between actual and model CO levels for (a) a week in late October ‘03, (b) a week in late December ‘03
Figure 3.27: Comparison between actual and model NOx levels for (a) a week in late October ‘03, (b) a week in late December ‘03
Figure 3.28: William Street canyon with wind directions
Figure 3.29: Assumed dimensions of the Perth airshed
Figure 4.1: Price elasticity for small and large change
Figure 4.2a: Impact of fixed charge of $1.0 on CO level for 6-month average data
Figure 4.2b: Impact of fixed charge of $1.0 on NOx level for 6-month average data
Figure 4.3a: Impact of variable charges of $0.4/$0.35/$0.3 for three periods of a day on hourly CO for 6-month average data
Figure 4.3b: Impact of variable charges of $0.4/$0.35/$0.3 for three periods of a day on hourly NOx for 6-month average data
Figure 4.4a: Impact of parking measure of $0.4.0/$3.0 on hourly CO for 6-month average data
Figure 4.4b: Impact of parking measure of $0.4.0/$3.0 on hourly NOx for 6-month average data
![Page 16: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/16.jpg)
List of figures
xv
Figure 4.5: Example of lane restriction at William Street and Wellington Street intersection
Figure 4.6a: Impact of 25% lane restriction on hourly CO for 6-month average data
Figure 4.6b: Impact of 25% lane restriction on hourly NOx for 6-month average data
Figure 4.7a: Short and long term impact of combined policy on hourly CO
Figure 4.7b: Short and long term impact of combined policy on hourly NOx
Figure 5.1: Hierarchical structure of mode distribution for travellers to Perth City
Figure 6.1: Response pattern of the survey
Figure 7.1: Latent class model structure
Figure 8.1: Hourly CO level under alternative policy measures: a new or added $1.00 charges in each case
Figure 8.2: Hourly NOx level under alternative policy measures: a new or added $1.00 charges in each case
Figure 8.3: Average daily CO and NOx reduction under alternative policy measures
Figure 8.4: Impact of parking fee on car use in the city
Figure 8.5: Lives saved under different policy measures in 2004
Figure 8.6: Benefit-Sacrifice Ratios and financial sacrifices for different measures
Figure 9.1: Initial estimates of annual reduction of air pollution in Perth city under four suggested policies
Figure 9.2: Benefit-sacrifice ratios for four potential policy measures
![Page 17: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/17.jpg)
Acronyms
xvi
AAccrroonnyymmss ABS Australian Bureau of Statistics
ACF Autocorrelation Function
ADR Australian Design Rules
AGO Australian Greenhouse Office
AIC Akaike’s Information Criterion
AQCP Air Quality Control Policy
AQMP Air Quality Management Plan
ARIMA Auto Regressive Integrated Moving Average
ASC Alternative Specific Constant
BTRE Bureau of Transport and Regional Economics
BTCE Bureau of Transport and Communications Economics
CBD Central Business District
CNG Concentrated Natural Gas
CO Carbon Monoxide
CO2 Carbon Dioxide
COPD Chronic Obstructive Pulmonary Disease
CPI Consumer Price Index
CSIRO Commonwealth Scientific and Industrial Research Organisation
DEP Department of Environmental Protection
DOTARS Department of Transport and Regional Service
EA Environment Australia
EEA European Environment Agency
EPA Environmental Protection Agency
ERP Electronic Road Pricing
HC Hydro Carbon
IIA Independence of Irrelevant Alternatives
IID Independently and Identically Distributed
IV Inclusive Value
LPG Liquefied Petroleum Gas
MNL Multinomial Logit
MSE Mean Square Error
NEPM National Environmental Protection Measure
NL Nested Logit
![Page 18: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/18.jpg)
Acronyms
xvii
NO Nitric Oxide
NO2 Nitrogen Dioxide
NOx Oxides of Nitrogen
NPI National Pollutant Inventory
OSPM Operational Street Pollution Model
PACF Partial Autocorrelation Function
PARTS Perth and Regions Travel Survey
PCU Passenger Car Unit
PPSS Perth Photochemical Smog Study
RP Revealed Preference
RR Relative Risk
SBC Schwarz Bayesian Criterion
SP Stated Preference
UNEP United Nations Environment Program
VKT Vehicle Kilometres Travelled
VMT Vehicle Miles Travelled
VOC Volatile Organic Compound
VOSL Value of Statistical Life
VTTS Value of Travel Time Savings
WA Western Australia
WHO World Health Organisation
![Page 19: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/19.jpg)
Chapter 1: Introduction to the research
1
CHAPTER ONE
Introduction to the Research
1.1 CARS AND AIR QUALITY
A serious reason for government reluctance to undertake unpalatable measures to
combat air pollution is concern about actual outcomes. If charges or restrictions are to
be imposed on motorists in order to improve conditions then the government taking this
step needs to be reasonably assured that a certain impost will produce a fairly certain
result. Then the achievement can be publicised to demonstrate that the sacrifice made by
those bearing the burden produces a quantifiable benefit.
This study addresses the problem by developing precise measures of car contributions to
pollution and, even more importantly, measures of driver responses to a variety of
potential steps to limit car use in critical areas at critical times. A city with a relatively
modest pollution problem but good data provides the basis for a model of how the
benefits can be measured reliably, even though air quality is considerably better than in
many other cities. Perth is an important case because of its high car ownership and
extremely high car share of commuter trips to the central business district.
Thus the study has two main areas of contribution: one in modelling air pollution and
the other in modelling relevant travel behaviour. These have been brought together to
determine pollution control measures. The study has dealt with three levels of causality:
vehicle to air pollution, charges to responses, and pollution to health. The final step is
to measure the value of lives saved in relation to the burdens that would be imposed on
motorists.
Air pollution modelling is a major part of the study. The estimated causal models are
shown to be equivalent to engineering and scientific models in estimating the emission
rates. They will be shown to be not only equivalent but also precise in providing
unbiased and accurate vehicle coefficients with tight confidence limits. The estimated
pollution models have also been interpreted in terms of a street canyon model in a
precise way.
![Page 20: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/20.jpg)
Chapter 1: Introduction to the research
2
1.2 PROBLEM STATEMENT IN RELATION TO PREVIOUS WORK
A review of previous studies in this area indicates the growing concern about
sustainable transport and its environmental impact, but these questions are addressed
from different points of view – socio-economic, transport, and management. According
to Camagni et al. (1998) ‘environment’ can be categorised as physical, economic, and
social and interactions between them, but many previous studies are limited by the
traditional borders of the discipline in which they are rooted and do not address all
components of the problem.
Research conducted by microeconomists has considered social costs, pricing, marginal
costs, who should be liable for the environmental pollution, and what would be the
efficient way to charge travellers. This research has been less strong on equity issues,
social barriers and implementation. There has been a tendency to examine air and noise
pollution, and congestion from a short term point of view.
Transport specialists have tended to investigate environmental issues such as air
pollution, congestion, demand management, and public transport from an engineering
point of view. Studies of the sustainable development of urban areas have covered the
short, medium, and long term. However, the studies have not answered the question,
how could travel behaviour be managed so as to do more to alleviate pollution?
Public health researchers have studied the impact of atmospheric pollution on the
human body. Other social scientists have looked at environmental issues in terms of
equity, ‘livability’, urban development, use of land, and economic growth.
This study goes beyond the boundaries of previous studies. A model to analyse and
predict atmospheric pollution in Perth, as an example of a medium sized city, using
traffic and meteorological variables is developed. Then, environmental control policies
are formulated to improve air quality. In turn, the predicted result is used in stated
preference (SP) analysis to reveal the probable responses of Perth travellers. Better
understanding of traveller sensitivity to environmental impact and control measures will
facilitate improved pollution control management (Louviere et al. 2000) and sustainable
development. Finally, suitable environmental control policies are identified by
observing costs and benefits of the policy implementation. Thus, three major questions
are addressed:
![Page 21: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/21.jpg)
Chapter 1: Introduction to the research
3
• What is the nature of the variation in air pollution in Perth and what are
the causal factors that influence this variation?
• How would urban people respond to policies specifically designed to
reduce air pollution?
• Which policies would be most effective in reducing air pollution in the
urban area?
• What would be the health benefits of the reduced pollution?
1.3 PUBLIC POLICY MEASURES AND INSTITUTIONS
Emissions from road, air, rail, and water transport have been partly responsible for acid
deposition, stratospheric ozone depletion and climate change. Road traffic exhaust
emissions have been the cause of much concern about the effects of urban air quality on
human health and troposphere ozone production (Colvile et al. 2001). Transport is
recognised as a major and growing source of air pollution worldwide. The transport
sector causes increasingly serious pollution and health problems since it is closely
associated with heavy urbanisation and high population densities, especially in
developing countries (Chaaban et al. 2001). As a consequence, throughout the world,
many policies, programs and acts regarding emissions and vehicle standards have
evolved over time. These include the 1970 US Clean Air Act, which in 1975 introduced
the first generation of catalytic converter to reduce vehicle emissions and in 1985
imposed stringent emission standards.
City residents are becoming increasingly aware of the deteriorating quality of life. The
pressure on space, the growing problem of urban pollution and growing differences in
living standards are all making cities increasingly difficult places for planners to
manage and for residents to enjoy. Most developed countries like the USA, Australia,
the UK, and Germany are conducting research programs to achieve sustainable
development. In order to address the sustainability of cities, we need to understand the
forces that shape them. Sustainability planning may require changing the way people
think about and solve transport problems.
Effective implementation of policies related to transport and urbanisation requires a
thorough understanding of the behaviour of people living in urban areas. Responsible
![Page 22: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/22.jpg)
Chapter 1: Introduction to the research
4
authorities would like to optimise policies related to environmental impact and to know
how responsive people are to policy changes.
The United Nations Environment Program (UNEP), established in 1972, works to
encourage sustainable development through sound environmental practices everywhere.
The World Bank states that in some countries the annual losses of productivity due to
environmental degradation have been estimated at 4% to 8% of GDP (The World Bank
2001).
The U. S. Environmental Protection Agency (EPA), one of the leading environment
monitoring authorities in the world, protects human health and the environment through
regulation and voluntary programs such as Energy Star and Commuter Choice. Under
the Clean Air Act, the EPA sets limits on how much of a pollutant is allowed in the air
anywhere in the United States. Although national air quality has improved over the last
20 years, many challenges remain in protecting public health and the environment. The
EPA’s goal is to have clean air to breathe for this generation and those to follow.
Other environmental protection organisations such as the European Environment
Agency (EEA) and the Protection of Human Environment, a sector of the World Health
Organization (WHO), are involved in monitoring environmental impacts and policies
related to the environment.
Since 1975, Environment Australia (EA) (also known as The Department of
Environment and Heritage) has developed a series of measures to protect the
environment. One of the EA national strategies deals with efficient transport and
sustainable urban planning. It states that the actions to be taken by Australia should
include: i) integrated land use-transport planning; ii) travel demand and traffic
management; iii) encouraging greater use of public transport, walking and cycling; iv)
improving vehicle fuel efficiency and fuel technology; and v) sustainable freight and
logistic systems (http://www.deh.gov.au/atmosphere/transport/index.html).
There are also non-government organisations active in developing environmental
policies, making people aware of environmental issues and encouraging them to use
more public transport, cycling, and walking rather than private motor transport.
However, the world is still at risk of a heavily polluted environment in the future.
Unfortunately, when the environmental effects are not obvious, people do not take them
very seriously. However, successful implementation of any policy is subject to human
![Page 23: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/23.jpg)
Chapter 1: Introduction to the research
5
behaviour: “urban planning which reduces the need for motorised travel and encourages
public transport use, and action to influence the behaviour of transport users”1.
Most countries are nowadays concerned about the environmental impact of transport
and are trying to prevent the situation becoming worse. Countries like the USA,
Australia, the UK, Germany, and others, are engaged in formulating policies regarding
the use of public transport and other non-motorised modes in order to reduce emissions
from private transport.
1.4 AIR COMPOSITION AND POLLUTION
According to the Royal Commission on Environmental Pollution (The Committee of
Royal College 1970), pollution is defined as “The introduction by man into the
environment of substances or energy liable to cause hazard to human health, harm to
living resources and ecological systems, damage to structure or amenity or interference
with legitimate use of the environment”. This definition covers a wide range of
pollution including air and water pollution. The pollution created from human activities
is called anthropogenic, while that from animals or plants is called biogenic. We may
have more control over anthropogenic pollution than biogenic.
There is no such thing as “pure air”. Air is a composite of various gaseous components.
Lide (2005) gives the sea-level composition of air (in percent by volume at the
temperature of 15°C and the pressure of 101325 Pa) as presented in Table 1.1. The
main components which form air are nitrogen (78%) and oxygen (21%). Some other
gaseous components exist in the air at very low volumes.
The composition of air varies with meteorological factors and human activities.
Anthropogenic emissions mainly include six common pollutants: carbon monoxide
(CO), nitrogen oxides (NOx), ozone (O3), lead, particles smaller than 10μm (PM10), and
sulphur dioxide (SO2), and also the combined gases called greenhouse gas. Greenhouse
gases include (but are not limited to) carbon dioxide (CO2), ozone (O3), methane (CH4),
nitric oxide (N2O), sulphur hexafluoride (SF6), and chlorofluorocarbons (CFC). These
gases affect human life by contributing to global warming. All of the pollutants have
direct or indirect effects on plants and animals (including humans). A brief description
of health and environmental impacts is given in the following section.
1 Module 5, The National Greenhouse Strategy, The Department of Environment and Heritage, Australia
![Page 24: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/24.jpg)
Chapter 1: Introduction to the research
6
Table 1.1: Sea level air composition
Name Symbol Percent by Volume
Nitrogen N2 78.080000%
Oxygen O2 20.950000%
Argon Ar 0.930000%
Carbon Dioxide CO2 0.031400%
Neon Ne 0.001818%
Methane CH4 0.000200%
Helium He 0.000524%
Krypton Kr 0.000114%
Hydrogen H2 0.000050%
Xenon Xe 0.000009%
Source: Lide (2005)
1.4.1 Health and environmental impact of pollutants
Carbon monoxide (CO) is a colourless and odourless gas that is formed when carbon in
fuel is not burnt completely. It can cause harmful health effects by reducing oxygen
delivery to the body’s organs and tissues. Even a low level of CO can be a major threat
to a heart disease sufferer; a healthy person can be affected in their central nervous
system and respiratory system.
Nitrogen oxides (NOx) is a generic term for a group of highly reactive gases containing
nitrogen and oxygen in varying proportions. They cause a wide variety of health and
environmental impacts, including respiratory problems, damage to lung tissues, and can
even be a cause of premature death. NOx is also one cause of acid rain, water quality
deterioration, global warming, and visibility impairment. NOx is also an ingredient in
ozone formation as discussed below.
Ozone (O3) is a gas composed of three atoms of oxygen. It is not usually emitted
directly into the air, but is created by a chemical reaction between oxides of nitrogen
(NOx) and volatile organic compounds (VOC) in the presence of sunlight and heat. It
can irritate lung airways and cause inflammation much like sunburn. Other symptoms
include wheezing, coughing, and breathing difficulty during outdoor activities.
Repeated exposure to ozone for several months may cause permanent lung damage.
Even a low level of this gas may trigger a variety of health problems, such as asthma,
![Page 25: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/25.jpg)
Chapter 1: Introduction to the research
7
pneumonia, and bronchitis. Other than health problems, this gas has the ability to
damage the leaves of trees and other plants and to reduce crop and forest yields.
Lead is a cumulative poison that can damage human organs, such as kidneys, liver,
brain and nerves. It can also cause mental retardation and behavioural disorders. High
blood pressure and increased heart disease can be caused by excessive exposure to lead.
Lead can enter into the water system through sewage and industrial waste and can cause
reproductive damage to aquatic life.
Particulate Matter smaller than 10µm (PM10) is found in the air and includes dust, dirt,
soot, smoke, and liquid droplets. It causes a wide variety of health and environmental
impacts. Scientific studies have found links between breathing PM10 and a series of
health problems, such as asthma, respiratory symptoms, chronic bronchitis, and even
premature death. PM10 can also create problems for aquatic life and plants. The effect
of particles on health is becoming a matter of serious concern but is outside the scope of
this study.
Finally sulphur dioxide (SO2) is a gas which can dissolve easily in water. It is found to
have similar effects to other pollutants on humans and on plants; in particular,
respiratory problems can be initiated by exposure to SO2. Sulphate particles are the
major cause of reduced visibility in many parts of cities.
All air pollutants discussed have the ability to cause deterioration of human and plant
life. Certainly an increasing amount of these pollutants will have impacts on our regular
activities and on future generations. To deal with these pollutants we need to know
their sources.
1.4.2 Sources of pollutants in Perth
Motor vehicle exhaust contributes about 66%2 of total CO emissions nationwide in the
USA, whereas in Perth, about 82%3 of all CO emissions are from motor vehicles.
Another important consideration in generation of CO is the age of vehicle; the older the
vehicle the higher the contribution to exhaust emission. In the 2004 Australian vehicle
fleet 31% of vehicles were pre-1990 but Western Australia has 34% in this category
(ABS 2004). However Perth is better than Sydney and Melbourne in terms of air
2 2001 figure according to US Department of Transportation 3 2003-2004 figure according to National Pollutant Inventory, Australia
![Page 26: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/26.jpg)
Chapter 1: Introduction to the research
8
quality. All six pollutant levels in Perth were less than in Sydney in 2003-2004 (Figure
1.1). More carbon monoxide was produced in both cities than other pollutants. Air
quality in Perth is far better than some polluted cities such as Mexico, Bangkok and
Mumbai, but Perth was selected for study for several reasons. First, air is polluted
mainly through industrial activities, residential activities, and transport; and since there
are no industrial activities and very few residences in central Perth city, the impact of
transport on air pollution can be measured separately. Secondly, Perth is one of the
rapidly growing cities in the world. The increasing number of cars in use is one of the
main concerns for air quality deterioration. As already noted, cars account for a very
large share of trips.
Carbon monoxide and Volatile Organic Compound (VOC) are major pollutants in Perth
as we can see in Figure 1.1. The nitrogen oxides also contribute to air quality
deterioration. A chemical reaction between VOC and NOx forms ozone; however ozone
is not reported by the National Pollutant Inventory (NPI) of the Department of the
Environment and Heritage, Australia. An indication of ozone formation is given by the
amounts of NOx and VOC.
CO NOx VOC PM10 SO2
0
100
200
300
400
500
600
700
800
900
mill
ion
kg PerthSydney
Figure 1.1: Pollutants emitted in Perth and Sydney airsheds in 2003-04 Source: National Pollution Inventory (NPI) website
![Page 27: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/27.jpg)
Chapter 1: Introduction to the research
9
CO
Solid fuel burning
(domestic)9%
Others3%
Motor Vehicles82%
Burning/ Wildfires
6%
NOx
Biogenics20%
Shipping & Boating
7%
Others6%
Motor Vehicles
67%
VOC
Others27%
Dom/Comm solvents & aerosols
10%Solid fuel burning
(domestic)19%
Motor Vehicles44%
SO2
Motor Vehicles
29%
Others8%
Shipping & Boating
63%
PM10
Solid fuel burning
(domestic)37%
Others5%
Burning/ Wildfires
31%
Motor Vehicles
27%
Figure 1.2: Sources of pollutants in Perth in 2003-2004 Source: constructed from National Pollution Inventory (NPI) data
The mixture of sources of pollutants is illustrated in Figure 1.2 which shows the
proportions of different sources in Perth. Pollutants are generated mainly from human
activities and most are concentrated in urban areas. Figure 1.2 shows that motor
vehicles are the main source of pollutant emissions in Perth. About 82% of CO is
emitted from motor vehicles. Motor vehicles also contribute about 67% of the total
NOx emitted in Perth, the remainder being biogenic 20%, and shipping & boating 7%.
The main sources of PM10 and SO2 are not motor vehicles, though motor vehicles
contribute about 27% and 29% of these pollutants respectively. Solid domestic fuel
![Page 28: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/28.jpg)
Chapter 1: Introduction to the research
10
burn (37%) and wildfires (31%) are two major sources of PM10 in Perth, whereas
shipping (63%) is the major source of SO2 pollution. From 1st January 2002 leaded
petrol was phased out, so that lead is no longer considered one of the major pollutants in
Australia. In the case of VOC, motor vehicles (44%) are the main source followed by
domestic fuel burn (19%).
It is clear that most pollutants are caused by motor vehicles. Conventional cars use
fossil fuel, which produces pollutants during the combustion process. These pollutants
come through the exhaust. Moreover cars also generate emissions through evaporation
from the engine and refuelling losses. The combustion process is discussed in a later
chapter.
The increasing number of vehicles in Perth is a major concern, as well as the increasing
number of vehicle-kilometres-travelled (VKT). Other factors, such as life of vehicles,
cold and hot start of vehicles, fuel efficiency, congestion, and meteorological factors
also influence the concentration of air pollution.
1.5 CLIMATE AND OTHER CHARACTERISTICS OF PERTH
Western Australia (WA) covers one-third of Australia, spreading over 2.5 million
square kilometres. The eastern border is mostly deserted and the west is bounded by
12,500 kilometres of coastline. Perth is located at the south-western corner of WA at
Latitude 31° 57' south and Longitude 115° 51' east and is spread along the coast.
Perth was established in 1829 as the capital city in Western Australia. It is considered
to be the most remote capital city in the world, the closest city Adelaide being 2,200
kilometres away to the east.
The average hours of sunlight each day and rain-free days each year in Perth are more
than in Brisbane, Melbourne, Sydney, Hobart or Adelaide. Perth enjoys pleasant
weather most of the year. However because of the geography of the western coast of
Australia and the effects of Indian Ocean air and water currents, Perth experiences some
more extreme weather than Sydney and Adelaide (which share approximately the same
latitude).
The global climate has changed over the last few decades, in Perth as elsewhere. Figure
1.3 shows monthly variation of temperature averaged over the last 12 years. The
![Page 29: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/29.jpg)
Chapter 1: Introduction to the research
11
highest temperature is observed during January-February and the lowest in July-August.
The bars represent the high-low range of temperature within each month.
Monthly Temperature
0
5
10
15
20
25
30
35
Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec
deg
CAverage
Perth has its highest rainfall during winter and very little rain in summer. However the
last 12 years observation (Figure 1.4) show that rainfall varies significantly during June
and July, with large gaps between high and low levels.
Monthly Rainfall
0
50
100
150
200
250
300
Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec
mm
Mean
Another significant meteorological observation in Perth is wind speed. Figure 1.5
shows that afternoon wind speed is higher than morning wind speed in all seasons.
Figure 1.3: Monthly average temperature in Perth Source: constructed from data from the Bureau of Meteorology, WA
Figure 1.4: Monthly average rainfall in Perth Source: constructed from data from the Bureau of Meteorology, WA
![Page 30: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/30.jpg)
Chapter 1: Introduction to the research
12
Wind Speed
9
11
13
15
17
19
21
Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec
km/h
9am
3pm
Wind direction is another important meteorological observation. Perth has a striking
wind direction feature compared to other cities in Australia. Figure 1.6 shows average
wind direction for the last 2 years at 9 am and 3 pm. In the morning wind flows mainly
from the north-east, which is from inland to the ocean and in the afternoon wind flows
mainly from south-west, which is from the ocean to inland. A somewhat similar feature
is observed in Adelaide, but the opposite is observed in Sydney and Brisbane (Bureau of
Meteorology, http://www.bom.gov.au/climate/averages/wind/selection_map.shtml).
Wind also flows from other directions in the morning and afternoon, but with lesser
frequency.
NE
SESW
NWNE
SESW
NW
Figure 1.5: Monthly average wind speed in Perth Source: constructed from data from the Bureau of Meteorology, WA
Figure 1.6: Average wind direction in Perth at 9am and at 3pm Source: constructed from data from the Bureau of Meteorology, WA
(9 am) (3 pm)
N
![Page 31: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/31.jpg)
Chapter 1: Introduction to the research
13
Geographical location and climate have a significant impact on air quality in Perth.
During winter when wind speed and temperature are low the air pollutants become
trapped near the ground beneath a layer of warm air.
Other than geographical and meteorological characteristics, Perth has its own social
character. The Perth Metropolitan area covers 5,386 square kilometres, comprising only
0.2% of the area of Western Australia, while 72% of the population of WA (1.34
million out of 1.85 million according to the 2001 Census) live in Perth. The 2001
Census reports that 49% of the total population are in the work force and of these 64%
are full time and 36% are part time workers. The 2006-07 State Budget reported that
the unemployment rate was 4.25% in 2005-06. Other social characteristics in 2001
included median age of 34, median weekly individual income of $300-$399, median
weekly household income of $800-$999 and mean household size of 2.6.
One important feature of Perth city is that it has the highest car ownership among
Australian cities. Car ownership in Perth was at least 587 per 1000 inhabitants in 2001,
whereas the figures were 472 in Sydney, 546 in Melbourne, and 533 in Brisbane.
People in Perth generally prefer to use a car to travel to work rather than using other
modes of transport. About 90% of the work force uses car (as a driver or a passenger)
to travel to work, 4% use trains and 6% use buses. Thus Perth is a car dominated city.
1.6 AIM OF THE RESEARCH
To fill the gap in the area of human responses, the study addresses the behaviour of
travellers in order to determine suitable environmental policies. The objectives of the
study are as follows:
• To estimate the air pollution in Perth due to road transport under various
atmospheric conditions;
• To identify potential policies related to pollution and transport;
• To assess the mode choice behaviour of travellers to Perth city, particularly the
factors underlying car choice;
• To estimate the responses of travellers (both commuters and discretionary
travellers) with respect to potential environmental policies using stated
preference methods;
![Page 32: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/32.jpg)
Chapter 1: Introduction to the research
14
• To formulate a composite environment and transport policy by analysing costs
and benefits of implementing the policy.
It has been recognised that effective implementation of environmental control policies is
not easy because the characteristics of environmental systems are uncertain and
externally dynamic (Papakyriazis and Papakyriazis 1998). A ‘suitable’ control policy
must be based on human behaviour. Commuter use of private cars is a central concern
of environmental policy makers. “Among the socio-economic characteristics, age,
income, and education level, seem to be influencing the choice of transit” (Abdel-Aty
2001). This study emphasises the combined use of stated preferences and revealed
preferences methods to derive travellers’ responses in relation to air quality control
policies.
Formulating appropriate solutions to the air quality problem in the Perth airshed is a
major objective. The aim is to identify suitable policies for improving air quality in the
Perth Central Business District (CBD). The research framework is shown in Figure 1.7.
The research is an integrated study conducted through several stages. At Stage 1 the car
pollution model is developed with meteorological and traffic data. Stage 2 involves
assessing likely responses to the proposed measures to limit car pollution using
previously estimated elasticities. The RP model for transport mode selection is
developed at Stage 3 on the basis of the Perth and Regional Travel Survey (PARTS) and
at Stage 4 the SP model is developed from the Car Trip Response Survey 2005. The
questions in this survey were based on the measures to control car pollution subjected to
preliminary testing at Stage 2.
The SP model results are integrated into the RP model and the combined results are
used to predict responses to the proposed measures at Stage 5. Finally at Stage 6 the
study identifies the most appropriate solution to the problem of improving air quality by
calculating health benefits and relating them to the burden that would be imposed on
motorists.
![Page 33: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/33.jpg)
Chapter 1: Introduction to the research
15
1.7 ORGANISATION OF THE THESIS
Chapter 2 deals with previous work on air pollution and travel behaviour. Various
factors influencing the concentration of air pollution in any urban area are identified.
This chapter also reviews the environmental policies implemented in a number of cities
around the world. Chapter 3 describes the air pollution model building process for
Perth city. This pollution model is used later in Chapter 4 and in Chapter 8 to estimate
Figure 1.7: Research framework
Stage 1 Stage 2
Stage 3
Stage 4
Stage 5
Stage 6
Meteorological and traffic data
Car pollution model
Initial response assessment
Previous elasticity estimates
Proposed initial measures to limit car pollution
Integrate SP results into RP model
RP model based on PARTS data
SP model based on Car Trip Response Survey 2005
Full response assessment
Calculation and assessment of health benefits
Proposed final measures to limit car pollution
![Page 34: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/34.jpg)
Chapter 1: Introduction to the research
16
the policy impacts. Chapter 4 identifies the potential measures to reduce air pollution in
Perth city and also presents calculations of the impacts of these potential measures in
terms of air pollution. Chapter 5 then develops a transport mode choice model with RP
data for travellers to Perth city. Chapters 6 and 7 discuss the Stated Preference survey.
Chapter 6 reports the descriptive survey outcomes and the following chapter develops a
binary logit model using discrete choice methods. Chapter 8 integrates the SP model
results into the RP model and then assesses the impact of the policies through benefit-
sacrifice analysis. In this chapter mode choice is simulated using the parameters of the
SP model for the purpose of prediction. Finally Chapter 9 summarises the research and
outlines the findings and their implications.
![Page 35: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/35.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
17
CHAPTER TWO
Previous analysis and policies on air pollution and travel
behaviour
Chapter 1 introduced the research topic on air pollution and transport. The problems
were identified and the direction of research formulated. This chapter gives a global
view of air pollution and transport in Section 2.1. Section 2.2 reviews previous studies
of the health impacts. Then in Section 2.3 air pollution modelling is discussed. Air
pollution control policies implemented in various cities in the world are discussed in
Section 2.4. Relevant studies of travel behaviour are reviewed in Section 2.5.
2.1 APPROACHES TO AIR POLLUTION AND TRANSPORT
Air pollution is a universally recognised challenge faced in the past, the present and the
future. In the bronze and iron ages, settlements were polluted by dust and fumes created
from many sources. Gold and copper were fabricated and clay was kilned and glazed to
produce pottery and bricks (Boubel et al. 1994). People used charcoal as the main
source of fuel at that time; later coal was used. Then at the beginning of the industrial
revolution in the early eighteenth century steam was used to provide the power to move
machinery. During most of the nineteenth century coal was the primary fuel, even
though some oil was used for steam generation late in the century. The leading air
pollution problem of the nineteenth century was smoke and ash generated from coal and
oil burning in power plants, locomotives, marine vessels and in heating houses.
Although smoke and ash were recognised as a problem in the fifteenth century, impacts
on human health and on plants received little attention until very recently. The air
pollution problem can also be projected into the future as more and more fuel is used to
meet the demands of growing population.
Since pollution is recognised as one of the challenges faced by urban populations, a
number of studies have been conducted to address this problem. Anthropogenic
pollution, which is created by people, can be reduced by controlling human activities
and behaviour. According to Weatherley and Timmis (2001) pollutants can be assigned
to seven types: i) nuisance (e.g. noise, odour), ii) toxic, iii) acidifying/atrophying, iv)
photochemical oxidant precursors, v) radio-nuclides, vi) stratospheric ozone depleting
![Page 36: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/36.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
18
substances, and vii) greenhouse gases. Of these, toxic and nuisance pollutants are
familiar in urban areas. The Weatherley and Timmis (2001) study among many others
(Newman and Kenworthy 1999, Nijkamp et al. 2002, Camagni et al. 1998,
Gudmundsson and Hojer 1996, Jones and Lucas 2000) have discussed the urban air
pollution problem and suggested measures to control it. These studies are used to
identify the potential challenges and measures to control air pollution in the Perth case.
The study by Weatherley and Timmis (2001) used an atmospheric management cycle
framework, which explains the factors influencing atmospheric degradation and the
probable means to resolve the problems. Because of the anthropogenic nature of the
pollution, the suggested solutions are mainly regulations and policies which can change
the activities and behaviour of people to reduce pollution generating elements. The
study concluded that developing an accurate quantitative measure of air pollution and
understanding the human health impact of pollutants can lead to the solution of the
problems.
In their book “Sustainability and Cities: overcoming automobile dependence”, Newman
and Kenworthy (1999) discussed sustainability and automobile dependence. After using
a number of cities as examples to show the pattern of auto-dependence, they visualised
the environmental situation with less auto-dependence, and finally sought to promote
urban changes in order to reach sustainability. This was a development of the Newman
and Kenworthy (1996) study on land use and transport. The aims of the 1996 paper
were to analyse the pattern of various cities in relation to land use and transport systems,
identifying problems linked to particular cities, and to evaluate awareness of the
connection between urban land use and transport. The paper compared cities in the
USA, Australia, Europe, and Asia in relation to transport and land use, using Perth as
one of the cases, and concluded that people can use their cars less, even in an
automobile-dependent city. In both of their studies Newman and Kenworthy concluded
that achievement of sustainability is possible from an economic point of view but
difficult from a political point of view. The book (Newman and Kenworthy 1999) is a
good source of comparative descriptions among cities in terms of demography and
transport, but it did not analyse the situation using mathematical models. Relational
models for sustainability and transport would give specific direction in solving
sustainability problems. Nevertheless, this book helps the present study in providing
background on sustainable transport systems from an air pollution point of view.
![Page 37: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/37.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
19
Camagni et al. (1998) analysed sustainable city policies in terms of the economy and
the environment. They identified three ‘environments’: the natural, the artifact, and the
social, and sought to integrate them for effective implementation of policies to achieve
sustainability in cities. A categorisation of positive and negative external effects due to
the interaction of these three ‘environments’ was summarised in their paper. The paper
aimed to identify environmental policies and how to put them into effect but it
essentially reviewed and analysed existing policies without trying to develop an optimal
composite policy.
Gudmundsson & Hojer (1996) dealt with sustainable development principles and their
implications for transport. They analysed ‘sustainability’ and ‘development’ using a
multi-directional concept. Four principles of sustainable development were evaluated –
i) safeguard natural resources, ii) maintain the option value of productive capital, iii)
improve the quality of life, and iv) equitably distribute quality of life. The authors found
that all principles are applicable in relation to transport. The study identified a challenge
in the way of sustainable development by arguing that the different sectors involved in
sustainability are highly integrated with each other. The criteria for sustainable
development for one sector may link to criteria for other sectors and making the entire
process complex. The paper considered only the broader principles of sustainable
development and did not quantitatively validate the effectiveness of the principles.
In another study Jones & Lucas (2000) sought to employ a more integrated approach to
policy appraisal. They identified 28 sustainability indicators related to transport and
suggested the integration of various different government units and departments in order
to achieve successful implementation of environmental policies. However, the paper
did not address the quantification of costs and benefits in appraising the transport
policies. Addressing many objectives to achieve the overall goal may become complex
and would not be practically feasible to implement.
In general a sustainable environment can be ensured by controlling human activities that
lead to air pollution or any other pollution. Many policies or regulations are being tried
in various cities in order to reduce air pollution; however increasing population is
making the implementation of such policies very difficult. Perth is one of the rapidly
growing cities. The human activities in this city, especially motor vehicle use, are
increasing as in other big cities. An accurate estimation of motor vehicle impact on air
![Page 38: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/38.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
20
pollution is required to control air pollution in Perth city and lead to measures to control
motor vehicle use.
2.2 HEALTH IMPACT OF AIR POLLUTION
Increasing recognition of economic and social costs resulting from transport
externalities directs researchers to measure the actual impact of air pollution and other
effects. Taylor and Taplin (1998) reported a BTCE (1996a and 1996b) estimate of
congestion impact in capital cities in Australia of about $2.16 billion per annum, which
does not include the costs associated with air pollution generated as a consequence of
the congestion. Many studies estimated the economic costs of air pollution by
calculating the cost in lives affected by air pollution. Studies like Amoako et al. (2003),
Scoggins at al. (2004), Kunzli et al. (2000), Finkelstein et al. (2003) are recent ones
which discussed the relationships between air pollution and mortality in various urban
areas.
Relative risk is the usual measure to estimate the impact of a harmful event, especially
in medical studies. The relative risk of death is defined as the probability of death due
to the occurrence of an event relative to the absence of that event. Many air pollution
and mortality related studies have reported the relative risk of mortality due to one unit
increase in a specific pollutant. The present study adopts this approach and quantifies
the number of deaths that could have been saved if the pollution levels were reduced by
a certain amount. To achieve this, estimates of relative risk of death due to one unit
increase in CO and NOx are required to quantify the benefit of air quality improvement.
The previous estimates of relative risk of death that are reviewed in this section have
been taken into account in the present study in the assessment of relative risks of death
for one unit increase in CO and NOx in Perth city.
The general health impacts of six major pollutants generated in urban areas were
discussed in Chapter 1. According to the Australian Bureau of Statistics (ABS) 45% of
death in Australia in 2004 was caused by diseases of the circulatory and respiratory
systems, which are to a considerable extent caused by air pollution. The figure was
41% for Western Australia but it rose to 44% for the period between 1997 and 2004.
The Melbourne Mortality Study (2000) was the first conducted in Melbourne to
estimate the association between air pollution (mainly particles, ozone, nitrogen
dioxide, and carbon monoxide) and mortality rate. The study used two methodological
![Page 39: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/39.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
21
approaches in estimating the relative risk (RR) of death associated with air pollution.
These two approaches are trigonometric analysis and a generalised additive model
(GAM). It is argued that the effects of individual pollutants are difficult to separate
from combined effects because of the high correlation between pollutants; the study
addresses this challenge by controlling for other pollutants by fitting the potential
confounding pollutants to the model then fitting the pollutant of interest to the residuals
of that model. This was a rigorous approach to the collinearity problem. The study also
considered seasonal effects on mortality. The results are in terms of estimates of
relative risk of mortality associated with PM10, O3, NO2, and CO. The relative risks of
mortality for CO and NO2 as calculated in the Melbourne Mortality Study (2000) have
been adopted to measure the number of lives that could have been saved if air pollution
were reduced in Perth city. The study is comprehensive in estimating RRs of mortality
due to all causes of death, and also deaths caused by respiratory and cardiovascular
diseases for both the 65+ and below 65 age groups.
Amoako et al. (2003) is another recent study conducted to estimate the economic
consequences of the health effects of transport emissions in Australian capital cities.
The study basically reports the economic impact of health effects in Australian cities
using the Kunzli et al. (2000) estimation of relative risks for a 10μg/m3 increase in
PM10. The health impact of transport emissions was assessed in terms of number of
deaths in all capital cities in Australia. Again the impacts were measured in monetary
terms by using the human capital method, although the study recognised the alternative
willingness to pay method. It finally compares the economic costs of air pollution for
all capital cities in Australia in terms of both mortality and morbidity. Perth ranked fifth
among Australian cities for total cost of health effects of air pollution. This study is a
good source, except that ‘willingness to pay’ is the more appropriate method of
determining the economic impact of air pollution (Deng 2006, Ortuzar et al. 2000,
Johannesson 1996).
Morgan et al. (1998a and 1998b), and Petroeschevsky et al. (2001) reported daily
mortality in Sydney, hospital admissions in Sydney, and hospital admissions in
Brisbane associated with an increase in pollution concentration from the 10th to the 90th
percentile of the average observation. These studies have estimated the relative risks of
mortality or morbidity (hospital admission) with the increase in pollution, using
generalised linear models. The studies also estimated the impacts in terms of
![Page 40: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/40.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
22
cardiovascular and respiratory mortalities. All these studies provide a good
representation of Australian health impacts of increasing air pollution. The estimated
relative risks are used to calculate the average relative risk of mortality for one unit
increase in CO and NOx for the present study.
A few other studies reported relative risks of mortality due to increase in pollution
levels in various cities. Income and air pollution levels are correlated with mortality
rate in southern Ontario (Finkelstein et al. 2003). A similar scenario was analysed in
another study (Finkelstein et al. 2004), where a strong negative relationship was found
between relative risk of mortality and the distance of residence from major roads and
highways. This study also established a link between risk of death and income levels.
A study in China (Chen et al. 2004) found increased risk of mortality and hospital
admission for COPD (chronic obstructive pulmonary disease) with increased air
pollution. The study estimates the relative risk of non-accidental deaths with an
increase in 10μg/m3 of NO2, SO2 and PM10. The present study does not consider the
income effect of mortality simply because of unavailability of data.
2.3 AIR POLLUTION MODELS
Although air quality is also affected by plants and animals, air is polluted mainly by
human activities in urban areas. The main sources are motor vehicles, industrial
emissions, and area-based emissions. Details of these sources in Perth are discussed in
Chapter 3. As was mentioned above, accurate measurement of quantitative
relationships between air pollution and the sources assists in formulating policies to
control air pollution.
For a large urban centre, pollution sources include individual point sources (industry
emissions) and mobile sources (motor vehicles). The combined pollution affects air
masses which spread over hundreds of kilometres. Such an air mass is described as an
urban plume. If the urban plume comes from a point source (emitted from a
smokestack) then estimation follows a Gaussian plume model, whereas if it is from
mobile sources, the estimation of the concentration follows a street canyon model. For
both models meteorological factors, especially wind, influence the concentration of
pollutants. More specifically, the concentration of a plume from a point source depends
on i) the physical and chemical nature of the pollutants, ii) meteorological factors, iii)
location of source relative to physical obstructions, and iv) topological factors that
![Page 41: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/41.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
23
affect air movement. The Gaussian plume model takes all these factors into account to
estimate the pollution concentration coming from point sources. The model is based on
a set of equations describing three-dimensional concentration (Figure 2.1). The three
Gaussian equations are provided in Appendix 2A.
The model assumes that concentrations from a continuously emitting source are
proportional to the emission rate and inversely proportional to the wind speed, and that
the time-averaged pollutant concentrations, vertically and horizontally, are well
described by Gaussian or normal (bell-shaped) distributions (Boubel et al. 1994). The
Gaussian plume equations strictly rely on the ratio of horizontal and vertical standard
deviations of the distributed plume. Apart from industrial application, Gaussian plume
models can be used to estimate pollution concentration in the vicinity of a highway.
However, these models are not directly applicable for small-scale dispersion within an
urban canyon (Vardoulakis et al. 2003).
Vardoulakis et al. (2003) reviewed various air quality models applicable to street
canyons. Air pollution concentrations in an urban street depend on the characteristics of
the street canyon: the canyon geometry, wind flow, traffic volume, and emission factor.
The term street canyon refers to a relatively narrow street with buildings along both
sides. The dimensions of a canyon play a vital role on pollution concentration in the
canyon. The dimensions are width (W), height (H), and length (L) of the canyon.
Depending on the dimensions of the canyon, the wind flow may be described in terms
Figure 2.1: Two cross-sections of a Gaussian plume Source: http://www.rpi.edu/dept/chem-eng/Biotech-Environ/SYSTEMS/plume/gaussian.html
![Page 42: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/42.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
24
of three regimes (Oke 1988). These are isolated roughness, wake interface, and
skimming flows. The wind speed and wind direction relative to the canyon determine
the pollution concentration in the canyon. The street pollution includes the direct
emission from vehicles and the contribution from recirculating air. Details of street
geometry and wind flows are discussed in Chapter 3.
While wind flow determines the dispersion of pollution into the street canyon, traffic
volume and the emission factor are variables determining the pollution concentration.
There are various influences associated with motor vehicles which affect the emission
factor. These are discussed in Section 2.3.4.
In the 1970s air quality modelling started with limited computer resources. With the
increase in computer power the models have improved significantly by including all
types of factors that affect air quality. Such air pollution modelling, especially street
canyon modelling, is relevant to this study in developing an air pollution model for
Perth city in which pollution concentrations follow the canyon effect. The modelling
approach identifies the factors and their impacts on plume concentration.
Vardoulakis et al. (2003) reviewed several air pollution models and tried to categorise
them according to their physical or mathematical principles and their level of
complexity. The study grouped them into statistical, receptor, screening, box, street
canyon, Gaussian, microscale, and urban scale types. The commonly used models
include STREET, OSPM, CAR, CALINE4, and ADMS-Urban. A brief discussion of
the three most relevant models is provided in the following section.
2.3.1 The STREET Model
The STREET model is an empirical model which calculates a series of hourly
concentration at various receptor locations within a street canyon (Vardoulakis et al.
2002). This model, developed by Johnson et al. (1973), assumes that the wind flow at
roof level is perpendicular to the street axis. The pollution concentration (C) on the
roadside consists two components, the background concentration (Cb) and direct
emission from motor vehicles (Cd). The direct emission component was derived from a
simple box model, where pollutants are assumed to be uniformly mixed from ground to
the depth of the boundary layer; source release rates and winds are assumed constant
over the model domain (Kallos 1998). In this model the emission concentration is a
function of emission rate, distance between the source and receptor, canyon geometry,
![Page 43: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/43.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
25
and wind speed, along with some empirical constants. Model details for direct emission
concentration on leeward and windward sides are provided in Appendix-2B.
According to the model, direct emission concentration on the leeward side is higher than
on the windward side. The model shows that if emission rate and wind speed vary,
other factors being fixed, the direct emission concentration on the leeward side is
approximately 2.4 times higher than on the windward side. It also shows that pollution
concentration is directly related to the emission rate and inversely related to wind speed.
In case of a wind parallel or near parallel to the street axis, an average of leeward and
windward concentrations should be calculated to estimate direct pollution concentration.
This model does not take the angle of wind to the street axis into account. It is simple to
estimate and has been used in recent studies like Vardoulakis et al. (2002) and Mensink
et al. (2006).
2.3.2 The OSPM Model
The Operational Street Pollution Model (OSPM) was developed by Berkowicz (1998).
This model estimates the pollution concentration using a combination of the Gaussian
plume model for direct contribution and the box model for recirculating part of the
pollutants in the street (see Figure 3.5 in Chapter 3). The total pollution concentration
(C) consists of direct contribution (Cd), recirculation of air (Cr), and background air
(Cb).
This model is similar to the STREET model. The pollution concentration is estimated
from the number of motor vehicles, average speed of vehicles, dimensions of vehicles,
aerodynamic drag coefficient, dimensions of recirculation zone, angle of wind to the
street axis, vertical fluctuation due to mechanical turbulences along with the factors
mentioned in the STREET model. It is more comprehensive than the STREET model.
In this model it is assumed that a vortex is formed inside the canyon if the wind is not
parallel to the street axis, and the length of the vortex is twice the up-wind building
height. The direct contribution follows the Gaussian model as a function of vertical
fluctuation of emission, emission rate, canyon geometry, and wind speed. On the other
hand the recirculation part of emission is determined by an equation which is practically
identical to the STREET model for the windward side. A significant improvement of
the OSPM over the STREET model is that it takes into consideration the angle of the
![Page 44: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/44.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
26
wind direction to the street axis. Details of the OSPM model are provided in
Appendix-2C.
The pollution concentration estimated on the leeward side is the sum of the direct and
recirculation contributions, but on the windward side only the direct contribution of
emissions generated outside the recirculation zone are taken into account. The OSPM
model has been used in many studies, including Berkowicz (2000), Vardoulakis et al.
(2002), and Mensink et al. (2006), to measure air quality in the urban street canyon. All
of these studies estimated values which were very close to the observed values. The
concept of the OSPM model can be related to the model developed for Perth city. The
present study model parameters can easily be interpreted in terms of the concepts of the
OSPM model as discussed in Chapter 3.
2.3.3 The CALINE4 Model
The CALINE4 model is the latest version of the CALINE series of pollution dispersion
models. Although CALINE4 is able to handle canyon effects, it has been used in
relatively few urban street air quality studies. The model mainly uses the Gaussian
plume theory to simulate the dispersion of pollutants emitted from a line source
(vicinity of a highway). The region directly above the road is called the mixing zone,
which is considered as a zone of uniform emission and turbulence. This model has been
widely used in scientific and engineering applications (Vardoulakis et al. 2003). The
details of this model are not discussed further because of it is less applicable in the street
canyon situation.
While the pollution models emphasise meteorological factors and street geometry,
vehicle emission rate is one of the important inputs to the models. However the vehicle
emission rate depends on a range of factors associated with vehicles. These factors are
discussed in the following section.
2.3.4 Factors influencing vehicle emission rate
Types of vehicles: Different categories of vehicle emit different amounts of pollutants.
Vehicles are categorised differently in various countries depending on size, weight, and
shape. According to Australian Bureau of Statistics (ABS) vehicles are classified as
passenger vehicles, motor cycles, light commercial vehicles, rigid trucks, articulated
trucks, non-freight carrying trucks, and buses. Usually smaller cars produce less
![Page 45: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/45.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
27
emission. In most CBDs, passenger cars generally predominate over other types of
vehicle. Therefore many emission models convert all vehicles to equivalent passenger
car units (PCU).
Types of fuel used: Different types of fuel produce different amounts of emissions. Un-
leaded petrol, diesel, liquefied petroleum gas (LPG), and compressed natural gas (CNG)
are the major types of fuel used to run cars. The different fuel types produce pollutants
in differing quantities. Formerly leaded petrol emitted lead into the air, but from 1st
January 2002 leaded petrol has been eliminated from Australia. Diesel produces more
SO2 than petrol does, whereas petrol produces more CO. On the other hand LPG and
CNG are considered cleaner fuels.
Types of road used by the cars: Road type may influence pollution generation. Four
categories of road are used in urban areas; these are freeway, highway, arterial road, and
local road. The smoothness of road surface and the average speed limit make a
difference to the production of emissions. Rough surface and lower speed generally
produce more pollutants.
Age of the car: Older car generally create more pollution than new cars. New model
cars are usually fitted with improved pollution control equipment. The catalytic
converter was introduced in 1986 to convert harmful pollutants like HC, CO, and NOx
into harmless carbon dioxide (CO2), water (H2O), and nitrogen (N2). At the same time
new cars have better fuel economy which ensures less emission. Very recently
alternative technologies are gaining popularity. One of them is the hybrid car, which
uses gasoline and an electric battery. In urban running, a hybrid car may use as little as
half the petrol used by a comparable conventional car (Australian Government 2003
quoted in Taplin 2004) and the hybrid is a very clean car in terms of pollution creation.
Therefore in emission model building older cars are considered to be greater polluters
than new cars.
Travel pattern: Other than the above mentioned physical factors, behavioural factors
also influence the level of emission. The factors include driving in a congested period,
speed of car, duration of car running, use of air conditioner, and cold-hot start. These
factors result in different rates of pollution production. For example, in a congested
period a car produces more pollution because of low speed and consuming more fuel; a
cold start produces more pollution than a hot start.
![Page 46: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/46.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
28
Vehicle emission models are used by various agencies. The US Environmental
Protection Agency (US EPA) has used a new version of MOBILE6 to estimate emission
rate; the UK Department for Transport uses a version of the EURO model. In Australia,
departments and agencies use various models similar to the MOBILE model. The
Australian Greenhouse Office has developed a methodology for estimating greenhouse
gas. The EPA Victoria uses the Australian Motor Vehicle Emission Factors System
(AusVeh 1.0). Other recognised emission models used in Australia include aaSIDRA
(Akçelik & Besley 2003) emission module and CSIRO power-based (Leung and
Williams 2000) emission model. The present study develops an air pollution model
with traffic as one of the explanatory variables. The coefficient of traffic is converted to
an equivalent emission factor which can be compared with emission factors estimated
by various emission models. The MOBILE6 and AusVeh1.0 emission models are
briefly presented in Appendix-2D.
The air pollution model estimated in this study takes an entirely different approach but a
comparative analysis with models such as MOBILE and AusVeh is discussed in
Chapter 3. The air pollution model quantifies the impact of vehicles on air pollution
concentration in Perth city.
2.4 AIR POLLUTION CONTROL POLICY
A number of policies and regulations are implemented in various cities around the
world to control and manage the use of cars. Different cities use different approaches to
achieve the goal of improving air quality. The following discussion shows that the USA
is more focused on using improved technology vehicles, whereas the UK approach is
more on reducing vehicle kilometres travelled (VKT). In general the air pollution can
be reduced in any city centre, such as the City of Perth, by implementing the following
strategies:
• Reduce private car use, particularly during periods of congestion.
• Discourage private car use in the city.
• Encourage use of public transport and non-motorised modes.
• Encourage people to shift to improved technology vehicles.
The US Environmental Protection Agency (EPA) is an organisation to protect human
health and the environment and, since 1970, it has been working for a cleaner and
healthier environment for the citizen of the USA. The UK is a leader in Europe in
![Page 47: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/47.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
29
implementing policies and regulations to improve the atmospheric environment, with its
policy on transport emissions being to minimise vehicle kilometre travelled (VKT). In
Australia the Department of Transport and Regional Services (DOTARS) is responsible
for managing development of policy and standards on vehicle emissions. It has specific
responsibility for the Australian Design Rules (ADR) related to vehicle emissions. The
first emissions related ADRs were introduced in the early 1970s and have been
gradually made more rigid since then. Moreover, the Australian Greenhouse Office
(AGO 2005), a part of the Department of the Environment and Heritage, develops
programs under the Australian Government’s climate change strategy. One of the aims
of these programs is to ensure transport sustainability in Australia.
Table 2.1: Comparison of key environmental and transport policy approaches
Measures US, EPAa UK, DfTb Australia
Technology Promote cleaner vehicle technology by improving fuel efficiency, alternative fuel vehicles.
Encouraging use of fuel-efficient vehicles, alternative fuel vehicles.
Encouraging use of natural gas (NG) and LPG as alternative fuels.
Pricing Parking cash-out program.
High Occupancy Toll Lanes.
Cordon pricing policy in central London.
Car manufacturing Industry
Introduce the low emission vehicle (LEV) program.
Setting a voluntary target for car manufacturers
Vehicle maintenance
Introduce inspection and maintenance (I/M) program
Fuel consumption labelling.
Green Vehicle Guide program.
Awareness Pollution awareness program
Encouraging public transport.
Walk or cycle to school program.
Emphasising cycling activities.
In-town-without-my-car program
Travel demand management
TravelSmart
Encourage cycling
a Environmental Protection Agency b Department for Transport
![Page 48: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/48.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
30
Table 2.1 gives a comparison of environmental and transport policy approaches. The
policies are categorised into six groups on the basis of the focus of the policy. The
measures deal with technology, pricing, car manufacturing, vehicle maintenance, and
awareness. The comparison of policies adopted by the US EPA, the UK DfT, and
Australia (Table 2.1) mainly shows similarities, yet some policies are different. Details
of the individual policies are discussed in the following sections.
2.4.1 Technology Measures
The US Environmental Protection Agency promotes the use of clean technology rather
than reducing the use of vehicles, engines, or equipment. People need to use vehicles
for mobility and this is seen as an inevitable part of human activity. But the EPA
encourages people to use more alternative fuel vehicles, hybrid vehicles, and vehicles
with good fuel economy. Similarly the UK DfT encourages people to use fuel-efficient
vehicles, hybrid vehicles, and fuel-cell vehicles, which produce less emission than
traditional cars. A program has also been introduced in Australia to increase the use of
alternative fuels, especially natural gas (NG) and liquefied petroleum gas (LPG), in
medium to heavy road vehicles. The technological aspect of environmental policy is
well recognised by all countries.
2.4.2 Pricing Measures
A number of cities have imposed pricing (or taxation) policies to manage travel
demand. Common methods are to impose a charge on car users to enter a city centre or
for travelling on a tolled road. The charge is usually designed to cover the social costs
of vehicle operation. The pricing policy may also impose added charges for workplace
parking. The policy basically discourages people from taking cars to the city. London
has implemented cordon pricing as have some European cities and Singapore.
However, cordon pricing is not applied in American cities, or in Australia, though tolled
roads are common in American cities and in Melbourne and Sydney in Australia.
Another form of pricing measure, used in California is the parking cash-out program,
under which employees are encouraged to earn extra cash by sacrificing their parking
space, so that they leave their car at home. In the 1990s the USA established a Value
Pricing Pilot Program to fund innovative road pricing measures for congestion relief.
One type of measure implemented is High Occupancy Toll (HOT) lanes. The HOT
lanes are an alternative to High Occupancy Vehicle (HOV) lanes that allow vehicles
![Page 49: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/49.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
31
that do not meet occupancy requirements to use the lanes for a toll. This type of
measure is an effective policy to control travel demand, however it is difficult to
implement from a political point of view.
2.4.3 Car Manufacturing Industry Measures
The US EPA has implemented the National Low Emission Vehicle (LEV) program.
Under this program 23 major car manufacturers were required to follow certain
standards on emissions in producing new cars by the model year 1999. The program
also indicated that the proportion of LEV sales should be at least 25% in 2001, 50% in
2002, 85% in 2003, and 100% in 2004 and in later years. This reflects the EPA
emphasis on low emission technology rather than reducing car use. This type of
measure is not adopted explicitly in the UK, nor in Australia. In Australia the National
Average CO2 Emissions (NACE) target is set by the Australian Greenhouse Office
(AGO). According to the NACE target the government arranged with the automotive
industry a voluntary target for fuel efficiency of 6.8L/100km for petrol passenger cars
by 2010. This represents an 18% improvement in the fuel efficiency of new vehicles
between 2002 and 2010.
2.4.4 Vehicle Maintenance Measures
The EPA issued its first guidance for the Inspection/Maintenance (I/M) program in
1978. This guidance addressed the State Implementation Plan (SIP) elements such as
minimum emission reduction requirements, administrative requirements, and
implementation schedules. Under this program vehicle tail pipe exhaust should be
checked in an authorised test stations on a regular basis, and should satisfy the standard
for exhaust emissions. The program also includes an evaporative system test,
centralised annual test, and visual inspection. This original I/M guidance was quite
broad and difficult to implement. Then in 1990 amendments to the Clean Air Act
(CAAA) set more I/M guidance including minimum performance standards for basic
and enhanced I/M programs. It also addressed a range of program implementation
issues, such as network design, test procedures, oversight and enforcement
requirements, waivers, funding, etc. In contrast the UK does not have this form of
regulation to control air pollution.
In Australia mandatory Fuel Consumption Labelling on all new cars sold promotes
consumer demand for fuel efficient vehicles by making comparative model specific
![Page 50: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/50.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
32
information available to buyers. In addition, mandatory CO2 labelling will raise
consumer awareness on reducing greenhouse gas emissions.
2.4.5 Awareness Measures
In Australia the Department of Transport and Regional Services (DOTARS) has
developed measures to raise awareness of the impact of vehicles on the environment by
launching the Green Vehicle Guide website and the requirement for a Fuel
Consumption Label on all new light vehicles. The Green Vehicle Guide provides
ratings on the environmental performance of new vehicles sold in Australia. This
Internet site helps to compare vehicles performance in terms of greenhouse gas and air
pollution emissions. A nationwide environmental awareness program is implemented in
Australia. The Australian Greenhouse Office (AGO) is joining with States, Territories,
local governments and communities to support various approaches to reduce greenhouse
gas emissions from passenger transport in urban areas. This initiative adds to
TravelSmart activities, which are already in operation across Australia. TravelSmart is
an approach which tries to make people aware of the environmental impact of motor
vehicles and of the opportunities available to them personally to use public transport.
They provide information about air pollution associated with the cars and its impact on
health, and encourage people to use alternatives to the private car, especially when
travelling to work or on business. The program encourages people to walk or cycle or
use public transport.
Public awareness has probably been given more attention in the UK than in any other
country. The program encourages people to use public transport or a non-motorised
mode. One of the program activities is the National Cycling Strategy (NCS). The aim
is to establish a culture favourable to the increased use of bicycles for all age groups; to
develop sound policies and good practice; and to seek out effective and innovative
means of fostering accessibility by bike. Furthermore, the cycling activities program
ensures workplace cycle parking facilities priority for cyclists. Apart from this people
are encouraged to follow the “In Town Without My Car” program. This suggests that
people not take a car to the city on a particular day of the year. Its intention is to stop
taking the car to the city every day of the year. In another program students are
encouraged to walk or cycle to school.
![Page 51: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/51.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
33
Most cities in the USA follow a similar environmental awareness program. People are
encouraged to use public transport, cycle, or use another non-motorised mode of
transport, though the main approach to controlling air pollution is to achieve improved
technology.
2.5 AIR POLLUTION CONTROL IN PERTH, WESTERN AUSTRALIA
In Western Australia the Department of Environment introduced the Perth Air Quality
Management Plan (AQMP) in December 2000 to ensure clean air throughout the Perth
metropolitan area. The AQMP is designed to manage air quality in Perth until the year
2029. The key areas addressed by the plan are:
• Health effect research.
• Monitoring, modelling, and research.
• Land use and transport planning.
• Vehicle emissions management.
• Domestic activities emissions.
• Burning emissions management.
• Industry emission management.
• Community information and education.
In the Perth AQMP context, this study indicated measures which would reduce air
pollution in Perth city airshed. Details of these measures are discussed in Chapter 4.
They are price and control measures which can be categorised into four types – fixed
charge, variable charges, parking measure, and lane restriction measure. Since none of
the suggested measures has been implemented in Perth before, a first assessment
(Chapter 4) is based on demand elasticities from other parts of the world. Later chapters
deal with a stated choice survey and the application of the resulting estimates.
A fixed charge would be imposed on a car each time it enters the city centre. This
measure is similar to cordon pricing which has already been implemented in cities such
as Singapore, London, Bergen, Oslo, Trondheim, Stockholm, and tried in Hong Kong.
The fixed charge measure has been assessed on the basis of studies by Luk (1999),
Lettice (2004), Matas & Raymond (2003), and Arentze et al. (2004) which estimated
![Page 52: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/52.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
34
the travel demand elasticities with respect to road tolls. Details of these studies are
discussed in Chapter 4; however some are briefly reviewed here.
Arentze et al. (2004) examined individual behaviour under a congestion pricing
scenario. They conducted an Internet based stated preference experiment to examine
individual adjustments in activity-travel patterns. The study analysed individual choice
data using the multinomial logit function and developed models for work activities and
non-work activities. The study also estimated the price elasticities of travel demand
under a congestion pricing policy, essentially a cordon pricing policy. The estimated
elasticities vary within a range of -0.13 to -0.19 for the entire network, and -0.35 to
-0.39 for congested roads and times. These estimates are used in the present study to
calculate aggregate responses to a fixed charge policy.
Variable charges are imposed on car users according to size of car and time of entering
the city. Records of responses to this type of charge were not available but the effects
are assumed to be similar to variable costs; fuel price elasticities are used in this study.
Some of the previous studies (Taplin et al. 1999, Mayeres 2000, Luk & Hepburn 1993,
Hensher & Young 1990, Button 1993) have been reviewed and their estimated
elasticities are used to calculate average demand elasticity with respect to variable costs.
Among these studies Mayeres (2000) used an applied general equilibrium model to
analyse transport pricing policy, such as fuel tax, to solve transport related problems.
The study formulated a utility model which contains four components: i) the direct
utility from the consumption of the commodities and time use, ii) the utility derived
from the public goods provided by the government, iii) the disutility from emissions,
and iv) the disutility from accidents. The study estimated the marginal external costs of
transport use in terms of air pollution and accidents. These marginal external costs are
used to determine the welfare impact of transport policies suggested in the study.
Finally the study estimated the impact of the policy in terms of percentage change in
traffic flow in peak and off-peak situations. These estimates have been adopted to
calculate average elasticity of travel demand with respect to variable charges.
Many studies (Hensher & King 2001, Hess 2001, Willson & Shoup 1990, Calthrop
2002) have estimated travel demand elasticity with respect to parking charges. Hensher
& King (2001) conducted a study on parking demand and pricing in the Sydney CBD.
The study used a Stated Preference (SP) experiment to explain the behaviour of the
travellers to Sydney CBD. They defined three different parking zones and compared
![Page 53: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/53.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
35
them in terms of travellers’ responses. The results were presented in terms of
elasticities of parking demand with respect to parking fee per hour. Since the study area
was in Australia, it seems appropriate to use its results in assessing travel behaviour in
Perth. Therefore the estimated travel demand elasticity is used to estimate aggregate
response to a proposed Perth parking measure.
Another potential policy considered in this study is lane restriction. A number of
studies (Noland 2001, Noland & Cowart 2000, Fulton et al. 2000, Hensen & Huang
1997) have developed relationships between increasing road capacity and induced
vehicle travel. All of these studies have estimated the elasticities of travel demand with
respect to increased road supply. The present study deals with the inverse of this; it is
tentatively assumed that the elasticities are reversible and can be applied to the
suggested lane restriction measure which would reduce road capacity. Noland (2001)
found that increased road capacity influences traveller’s behaviour in terms of mode
shifts, route shifts, redistribution of trips, and generations of new trips. The study
ultimately estimated elasticity of travel demand in vehicle miles travelled (VMT) with
respect to increased road capacity. A logarithmic transform of VMT was related to a
logarithmic transformation of lane miles (a proxy for cost of travel time) and to
demographic variables. The model is basically a simple form of regression model. The
study estimated the elasticity of vehicle miles travelled with respect to lane capacity as
0.3 to 0.6 in the short run and 0.7 to 1.0 in the long run. These values are used initially
in calculating the average elasticity of travel demand with respect to lane closure.
After estimating the average impact of suggested policies on travel demand, a study
conducted by Taylor and Taplin (1998) is used as a basis to set the actual values for
fixed and variable charges. The study was conducted in the Australian context;
therefore its estimations seem to be appropriate as the base of the charges. The present
study uses Taylor & Taplin (1998) costs figures indexed up to 2004 with the consumer
price index (CPI).
All of these previous studies provide reasonable bases for aggregate measures of the
impact of air quality control policies for Perth city and are used in the first assessment
reported in Chapter 4. However, to know the actual travel behaviour for the travellers
to the Perth city, we need to analyse actual data for Perth city. Consequently in the
present study a stated preference (SP) discrete choice survey was conducted to assess
the actual reaction to the suggested policies (Chapters 6 and 7).
![Page 54: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/54.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
36
2.6 DISCRETE CHOICE ANALYSIS
Discrete choice analysis is an integral part of this study. It is the key to assessing driver
responses to pollution reducing measures. Travel choice has many different aspects
including but not limited to transport mode choice, responses to price changes and
policies, and responses to travel time changes, parking fees and availability of parking
spaces. Travellers’ choices may be observed in their past activities or approached
through their intended activities in the future. The information collected from past
activities is called revealed preference (RP) information. The revealed preference data
is used to analyse travel demand and travel behaviour in the transport research field
(Caldas & Black 1997). On the other hand, when travellers have not encountered a
particular situation their responses to it cannot be observed. However their likely
responses can be assessed through stated preference (SP) information. This involves
setting up some hypothetical situation and finding how they would react in that event.
The approach is appropriate to investigate a new or a hypothetical event (Louviere et al.
2000, Hensher et al. 2005, Ben-Akiva et al. 1991). Limitations to both approaches are
discussed in Chapter 6 in Section 6.2.2. Morikawa (1994) and others (Louviere et al.
2000, Ben-Akiva and Morikawa 1990, Cherchi and Ortuzar 2002) suggested that SP and
RP data should be combined to exploit their advantages and overcome their limitations.
Travellers’ choice or preference data are analysed using discrete choice analysis. The
Multinomial Logit (MNL) function based on utility concepts is used to estimate the
probability of choosing a certain option. The MNL function has been modified and
extended to Nested Logit (NL), Generalised Extreme Value (GEV), Mixed Logit,
Non-normalised Nested Logit (NNNL), and the Heteroscedastic Extreme Value (HEV)
model. As well as the multinomial logit (MNL) and nested logit (NL) models used in
this study to analyse the behaviour of travellers’ to Perth city, a latent class model has
also been used. The nested logit and multinomial logit models are discussed in Chapter
5 where a transport mode choice model is developed for Perth city travellers on the
basis of RP survey data. Chapters 6 and 7 explain the binary logit, panel data, and latent
class models. The following paragraphs give an initial introduction.
Among the case studies discussed by Louviere et al. (2000) one is on the valuation of
travel time savings and urban route choice using SP information for tolled and free
routes. The attributes of the choices were toll and travel time, each attribute having
three levels which gave an orthogonal design of nine choice sets. Five different models
![Page 55: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/55.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
37
were developed with travel time, toll, and their interaction as explanatory variables
along with personal income as a demographic variable. Using these models the study
estimated the value of travel time savings (VTTS) for five groups based on responses to
a $1.00 toll. The study reported the VTTSs for five groups as $4.35 per hour for private
commute, $7.07 for business commute, $4.59 for travel as a part of work, $5.68 for
non-work related travel, and $8.33 for other personal business travel. The present study
has also developed a mode choice model using discrete choice analysis. That model is
used to estimate VTTS for the travellers to Perth city. The study is unable to estimate
VTTS for different groups due to small sample size. However, the estimated VTTS for
all travellers is very close to Louviere et al. (2000) estimations. Details are discussed in
Chapter 5.
Morikawa (1994), an early proponent of the combined SP-RP approach, suggested a
method of correcting correlation effects in SP-RP estimation which was a major
problem in some studies. The theory related to this correction is discussed in Section
6.2.2 in Chapter 6.
A latent class modelling approach to choice problems was introduced by Swait (1994).
The latent class model is essentially another form of nested logit. It is useful for
segmenting respondents by using their explicit choices and unobserved preferences.
The results from the latent class model provide improved classification of respondents
which can be used to target for marketing or other purposes. The present study
developed a latent class model to segment responses to air pollution control policies
(Chapter 7).
![Page 56: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/56.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
38
Appendix 2A
The Gaussian Plume Model
For stable conditions or unlimited vertical mixing the plume concentration is (Boubel et
al. 1994):
]})2/[(]}{)2/[(){/1( 5.02
5.01 zy gguQ σπσπχ = .................................... (2A.1)
Where,
)/5.0exp( 221 yyg σ−=
]/)(5.0exp[]/)(5.0exp[ 22222 zz zHzHg σσ +−+−−=
χ is plume concentration Q is emission rate
u is wind speed
σy is standard deviation of horizontal distribution of plume concentration
σz is standard deviation of vertical distribution of plume concentration
Figure 2A1: The Gaussian Plume Model Source: Boubel et al. 1994
![Page 57: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/57.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
39
L is mixing height
h is physical stack height
H is effective height of emission
x is downwind distance
y is crosswind distance
z is receptor height above ground
For unstable or neutral condition, where σz is greater than 1.6L, the plume concentration is:
)/1]}()2/[(){/1( 5.01 LguQ yσπχ = ..................................................... (2A.2)
For unstable or neutral condition, where σz is less than 1.6L, the plume concentration is:
]})2/[(]}{)2/[(){/1( 5.03
5.01 zy gguQ σπσπχ = .................................... (2A.3)
Where,
∑∞
−∞=
++−++−−=N
zz NLzHNLzHg ]}/)2(5.0exp[]/)2(5.0{exp[ 22223 σσ
![Page 58: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/58.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
40
Appendix 2B
The STREET Model
The following model is taken from Dabberdt et al. (1973).
Pollution concentration (C) on the roadside is shown in equation (2B.1).
db CCC += ............................................................ (2B.1)
Where, Cb is background concentration, and Cd is direct emission from motor vehicles.
The flow of wind in a street canyon is shown in Figure 2B.1.
For the leeward side of the street the direct emission concentration is expressed in
equation (2B.2).
)]()[( 05.022
s
Ld UUhzx
QKC+++
= ................................... (2B.2)
Figure 2B.1: Schematic of cross-street circulation between buildings. Source: Dabberdt et al. 1973
![Page 59: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/59.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
41
Where, K is an empirical constant (K=7) Q is emission rate on the street (gm/s) x is horizontal distance between the receptor and centre of the nearest traffic lane z is height of the receptor h0 is a constant that accounts for the height of initial pollutant dispersion (h0 = 2m) U is roof level wind speed Us is a constant for additional air movement (empirical value is 0.5 m/s)
For the windward side this concentration can be expressed in equation (2B.3).
H
zHUUW
QKCs
Wd
−+
=)(
.................................................. (2B.3)
Where H is the height of the canyon W is the width of the canyon
![Page 60: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/60.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
42
Appendix 2C
The OSPM Model
The following models are taken from Berkowicz (1998).
The total pollution concentration (C) is expressed in equation (2C.1) by adding direct
contribution (Cd), recirculation of air (Cr), and background air (Cb).
brd CCCC ++= ............................................................... (2C.1)
According to Gaussian plume model the direct plume contribution can be estimated by
using equation (2C.2).
FW
QCw
d σπ2
= .................................................................. (2C.2)
Where Q is emission rate on the street (gm/s) W is the width of street canyon F is a factor depending on synoptic wind
σw is the vertical velocity fluctuation due to mechanical turbulence generally by wind and traffic on the street
This vertical velocity fluctuation can be expressed as:
22)( wow u σασ +=
Where α is a constant (empirical value is 0.1) u is the street level wind speed σwo is traffic created turbulence
Again traffic created turbulence can be defined as:
⎟⎟⎠
⎞⎜⎜⎝
⎛=
WNVSbwo
2
σ
Where b is aerodynamic drag coefficient (empirical value is 0.3) N is the number of vehicles on the street per time unit V is the average vehicle speed S2 is the road surface occupied by a single vehicle W is the width of the canyon
![Page 61: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/61.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
43
The contribution from the recirculation zone is estimated using a simple box model,
assuming that the pollutants are well mixed inside the box. The calculation of this
component can be expressed in equation (2C.3).
21 SSttwt
rr uLLUL
LWQC
++=
σ .............................................. (2C.3)
Where Lr, Lt, LS1, and LS2 are the dimensions of the recirculation zone, assuming that the canyon vortex has a trapeze shape.
σwt is the ventilation velocity of the canyon, which can be expressed as:
22)( woroofwt FU σλσ +=
Where U roof level wind speed λ and Froof are proportionality constants given the values of 0.1 and 0.4
respectively
The length of the recirculation zone (Lr) can be defined as:
)sin,min( ψvortexr LWL =
Where Lvortex is the length the vortex ψ is the angle between roof level wind and street axis
![Page 62: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/62.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
44
Appendix 2D
The MOBILE6 Emission Model
The MOBILE6 model was developed by the US Environmental Protection Agency
(EPA). This comprehensive model incorporates many factors which influence emission
rate. It mainly focuses on vehicle performance, fuel performance, and travel pattern.
The algorithm used to estimate running emission rates for different classes of vehicle is
summarised in equations (2D.1) and (2D.2) (EPA 2001).
[Fleet-Ave Emission Rate]veh class = ∑ [Travel Fraction] × {[Linear Emission Rate + Tampering Offset + Aggressive Driving + Air Conditioning] × [Temperature Adjustment] × [Speed Adjustment] × [Fuel Adjustment]} ................... (2D.1)
[Fleet –Ave Emission Rate] = ∑ [VMT Mix]veh class
× [Fleet-Ave Emission Rate]veh class ....... (2D.2)
Where
Travel fraction based on VMT distributions, registration distribution (25 years), and mileage accumulation.
Linear emission rate is historical linear rate of emission.
Tampering offset based on production features of the vehicle.
Aggressive driving considers acceleration rate of the car.
Temperature adjustment is the variation of temperature at testing cycle. Low temperatures range from -7° C to 24° C and high temperatures range from 28° C to 35° C.
Speed adjustment considers different road speed conditions.
Fuel adjustment considers fuel performance, e.g. oxidised, non-oxidised, sulphur level etc.
Age=1
25
veh=1
n
![Page 63: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/63.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
45
The AusVeh 1.0 emission model
The Australian Motor Vehicle Emission Factors System (AusVeh 1.0) has been
developed by EPA Victoria to estimate motor vehicle emissions for states/territories or
nationally in Australia. This model provides the methodology for estimating running
emissions and evaporative emissions for different pollutants and for different types of
vehicles. It is similar to the MOBILE6 model. The methodology (EPA Victoria 2003)
used to estimate running emissions is shown in equation (2D.3).
( ){ }∑ ×××+×=y
ypscfvyfvgfvgpfvo
gpcfvppscfv scrvcvdrefcfef ,,,,,,,,,,,,,,,,,,,, ,min 150 ........ (2D.3)
where ef is average emission factor (g/km),
cf is conversion factor,
efo is base emission factor or zero-kilometre emission (g/km),
dr is deterioration rate (g/1000km²),
cv is average cumulative vehicle kilometre travelled (VKT) (in 103km),
min(cv,150) is minimum of cv and 150,
rv is relative VKT,
sc is speed correction factor,
v is index for motor vehicle type,
f is index for fuel type,
c is index for process,
s is index for speed,
p is index for pollutant,
y is index for year of manufacture, and
g is index for year group.
The conversion factor (cf) is used to convert the emission factor of one pollutant to that
of another. Equation 2D.3 assumes that there is no further deterioration after 150,000
km of travel due to engine replacement (Carnovale et al. 1996). The deterioration rate
(dr) is only applicable for exhaust emission and if it is not entered for a vehicle type,
fuel type and pollutant then it is assumed to be zero. In this case, the base emission
factor is an average emission factor for the vehicle type, fuel type, pollutant, and year
group concerned. If a speed correction factor is not entered for a vehicle type, fuel type,
and pollutant, it is assumed to be 1.
![Page 64: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/64.jpg)
Chapter 2: Previous work on air pollution and travel behaviour
46
The average cumulative VKT and relative VKT are calculated according to equations
(2D.4) and (2D.5).
∑∑==
×=2
1
2
1
y
yyyfv
y
yyyfvyfvgfv nvcvnvcv ,,,,,,,, ....................................... (2D.4)
∑=y
yfvyfvyfv tvtvrv ,,,,,, ................................................................ (2D.5)
Where
nv is number of vehicles
y1 and y2 are the start and end years of the year group between 1965 and 2021
tv is total VKT (106 km/yr)
aiy −=
i is year in that the vehicle commence in use a is vehicle age
![Page 65: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/65.jpg)
Chapter 3: Causal relationships between traffic and air pollution
47
CHAPTER THREE Causal relationships between traffic and air pollution in a
Perth city canyon
Transportation gives people access to goods, services, and activities. On the other hand
it contaminates the environment by producing emissions. Chapter 2 reviewed and
identified the factors that may affect the level of pollution concentration in any urban
area. This chapter first discusses air pollution formation in Perth city and the factors
influencing the concentration and dispersion of pollution. Section 3.3 discusses the
structure of data used in developing an air pollution model. Air quality data,
meteorological data, and traffic data are analysed. Section 3.4 presents the process of
development of pollution models for CO and NOx levels in Perth city. Both ARIMA
and Causal relationship models are developed. Section 3.5 presents a comparative
analysis of the results of the causal model and previously developed models.
3.1 INTRODUCTION
The air around us can be polluted from sources such as on-road vehicles, non-road
engines and equipment, and aircraft. As noted in Chapter 1 surface transport is the
major source of air pollution in most urban areas. The atmosphere is polluted by
various gases and particles, mainly carbon monoxide (CO), nitrogen oxides (NOx),
ozone (O3), sulphur dioxide (SO2), lead, and inhalable particles (PM10 and PM2.5).
Among these, CO and NOx come directly from motor vehicles. These are by-products
of the combustion process in any petrol or diesel vehicle. The chemical reaction of the
combustion process can be generalised in the following expression.
Typical Engine Combustion:
FUEL (C9H20 or C14H30) + AIR (N2 & O2) ⇒ UNBURNED HYDROCARBONS (HC) + NITROGEN OXIDE (NO2) + NITRIC OXIDE (NO) + CARBON MONOXIDE (CO) + CARBON DIOXIDE (CO2) + water (H2O)
All of the by-products other than water can adversely affect the human body directly
and indirectly. A small portion of carbon monoxide reduces the flow of oxygen in the
![Page 66: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/66.jpg)
Chapter 3: Causal relationships between traffic and air pollution
48
bloodstream and is particularly dangerous to a person with heart disease and NOx also
exacerbates respiratory symptoms and cardiovascular diseases. Hydrocarbons, carbon
dioxide and nitrogen oxides are the major contributors to ozone and “greenhouse gas”
formation.
This section of the study explores air pollution in Perth city by developing mathematical
models for CO and NOx concentrations. Before investigating the variability of CO and
NOx concentrations and the causes of variability, we need to consider air pollution
development in Perth city.
3.2 AIR POLLUTION DEVELOPMENT IN PERTH CITY
The air pollution development process in an urban area is not simple and is complicated
by the nature of air flow within city street ‘canyons’. The canyon refers here to a street
channel bounded by high rise buildings on both sides. The factors influencing pollution
concentration in such a canyon are discussed in the following sections.
3.2.1 Factors in the formation of pollutants
The pollution level at any particular location depends on the dispersion process. This
process is complex in a street canyon. The dispersion process is a function of
meteorology, street geometry, receptor location, traffic volume, and emission factor.
All of these have significant impacts on air quality in Perth city.
3.2.1.1 Meteorology
Wind is probably the most obvious factor influencing dispersion of air pollution from
one place to another. Light winds allow emissions to remain close to the source and
accumulate high concentrations. The summer season in Perth is characterised by
prevailing offshore winds in the morning with long period of fine warm weather (Perth
Photochemical Smog Study 1996). A temperature difference between inland and the
sea creates an onshore pressure difference, which leads to a regular sea breeze. This sea
breeze is usually south-westerly. The morning wind flow takes the city’s concentrated
pollution offshore, while the afternoon sea breeze brings it back and adds to the mid-day
emissions.
![Page 67: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/67.jpg)
Chapter 3: Causal relationships between traffic and air pollution
49
In the winter, at night, there are high concentrations of emissions from wood fires and
motor vehicles; these accumulate near ground level. Few variations can be observed in
these processes.
Generally the sea breeze forms at some distance offshore. When the offshore flow is
strong and/or the sea breeze forms close to the shoreline the city’s morning emissions
may be removed from the region. This is illustrated in Figure 3.1.
In contrast when the morning easterly wind is light and/or the sea breeze forms at a
distance offshore, the morning emissions may be trapped in the sea breeze and returned
to the city. The effect is shown in Figure 3.2.
Furthermore, the Perth Photochemical Smog Study (PPSS 1996) reported on other
significant events. The “inland event” and “Kwinana event” are the two most
Morning
Afternoon
Sea breeze
Figure 3.1: Morning emissions lost out at sea
Morning
Afternoon
Figure 3.2: Morning emissions trapped in the city
![Page 68: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/68.jpg)
Chapter 3: Causal relationships between traffic and air pollution
50
significant in relation to pollution concentration in Perth city. The “inland event” has
been identified as morning wind direction between northeast and east and wind speed
inland of 11 km/h or less. Usually (but not always) a low pressure occurs just offshore
and the sea breeze arrives slightly earlier than usual. Because of the northerly
component of morning winds, the sea breeze has more westerly direction than usual,
which ensures that the morning emissions return to the city but are not carried to the
northern suburbs. Figure 3.3 shows the directions for city emission flow and Kwinana
emission flow.
The “Kwinana event” was also observed during the PPSS (1996) study. It is generally
similar to the “inland event” except that there are more southerly morning winds. City
emissions return to the northern suburbs and Kwinana industrial emissions return to the
city region. In this event the afternoon city emission level is augmented by the Kwinana
emission. The afternoon NOx level may be higher than the morning NOx level in the
city, because Kwinana emissions have high levels of NOx. This event is illustrated in
Figure 3.4.
Figure 3.3: Inland event showing emission flows Source: Developed from the study PPSS (1996)
Figure 3.4: Kwinana event showing emission flows Source: Developed from the study PPSS (1996)
![Page 69: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/69.jpg)
Chapter 3: Causal relationships between traffic and air pollution
51
3.2.1.2 Street geometry
A higher level of pollution is observed in a street canyon (Vardoulakis et al. 2003). The
unique feature of street canyon wind flow is the formation of a wind vortex that makes
the direction of wind at street level opposite to the direction of flow above the roof level
(Berkowicz 2000). This is illustrated in Figure 3.5.
Estimation of air pollution from a motor vehicle is not just simple measurement of the
emission factor. Wind flows and street geometry influence the concentration and
dispersion of pollution in street canyons. Total pollution concentration is the
summation of street contribution and background contribution, and again street
contribution includes the direct plume and recirculating air. The pollutants emitted
from traffic in the street primarily move toward the upwind building (leeward side)
while the downwind side (windward) is exposed to background pollution and the
pollution that has recirculated in the street (Berkowicz 2000). Therefore, the pollution
concentration also depends on the dimensions of the street canyon, height (H), width
(W) and the ratio of height to width (H/W), called the aspect ratio. The canyon is
called regular if the aspect ratio is approximately 1; if the aspect ratio is 2 or more the
canyon is called a deep canyon. Other than the height and width, length (L), usually
expressing the road distance between two major intersections, can also influence
pollution dispersion. The street canyon can also be characterised in terms of ratio
Figure 3.5: Schematic diagram of flow and dispersion condition in street canyon Source: Berkowicz 2000
![Page 70: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/70.jpg)
Chapter 3: Causal relationships between traffic and air pollution
52
between length and height (L/H). The canyon can be cubic (L/H = 1), short (L/H ≈ 3),
medium (L/H ≈ 5), or long (L/H ≈ 7). The dimensions of a street canyon are shown in
Figure 3.6.
Hunter et al. (1991) investigated relationships between street geometry and anticipated
types of wind flow. The wind flow regimes in an urban street canyon, classified by Oke
(1988) as isolated roughness, wake interface, and skimming flow, are shown in Figure
3.7.
For a wide canyon (H/W<0.3), the buildings are well apart and act essentially as
isolated roughness elements. In this situation the air flows a considerable distance
Figure 3.6: Dimensions of a street canyon Source: Hunter et al. 1992
Figure 3.7: The flow regimes associated with air flow over building and aspect ratio Source: Oke 1988
![Page 71: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/71.jpg)
Chapter 3: Causal relationships between traffic and air pollution
53
downward from the first building before facing the next one. When the buildings are
more closely spaced (H/W ≈ 0.5) the air flow has inadequate distance to readjust the
flow before facing the next obstacle; this flow is called wake interface. In the case of a
regular canyon (H/W ≈ 1), the major flow skims over the buildings producing skimming
flow. Hunter et al. (1991) reported that for a long (L/H = 7) and somewhat deep (H/W
≥ 2) canyon the anticipated flow would be skimming flow. These approximate to the
relative dimensions of William street canyon in Perth city, where the pollution
monitoring station is located.
3.2.1.3 Perth city pollution monitoring station
The Department of Environmental Protection (DEP) in Western Australia currently
monitors air quality at 10 monitoring stations in Perth. These 10 stations are spread
across the entire metropolitan area. The locations are shown in Figure 3.8.
The station called “Perth” is located at the Queen’s Building in William Street at the
centre of Perth Central Business District (CBD). The exact view of the Queens
Building monitoring station is shown in Figure 3.9. The station has a sampling inlet at
4.4 metres above the kerb (‘4’ in Figure 3.9). The main section of William Street is
about 400 metres (measured from Online Mapping System, City of Perth) between the
intersections at Wellington Street and St. Georges Terrace. The height of the buildings
on both sides of the street averages about 25 metres (although the buildings are
Figure 3.8: Air quality monitoring stations in Perth Metropolitan area Source: The Department of Environmental Protection, WA website
![Page 72: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/72.jpg)
Chapter 3: Causal relationships between traffic and air pollution
54
asymmetric) and the width of the street is about 15 metres (measured from Online
Mapping System, City of Perth). Therefore the approximate dimensions of the William
street canyon are L=400m, H=25m and W=15m. Hunter et al. (1992) reported that for a
deep canyon, like this, air flow would be skimming flow, giving a very low movement
of air at the bottom of the canyon, with a vortex created in the upper part of the canyon.
3.2.1.4 Traffic volume and emission factor
The final factors which affect the pollution concentration and dispersion are traffic
volume and emission rates. In addition to the number of motor vehicles operating in the
city, vehicle speed, density of moving cars, and aerodynamic drag have impacts on
pollution. Details of traffic volume and emissions in Perth city are discussed in section
3.3.3.
All of these factors have been used to develop air pollution models for the urban
canyon. There is a range of mathematical models which are modified to suit the street
geometry. The models include STREET, CAR, OSPM, CFD, UK-ADMS, ADMS-
Figure 3.9: Queens Building monitoring station: [1] monitoring room, [2] nephelometer inlet, [3] PM10 sampler, [4] inlet sample tube
Source: Monitoring Plan for WA 2001
![Page 73: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/73.jpg)
Chapter 3: Causal relationships between traffic and air pollution
55
Urban, and CALINE4 among many others (Vardoulakis et al. 2003). Some of these
were discussed in Chapter 2.
The present study depends entirely on secondary data as there was no opportunity to
experiment in collecting actual wind flow information at the source of emissions.
Therefore the study develops a pollution model for Perth city using available data from
various sources. It establishes relationships between air pollution, especially CO and
NOx, and motor vehicles travelling in Perth city as well as wind speed and direction.
The main objective of this part of the study is to develop and calibrate an appropriate
model for Perth air quality. Effectively, this part of the study is an extension of the
study reported by Siddique (2004). Air quality data were collected from the Department
of Environmental Protection, WA, meteorological data from the Bureau of
Meteorology, and traffic data from Main Roads, WA.
3.3 DATA STRUCTURE
3.3.1 Air quality data
Although Perth has 10 air quality monitoring stations, not all stations record every
pollutant. The only pollution data used in this study was from the Perth monitoring
station in Queen’s Building which monitors CO and NOx every ten minutes.
The National Environmental Protection Measure (NEPM) air quality standard sets 9
ppm (parts per million air volume) for an 8-hour average as the standard for CO
nationwide. Figure 3.10 shows hourly CO level in Perth city for the period from
October 2003 to June 2005. It was found that the NEPM limit was exceeded once when
Perth CBD level of CO reached 12.8 ppm at 2 AM on 17th February 2005.
![Page 74: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/74.jpg)
Chapter 3: Causal relationships between traffic and air pollution
56
0
1
23
4
5
67
8
9
10
1112
13
14
Oct
Nov
Dec Ja
n
Feb
Mar
Apr
May Ju
n
Jul
Aug
Sep Oct
Nov
Dec Ja
n
Feb
Mar
Apr
May Ju
n
hourly (Oct 2003 to June 2005)
ppm
Although average hourly CO level in Perth is currently within the NEPM limit most of
the time, increasing car use will cause the level to rise. According to the Perth
Metropolitan Transport Strategy 1995-2029 (State Government of WA 1995), average
personal car travel to work or business was 8.4 kilometres in 1991 and this increased to
12.6 km in 2004 (according to the Perth and Regional Transport Survey data).
The other pollutant considered in this study, nitrogen dioxide (NO2), is a brown gas,
most being transformed from nitric oxide (NO) contained in emissions. These two
nitrogen oxides are recorded in the Perth monitoring station. In an urban area, motor
vehicle emissions along with industrial boilers and furnaces are the major source of
NO2. There are two primary standards for ambient NO2 in Australia. One is a 1-hour
average of 0.12 ppm (12.0 pphm) (parts per hundred million air volume) and another is
a 1-year average of 0.03 ppm (3.0 pphm). Figure 3.11 shows the hourly average NO2
level in Perth from October 2003 to June 2005; during that period, the level exceeded
the standard once to 0.16 ppm at 1 PM on 8th March 2004. The yearly averages for
three years were 0.02, 0.01, 0.02 ppm in 2003, 2004, and 2005 respectively. Data are
not available for the month of January 2005.
Figure 3.10: Hourly CO level in Perth City from October 2003 to June 2005
NEPM standard
![Page 75: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/75.jpg)
Chapter 3: Causal relationships between traffic and air pollution
57
0
2
4
6
8
10
12
14
16
18
Oct
Nov
Dec Ja
nFe
bM
arA
prM
ay
Jun
Jul
Aug
Sep Oct
Nov
Dec Ja
nFe
b
Mar
Apr
May
Jun
hourly (Oct 2003 to June 2005)
pphm
Nitric oxide (NO) gas is also generated from combustion. It has an open shell
configuration, which makes it very reactive and unstable. In air this gas reacts quickly
with oxygen to form nitrogen dioxide (NO2). During the vehicle combustion process a
greater volume of NO is produced than NO2 but it disappears very soon. The study
considers NOx as a summation of NO2 and NO for the purpose of model development.
Transportation contributed 47% of NOx in USA in 2001 (US Department of
Transportations 2003), whereas it contributed 68% (in year 2003-2004) in Perth (NPI
website). The level of NOx in Perth city for the period between October 2003 and June
2005 is shown in Figure 3.12.
0
10
20
30
40
50
60
Oct
Nov
Dec Ja
n
Feb
Mar
Apr
May
Jun
Jul
Aug
Sep
Oct
Nov
Dec Ja
n
Feb
Mar
Apr
May
Jun
hourly (Oct 2003 to June 2005)
pphm
Figure 3.11: Hourly NO2 level in Perth City from October 2003 to June 2005
Figure 3.12: Hourly NOx level in Perth City from October 2003 to June 2005
NEPM standard
![Page 76: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/76.jpg)
Chapter 3: Causal relationships between traffic and air pollution
58
The maximum level of NOx was 53.4 pphm at 11 PM on 17th June 2005. There is no
national standard set for NOx in Australia.
Figures 3.10, 3.11, and 3.12 show overall variation of hourly CO and NOx levels in
Perth city for the period between October 2003 and June 2005. Hourly variation of CO
and NOx in an average day is shown in Figures 3.13 (a) and (b).
0.0
0.2
0.4
0.6
0.8
1.0
1.2
1.4
100
300
500
700
900
1100
1300
1500
1700
1900
2100
2300
hour
ppm
0
2
4
6
8
10
12
14
16
100
300
500
700
900
1100
1300
1500
1700
1900
2100
2300
hourpp
hm
Maximum levels of CO and NOx are reached in the afternoon at around 6 PM in Perth.
Although there is a peak in the morning at around 9 AM, it is not to the level of the
afternoon peak. This disparity in peaks can be due to a range of reasons, which are
discussed later.
3.3.2 Meteorological data
Although motor vehicles are the major cause of air quality deterioration, temperature,
wind speed, wind direction, rainfall, humidity, and hours of sunshine can modify the
concentration of any pollutant. To build a relationship between air pollution and
meteorological factors, the data should be collected from the same geographical
location. However, there was no opportunity to set up an experiment which could
ensure data collection from the same location. Therefore the study had to rely on the
data collected from the closest weather station.
Air temperature is an important factor in the chemical process leading to the formation
of ozone from nitrogen oxides in the presence of sunlight. The levels of CO and NOx in
the outdoor air are typically higher during the colder months of the year when inversion
(a) CO (b) NOx
Figure 3.13: Hourly variation in an average day in Perth city (a) for CO, and (b) for NOx Source: Constructed from the data provided by Department of Environmental Protection, WA
![Page 77: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/77.jpg)
Chapter 3: Causal relationships between traffic and air pollution
59
conditions are more frequent. Air pollutants become trapped near the ground beneath a
layer of warm air. Though CO and NOx levels are low during summer (December-
February) the high temperatures may lead to high ozone concentrations. Figure 3.14
shows monthly variation of pollution levels with air temperature and wind speed.
0.0
5.0
10.0
15.0
20.0
25.0
30.0
Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec
NO
x (p
phm
), Te
mp
(C),
Spee
d (k
m/h
)
0.0
0.1
0.2
0.3
0.4
0.5
0.6
0.7
0.8
0.9
CO
(ppm
)
Wind speed
Temperature
NOx
CO
Wind speed and direction influence the distribution of CO and NOx in Perth. The city is
located close to the sea; therefore a strong wind from the sea blows away most of the
pollutants. It was mentioned before that the morning wind blows the morning
emissions of the city offshore, and the afternoon sea breeze brings it back and adds to
the midday emissions. Thus direction and speed of the wind are factors determining
pollution concentration and dispersion. In this study, all wind directions were
categorised as North-East, South-East, South-West, or North-West. Figure 3.15 shows
a Perth map with wind directions.
Figure 3.14: Monthly average Temperature, wind speed and pollution level in Perth city over 2003 to 2005
Source: Constructed from the data provided by Department of Environmental Protection, WA
![Page 78: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/78.jpg)
Chapter 3: Causal relationships between traffic and air pollution
60
3.3.3 Traffic data
Main Roads WA records traffic count data from various roads throughout the Perth
metropolitan area. Many of the traffic counts are intermittent but some are done on a
continuous basis. Main Roads records traffic counts every 15 minutes at most of the
traffic lights in the city area. The study combines the traffic counts (passenger car units)
of 10 intersections close to the Perth air quality monitoring station and uses the data on
an hourly basis. Traffic data was collected for the period between October 2003 and
March 2004. According to Main Roads WA this huge data set is stored on a six-month
basis. They could only provide the data for this period.
0
5000
10000
15000
20000
25000
30000
100
200
300
400
500
600
700
800
900
1000
1100
1200
1300
1400
1500
1600
1700
1800
1900
2000
2100
2200
2300
2400
hour
num
ber
weekdayweekend
Figure 3.15: Wind directions in Perth
Figure 3.16: Average hourly traffic in the city for the period between October 2003 and March 2004
Source: constructed from the data provided by Main Roads WA
![Page 79: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/79.jpg)
Chapter 3: Causal relationships between traffic and air pollution
61
Hourly average traffic volumes in the city differ between weekdays and weekends as
shown in Figure 3.16. On weekdays there are two peaks, one at around 9 AM and
another at about 6 PM. People come to the city in the morning for work and leave at
around 6 PM during weekdays. Between the peaks people may come for other
purposes, such as shopping and personal business. In contrast, the weekend days have
only one peak in the middle of the day, and this peak is far less than the weekday peaks,
indicating that fewer people go to the city during weekends.
3.4 AIR POLLUTION MODEL
This study builds models of air pollution for CO and NOx levels based on data for the
period between October 2003 and March 2004 in which traffic data were available. The
fluctuations of CO and NOx levels for a two-week period in late October ‘03 and
another in late December ’03 are shown in Figure 3.17. Both CO and NOx vary during
a day and it is evident that weekend (last two peaks in panel (a) and last 4 peaks for
Christmas holidays in panel (b)) levels are lower than weekday levels.
00.20.40.60.8
11.21.41.61.8
2
100
1000
1900 40
013
0022
00 700
1600 10
010
0019
00 400
1300
2200 70
016
00 100
1000
1900
hour (20-26 Oct, 2003)
CO (ppm)
0
5
10
15
20
25
30NOx (pphm)
CONOx
(a)
0
0.5
1
1.5
2
2.5
3
100
1000
1900 40
013
0022
00 700
1600 10
010
0019
00 400
1300
2200 70
016
00 100
1000
1900
hour (22-28 Dec, 2003)
CO (ppm)
0
5
10
15
20
25
30
35NOx (pphm)
CONOx
(b)
The variation of the CO and NOx levels can be explained through mathematical models.
This study attempts to explain the variations of CO and NOx levels in Perth city within
an atmospheric pollution modelling framework using multivariate statistics. Two types
of models are developed and compared: ARIMA (autoregressive null relationships) and
multiple regressions (causal relationships) models.
Figure 3.17: Pollutant levels for a) a week in late October ’03, and b) a week in late December ‘03
![Page 80: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/80.jpg)
Chapter 3: Causal relationships between traffic and air pollution
62
3.4.1 ARIMA Model
Autoregressive Integrated Moving Average (ARIMA) models are used to establish
relationships between predicted variables and the same variables in previous periods.
This modelling approach is especially suitable when little or no information on causal
relationships is available. They are used in this case to estimate the extent to which
pollution can be explained in terms of lagged values, before traffic is taken into account.
The present study considers both hourly CO and NOx levels related to the levels for the
previous 16 hours. Two separate daily models were developed for CO and NOx levels.
After preparing the datasets, an estimation of ARIMA model parameters (p=order of the
autoregressive part, d=degree first differencing involved, and q=order of the moving
average part) is required. To estimate these parameters we need to determine an
autocorrelation function (ACF) and partial autocorrelation function (PACF). Mainly
the shapes of ACF and PACF are used to determine the parameters. The study
examines these functions for 16 lagged periods. Figure 3.18 shows ACF and PACF for
CO with lag periods.
ACF - CO
Lag Number
16151413121110987654321
ACF
1.0
.8
.6
.4
.2
.0
-.2
-.4
-.6
PACF - CO
Lag Number
16151413121110987654321
Parti
al A
CF
1.0
.8
.6
.4
.2
.0
-.2
-.4
-.6
-.8
-1.0
ACF and PACF cannot be used to determine the parameters at this stage as the shapes
do not convey any decisive information. The ACF moves in a sine-wave manner,
therefore it is not possible to determine the values of the parameters. The next step is
differencing data at the first order level. The shapes of ACF and PACF after first order
differencing are shown in Figure 3.19.
Figure 3.18: ACF and PACF for CO levels for 16 hour lag periods
![Page 81: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/81.jpg)
Chapter 3: Causal relationships between traffic and air pollution
63
ACF - 1st differencing CO
Lag Number
16151413121110987654321
ACF
1.0
.8
.6
.4
.2
.0
-.2
-.4
-.6
-.8
-1.0
PACF - 1st differencing of CO
Lag Number
16151413121110987654321
Parti
al A
CF
1.0
.8
.6
.4
.2
.0
-.2
-.4
-.6
-.8
-1.0
At this stage it is possible to determine the parameters of the model. Autoregressive
order (p) will be 1 as the correlation of the first lag period is significantly higher than
other correlations, moving average order (q) will also be 1 because of a similar shape of
PACF and the differencing parameter is 1 as we use first difference data. However,
Figure 3.19 shows a diurnal (‘seasonal’) effect as the 12th period lag has a spike on both
ACF and PACF. Therefore another model with ‘seasonal’ difference was developed as
well. Two models of ARIMA (0,0,0)(1,1,1) for ‘seasonal’ difference and ARIMA
(1,1,1) with first order difference are compared and the results are shown in Table 3.1.
Table 3.1: Comparative results of ARIMA models for CO level
Model Log likelihood
AICa SBCb R2 MSEc
ARIMA (000) (111), ‘seasonal’ -2088.15 4182.31 4201.39 0.42 0.19
ARIMA (111), ‘non-seasonal’ -898.01 1802.03 1821.13 0.64 0.16a AIC is Akaike’s Information Criterion. AIC=-2 log L + 2m, where m=(p+q+P+Q) where p and q are
as above; P=seasonal part of autoregressive order and Q=seasonal part of moving average order (Makridakis et al. 1998)
b SBC is Schwarz Bayesian Criterion. SBC=-2Log L + k Log(n), where k is number of parameters and n is number of observations (Brockwell and Davis 1996) .
c MSE is Mean Square Error, the average of squared differences between actual and predicted values. Lower absolute values of Log likelihood, AIC, SBC, and MSE and higher R2 indicate a
better model. Therefore the ARIMA (111) model (‘non-seasonal’ difference) is a better
predictor of CO level in Perth than the ARIMA (000)(111) model with ‘seasonal’
difference. The detailed ARIMA (111) model is provided in Appendix-3A. Another
way of assessing the model’s fit is to examine residual plots. The ‘non-seasonal’ model
Figure 3.19: ACF and PACF after first differencing of CO levels for 16 hour lag periods
![Page 82: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/82.jpg)
Chapter 3: Causal relationships between traffic and air pollution
64
(panel b) data series looks more stationary than ‘seasonal’ model (panel a) in Figure
3.20.
-6.000
-4.000
-2.000
0.000
2.000
4.000
6.000
resi
dual
for
CO
from
AR
IMA
(000
)(11
1)l
(a)
-6.000
-4.000
-2.000
0.000
2.000
4.000
6.000
resi
dual
for C
O fr
om A
RIM
A (1
11)
(b)
A similar investigation was conducted for NOx model building. ACF and PACF for the
NOx dataset after first differencing are shown in Figure 3.21.
ACF - 1st differencing of NOx
Lag Number
16151413121110987654321
ACF
1.0
.8
.6
.4
.2
.0
-.2
-.4
-.6
-.8
-1.0
PACF - 1st differencing of NOx
Lag Number
16151413121110987654321
Parti
al A
CF
1.0
.8
.6
.4
.2
.0
-.2
-.4
-.6
-.8
-1.0
The shapes of ACF and PACF indicate that the values of both autoregressive and
moving average parameters are one, although it may be argued that the series needs
‘seasonal’ differences as the 12th period lag has the highest spikes. Therefore, the study
again compared two models with ‘seasonal’ difference and ‘non-seasonal’ difference.
Table 3.2 shows the comparative results for the models and Figure 3.22 shows residual
plots of these models. Most of the numerical values for the NOx model are higher than
the CO model because the data set used is in pphm compared to ppm for CO.
Figure 3.21: ACF and PACF after first differencing of NOx levels for 16 hour lag periods
Figure 3.20: Residual plots for a) ‘seasonal’ model and b) ‘non-seasonal’ model
![Page 83: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/83.jpg)
Chapter 3: Causal relationships between traffic and air pollution
65
Table 3.2: Comparative results of ARIMA models for NOx level
Model Log likelihood
AIC SBC R2 MSE
ARIMA (000)(111), ‘seasonal’ -12361.49 24728.99 24748.06 0.48 23.9
ARIMA (111), ‘non-seasonal’ -10665.67 21337.35 21356.44 0.68 17.2
-30.000
-20.000
-10.000
0.000
10.000
20.000
30.000
resi
dual
for N
Ox
from
AR
IMA(
000)
(111
)
(a)
-30.000
-20.000
-10.000
0.000
10.000
20.000
30.000
resi
dual
for N
Ox
from
AR
IMA
(111
)
(b)
Table 3.2 and Figure 3.22 indicate that the ‘non-seasonal’ model is a better model to
estimate the level of NOx. The detailed ARIMA (111) model for NOx is provided in
Appendix-3B.
In summary, the ARIMA models established the extent to which CO and NOx pollution
can be explained as functions of their own previous values. Although it is possible to
achieve some prediction of CO and NOx levels in Perth city using ARIMA, these are not
causal models. However the estimates indicate the strength of the lagged relationships
which must be taken into account in the causal models which incorporate traffic.
3.4.2 Causal Model
The development a functional relationship between hourly levels of CO and NOx and
traffic volume in Perth city is based on the fact that the major contributors to air
pollution in the urban area are motor vehicles. Figure 3.23 shows the fluctuation of
traffic and CO level in (a) and NOx level in (b). The morning peaks for CO and NOx do
not match the level of the traffic peak, though afternoon peaks follow the traffic level.
The probable reasons are:
Figure 3.22: Residual plots for a) ‘seasonal’ and b) ‘non-seasonal’ models of NOx
![Page 84: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/84.jpg)
Chapter 3: Causal relationships between traffic and air pollution
66
i) Accumulation of air pollution, emission in the morning hours being
accumulated throughout the day and dropping after traffic falls back in the
afternoon,
ii) The cold start effect, which means that in the afternoon, despite warm
ambient temperature, the engines of the parked cars are started before
leaving the city, thus generating more emissions at that time (Joumard and
Serie 1999).
iii) Finally, there could be some effect of wind flows; as discussed before, the
afternoon sea breeze brings back morning emissions which were taken
offshore by the morning wind.
0.0
0.2
0.4
0.6
0.8
1.0
1.2
1.4
100
300
500
700
900
1100
1300
1500
1700
1900
2100
2300
hour
ppm
0
5000
10000
15000
20000
25000number
CO Traffic
0.0
2.0
4.0
6.0
8.0
10.0
12.0
14.0
16.0
18.0
100
300
500
700
900
1100
1300
1500
1700
1900
2100
2300
hour
pphm
0
5000
10000
15000
20000
25000
number
NOx Traffic
This study identified numbers of variables which could explain the variation of hourly
CO and NOx level in Perth. It identified hourly traffic, wind speed, previous period’s
wind speed, cross product of wind direction (as dummy variables) and previous
period’s wind speed, and cross product of previous period’s wind speed and previous
period’s pollution level as explanatory variables. A series of regression models was
developed with different combinations of explanatory variables. Wind speed and
direction for the same period and previous period were the main causal variables for
accumulation of pollution. Wind speed and direction are measured at roof top level, not
at street level. Traffic is the main causal variable for the generation of pollution. As was
discussed in Chapter 2, in a deep and medium length canyon, like William Street where
Figure 3.23: Traffic and a) average hourly CO level, b) average hourly NOx level in Perth city during Oct 2003 to Mar 2004
Source: Constructed from the data provided by Department of Environmental Protection, WA and Main Roads WA
(a) CO (b) NOx
![Page 85: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/85.jpg)
Chapter 3: Causal relationships between traffic and air pollution
67
the receptor is located, a skimming wind flow could be anticipated with a very low air
movement at the bottom of the canyon. Therefore, wind speed experienced at the
downwind building would be relatively higher than roof top wind speed (Hunter et al.
1991).
Tables 3.3 and 3.4 show the matrices of correlations between pollutants and
independent variables. Traffic and south-west wind are highly correlated with pollution
levels.
Table 3.3: Correlations between CO & explanatory variables (bold shows higher correlation)
Traffic Wind Speed
North-East wind
direction (dummy1)
South-East wind
direction (dummy2)
South-West wind direction (dummy3) CO
Traffic 1
Wind Speed 0.438 1 North-east wind direction (dummy1) -0.139 -0.277 1 South-east wind direction (dummy2) -0.221 -0.171 -0.358 1 South-west wind direction (dummy3) 0.319 0.412 -0.376 -0.620 1
CO 0.664 0.220 -0.168 -0.440 0.507 1
Table 3.4: Correlations between NOx & explanatory variables (bold shows higher correlation)
Traffic Wind Speed
North-East wind
direction (dummy1)
South-East wind
direction (dummy2)
South-West wind
direction (dummy3) NOx
Traffic 1
Wind Speed 0.438 1 North-east wind direction (dummy1) -0.139 -0.277 1 South-east wind direction (dummy2) -0.221 -0.171 -0.358 1 South-west wind direction (dummy3) 0.319 0.412 -0.376 -0.620 1
NOx 0.724 0.276 -0.179 -0.418 0.520 1
The correlation matrices show individual variables, not cross-products. The correlation
matrices for variables in cross-product form are very similar (not shown here). The
regression model uses cross-products of wind speed and the dummy variables for wind
directions. The direction of wind provides better information when taken in conjunction
![Page 86: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/86.jpg)
Chapter 3: Causal relationships between traffic and air pollution
68
with wind speed in relation to the estimation of pollution level. In the ARIMA model
section it was recognised that the previous period’s pollution level influences the
present period’s pollution level. The causal model also uses the cross-product of
previous period wind speed and previous period pollution level. This cross-product
would explain the combined effect of static pollution level and the diffusion process.
Most of the explanatory variables used in the regression modelling are cross-products
for the previous period. One of the four wind directions (North-West) was omitted. A
North-West wind is not very common in Perth city.
Different models were developed using the same sets of variables and goodness of fit
was compared. The initial model (CM1CO) was developed with a linear relationship
between hourly CO level as the predicted variable and the explanatory variables. It was
found that the data set needs to be made stationary around the mean and variance.
Hence the model was further modified in two stages. The second model (CM2CO) was
developed with first difference of CO as the predicted variable, keeping the explanatory
variables unchanged. Later the study examines non-linearity in the relationship. A
further model (CM3CO) was developed with logarithmic transformation of CO level
and keeping explanatory variables unchanged except that traffic was logarithmically
transformed. Details of CM1CO and CM3CO models are provided in the Appendix-3C
and CM2CO model is discussed below. The R2 and MSE are calculated using actual
and predicted values for the three models so that the models are directly comparable. A
comparative analysis of model fit is shown in Table 3.5.
Table 3.5: Comparative results of regression models for CO calculated with actual and predicted values
Model R2 MSE DPa NPb
Linear model (CM1CO) 0.65 0.11 4215 7
Linear model with first difference of CO (CM2CO) 0.68 0.11 4208 7
Non-linear model (CM3CO) 0.63 0.13 3924 7 a DP = Data point b NP = Number of parameters
The CM2CO model gives a high R2 and low MSE. Furthermore, as noted by Harvey
(1980), a first difference model yields a better estimator of β than a model using
aggregates. This model is also justified by observing the residual plots which shows
![Page 87: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/87.jpg)
Chapter 3: Causal relationships between traffic and air pollution
69
that CM2CO has a more stationary data series than other models (Figure 3.24). The
residual plot for CM2CO has higher proportion of cases lies within ±0.5 ppm.
-6.0
-4.0
-2.0
0.0
2.0
4.0
6.0re
sidu
al fo
r CO
from
CM
1CO
-6.0
-4.0
-2.0
0.0
2.0
4.0
6.0
resi
dual
for C
O fr
om C
M2C
O
-6.0
-4.0
-2.0
0.0
2.0
4.0
6.0
resi
dual
for C
O fr
om C
M3C
O
Figure 3.24: Residual plots for models (a) CM1CO, (b) CM2CO, and (c) CM3CO
(a) Model: CM1CO
(b) Model: CM2CO
(c) Model: CM3CO
Proportion of cases within ±0.5 ppm = 95%
Proportion of cases within ±0.5 ppm = 95%
Proportion of cases within ±0.5 ppm = 94%
![Page 88: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/88.jpg)
Chapter 3: Causal relationships between traffic and air pollution
70
The CM2CO model results are shown in Table 3.6.
Table 3.6: Coefficients of the explanatory variables for first difference of hourly CO
level
Un-standardised
Coefficients Standardised Coefficients t-ratio Sig.
B Std. Error Beta (Constant) -0.1061 0.0146129 -7.33 0.000Wind speed -0.0040 0.0015764 -0.109 -5.05 0.000Previous period’s wind speed 0.0210 0.0025470 0.406 12.02 0.000Previous period’s north-east wind speed -0.0163 0.0022169 -0.200 -8.44 0.000Previous period’s south-east wind speed -0.0159 0.0020899 -0.317 -10.61 0.000Previous period’s south-west wind speed 0.0059 0.0020615 0.059 1.56 0.119Cross product of previous period’s wind speed and previous period’s CO level -0.0326 0.0008909 -0.979 -41.32 0.000
Traffic (in ‘000) 0.0263 0.0000008 0.508 29.55 0.000Dependent Variable: First difference of CO level in parts per million F-statistic = 1999.37, df=4201
The un-standardised coefficient for traffic is very small in value which is due to the
large actual value of traffic as compared to the very small value of CO. The Beta
coefficient gives a relative measure of the traffic effect.
A similar process was followed for NOx (in parts per hundred million) model
development. It was found that the first difference of NOx level can be explained by the
same explanatory variables as those used in CO modelling. As in the CO modelling,
two other models were developed with actual NOx level (CM1NOx) and Logarithmic
transformation of NOx (CM3NOx), however CM2NOx is the best of these models.
Model fit results are shown in Table 3.7 and residual plots are in Figure 3.25 for the
three models.
Table 3.7: Comparative results of regression models for NOx calculated with actual and predicted values
Model R2 MSE DPa NPb
Linear model (CM1NOx) 0.72 11.4 4210 7
Linear model with first difference of NOx (CM2NOx) 0.75 11.5 4210 7
Non-linear model (CM3NOx) 0.71 11.7 4159 7 a DP = Data point b NP = Number of parameters
![Page 89: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/89.jpg)
Chapter 3: Causal relationships between traffic and air pollution
71
The CM2NOx model is best among these three with a high R2 and reasonably low mean
square error.
-30.0
-20.0
-10.0
0.0
10.0
20.0
30.0re
sidu
al fo
r NO
x fro
m C
M1N
Ox
-30.0
-20.0
-10.0
0.0
10.0
20.0
30.0
resi
dual
for N
Ox
from
CM
2NO
x
-30.0
-20.0
-10.0
0.0
10.0
20.0
30.0
resi
dual
for N
Ox
from
CM
3NO
x
Figure 3.25: Residual plots for models (a) CM1NOx, (b) CM2NOx, and (c) CM3NOx
(a) Model: CM1NOx
(b) Model: CM2NOx
(c) Model: CM3NOx
Proportion of cases within ±5 pphm = 94.5%
Proportion of cases within ±5 pphm = 94.14%
Proportion of cases within ±5 pphm = 94.55%
![Page 90: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/90.jpg)
Chapter 3: Causal relationships between traffic and air pollution
72
Detailed model results are shown in Table 3.8 (other models’ details are shown in
Appendix 3D).
Table 3.8: Coefficients of the explanatory variables for first difference of hourly NOx level
Unstandardised
Coefficients Standardised Coefficients t-ratio Sig.
B Std. Error Beta (Constant) -1.1006 0.152269 -7.23 0.000
Wind speed -0.0236 0.015612 -0.034 -1.51 0.130
Previous period’s wind speed 0.1365 0.023726 0.199 5.75 0.000
Previous period’s north-east wind speed -0.1152 0.020788 -0.135 -5.54 0.000
Previous period’s south-east wind speed -0.1280 0.019065 -0.206 -6.72 0.000
Previous period’s south-west wind speed 0.0481 0.018504 0.104 2.60 0.009
Cross product of previous period’s wind speed and previous period’s NOx level -0.0285 0.000830 -0.853 -34.30 0.000
Traffic (in ‘000) 0.2411 0.000009 0.490 26.78 0.000
Dependent Variable: First difference of NOx level in parts per hundred million F-statistic = 3216.41 df=4203
As for CO, in this model traffic and cross product of previous period’s wind speed and
previous period’s NOx level have major influences on NOx level prediction (high Beta
values). The signs of the coefficients for both CM2CO and CM2NOx are the same,
which shows model consistency.
To achieve comparability, the R2 and MSE values for all models have been calculated
from actual and predicted values. The higher values of R2 and lower values of MSE in
regression models for both CO and NOx than those in the ARIMA models indicate the
improvement that has been achieved, which demonstrate the superiority of the
regression model over the ARIMA model. In the causal models the traffic is a major
explanatory variable so that these models can be used to assess pollution levels for a
specific traffic volume. To illustrate the model fit Figure 3.26 (a) and (b) show the
comparison between observed and model CO levels for two weeks (same weeks shown
in Figure 3.17) and Figure 3.27 (a) and (b) show the comparison between observed and
model NOx levels.
![Page 91: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/91.jpg)
Chapter 3: Causal relationships between traffic and air pollution
73
-0.5
0
0.5
1
1.5
2
100
1100
2100 70
017
00 300
1300
2300 90
019
00 500
1500 10
011
0021
00 700
1700
hour (20-26 Oct, 2003)
ppm
observed
CM2CO
-0.5
0
0.5
1
1.5
2
2.5
3
100
1000
1900 40
013
0022
00 700
1600 10
010
0019
00 400
1300
2200 70
016
00 100
1000
1900
hour (22-28 Dec, 2003)
observed
CM2CO
-5
0
5
10
15
20
25
30
100
1100
2100 70
017
00 300
1300
2300 90
019
00 500
1500 10
011
0021
00 700
1700
hour (20-26 Oct, 2003)
pphm
observed
CM2NOx
Figure 3.26: Comparison between actual and model CO levels for (a) a week in late October ‘03, (b) a week in late December ‘03
(a)
(b)
(a)
![Page 92: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/92.jpg)
Chapter 3: Causal relationships between traffic and air pollution
74
-5
0
5
10
15
20
25
30
35
100
1000
1900 40
013
0022
00 700
1600 10
010
0019
00 400
1300
2200 70
016
00 100
1000
1900
hour (22-28 Dec, 2003)
pphm
observedCM2NOx
In order to fully interpret the model estimates, it is necessary to consider the actual
situation where the pollution was measured. This is illustrated in Figure 3.28.
(b)
Figure 3.27: Comparison between actual and model NOx levels for (a) a week in late October ‘03, (b) a week in late December ‘03
Figure 3.28: William Street canyon with wind directions
William Street Canyon
Receptor
S-W wind
N-E wind
S-E wind
φ
North
θ
30o
δ
![Page 93: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/93.jpg)
Chapter 3: Causal relationships between traffic and air pollution
75
The William Street canyon is aligned at approximately 30o from due north. Although
the wind directions are assumed to be from the middle of North-East, South-East,
South-West, and South-East, the actual average directions were 47o, 131o, 213o and 300o
from North. Therefore in the canyon the north-east wind is coming at approximately a
13o (φ) angle with respect to the street axis and south-west wind is at 3o (θ) (almost
parallel to the street axis) and the south-east wind is coming at 79o (δ) angle to the street
axis. If the recirculation zone extends through the whole canyon, no direct contribution
will be recorded at the receptor on the windward side (Berkowicz et al. 1997). The
emission contribution on the leeward side would be more than on the windward side, as
was illustrated in Figure 3.5. When the angle between wind direction and street axis is
small then the effect at the receptor would be less than when the angle is big (Berkowicz
et al. 1997).
In this context, the results from both CM2CO and CM2NOx models (shown in Table 3.6
and 3.8) support the arguments reported in the previous studies. The coefficients for
north-east and south-east wind directions in both models have negative signs, which
indicate decreasing concentration at the windward side receptor (see Figure 3.28).
Again the north-east wind has a smaller angle (φ=13o) with the street axis than the
south-east wind (δ=79o); therefore the effect of the north-east wind on pollution
concentration at the receptor would be less. The Beta coefficients are -0.200 and -0.317
for north-east wind and south-east wind respectively in the CM2CO model, indicating
that the south-east wind has a higher negative impact on pollution concentration at the
windward side receptor. A similar situation is observed in the CM2NOx model, where
-0.135 and -0.206 are the Beta coefficients for north-east wind and south-east wind
respectively.
For the south-west wind the receptor is located at the leeward side; therefore pollution
concentration would be increased for this wind direction. The Beta coefficient for
south-west wind was 0.059 in the CM2CO model and 0.104 in the CM2NOx model. In
both the cases the coefficients are positive, which indicates an increase in pollution
concentration. This confirms the expectation that on the leeward side the direct plume
from the vehicles would be added to the recirculated pollution. But since the angle
(θ=3o) between south-west wind and street axis is very small, the impact at the receptor
is relatively low compared to the south-east wind. In addition, the south-west wind
often brings back polluted air, as discussed earlier in this chapter.
![Page 94: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/94.jpg)
Chapter 3: Causal relationships between traffic and air pollution
76
Traffic and the cross-product of previous period wind speed and previous period
pollution have relatively large Beta values and thus make the major contributions to the
explanation of the dependent variable. The standard error of the traffic coefficient is
extremely small, so that this coefficient is very reliable for forecasting purposes.
3.5 COMPARISON WITH PREVIOUSLY DEVELOPED MODELS
The model reported in Section 3.4 can be compared with previous studies in terms of
the ratio of CO to NOx level. Because of the different units used in reporting the results
of various models, the ratio CO/NOx enables comparison of results as the ratio is
independent of the units employed. The estimated coefficients for traffic in the CM2CO
and CM2NOx models are used to calculate the ratio CO/NOx. These coefficients are
expressed in volumetric units (i.e. ppm and pphm per 1000 cars). Since most of the
previous estimations were expressed in gravimetric units (i.e. grams per cubic meter)
the traffic coefficients are converted to gravimetric units using the conversion factors of
Colls (1997). Depending on molecular masses for these gases, the conversion factors
are not the same for CO and NOx. The conversion factors for CO and NOx from ppb to
μg/m3 are 1.16 and 1.58 respectively at 20o C. These factors are used to convert the
traffic coefficients to g/m3/vehicle. The ratios of CO to NOx from the present models
and some previous studies are shown in Table 3.9. The ratio for this study is 7.99, and
the ratios from other studies are between 7.95 and 14.00.
Table 3.9: A comparison of CO/NOx ratio between present study and other studies
Studies CO NOx CO/NOx
0.0263 (ppm/1000 cars) 0.00241 (ppm/1000 cars) Present study
3.06E-08a (g/m3/vehicle) 3.82E-09a (g/m3/vehicle) 7.99
Palmgren et al. 1999 25.2b (g/vehicle km) 1.8b (g/vehicle km) 14.00
Eerens et al. 1993 12 (g/vehicle km) 1.5 (g/vehicle km) 8.00
Pokharel et al. 2002 53 (g/kg of fuel) 6.3 (g/kg of fuel) 8.41
EPA Victoria 1999 11.3-12.7 (g/km) 1.42-1.6 (g/km) 7.95
Ketzel et al. 2003 16 (g/vehicle km) 1.6 (g/vehicle km) 10.00
a using conversion factors according to Colls (1997) b estimations are for year 1994 as a base year
![Page 95: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/95.jpg)
Chapter 3: Causal relationships between traffic and air pollution
77
Comparison in terms of actual emissions is more difficult. Emission models have been
developed in various studies for use by environmental protection agencies. They
generally estimate the emission rate, in grams per kilometre travelled by a vehicle
(g/km) or grams per mile (g/m). The factors discussed in Chapter 2 (Section 2.3.4) play
significant roles in estimating emission rate. Many studies have developed emission
models from empirical data.
The coefficients of traffic in this study are converted from ppm and pphm to grams per
cubic metre (g/m3) with factors due to Colls (1997). That still leaves the problem of
relating these measures to emission model outputs which are in terms of grams per
kilometre. The CM2CO and CM2NOx models are not directly comparable with
previously developed models because of the different variables used. As an
approximation the coefficient of traffic in g/m3 is converted to g/km by assuming that
the volume of the Perth airshed is 0.219 km3. This is based on the area of the city of
Perth of 8.75 km2 and an assumed depth of the relevant air mass of 25 m, the height of
the William Street canyon. As a very rough approximation, the average car is assumed
to travel one kilometre after entering the central area (Figure 3.29).
On this basis, the contribution to air pollution per car estimated in this study can be
converted to emission factors for comparison with some previous studies (Table 3.10).
2.96 km
2.96 km
0.25 km
Figure 3.29: Assumed dimensions of the Perth airshed
![Page 96: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/96.jpg)
Chapter 3: Causal relationships between traffic and air pollution
78
Table 3.10: A comparison of emission factors between this study and other studies Models CO NOx
0.0263 (ppm/1000 cars) 0.00241 (ppm/1000 cars)
3.05E-08a (g/m3/car) 3.82E-09a (g/m3/car) Present study model
6.67 (g/km)b 0.84 (g/km)b
Other studies MOBILE6 (Pokharel et al. 2002) 6.36 (g/km)c 0.75 (g/km)c
MOBILE5 (Robinson et al. 1996) 11.09 (g/km)d 2.1 (g/km)d
MOBILE4.1 (Robinson et al. 1996) 5.86 (g/km)d 1.0 (g/km)d
AusVeh 1.0 (EPA Victoria 1999) 11.3-12.7 (g/km) 1.42-1.6 (g/km)
AGO method (EPA NSW 1995) 11.57 (g/km) pre 1986 cars 3.2 (g/km) post 1986 cars
1.17 (g/km) pre 1986 cars 0.73 (g/km) post 1986 cars
aaSIDRA (Dia et al. 2005) 39.9 (g/km) 0.9 (g/km)
CSIRO (Dia et al. 2005) 17.9 (g/km) 4.7 (g/km)
BTRE 2003a 6.9-12.4 (g/km) 1.37-1.75 (g/km) a using conversion factors according to Colls (1997) b using Perth airshed assumption: the area of Perth city is 8.75 km2 and an assumed depth of the relevant air mass of 25 m produces Perth airshed of 0.219 km3, and average car assumed travel 1 km after entering the city.
c using conversion factor from McGaughey et al. 2004 d results for Fort McHenry site
It is clear that the estimates vary within wide ranges. This study produces results which
are well within those ranges.
While the correspondence between models is reassuring, it is clear that those estimated
in this study are superior from a cause and effect point of view. It would be quite
arbitrary to select one of the previous models as the basis for estimating the impact on
pollution of a car entering the city. The model parameters vary so widely that there
could be little confidence in any such inference. In contrast, the vehicle coefficients in
the CO and NOx models estimated in this study are reliable within narrow confidence
limits.
3.6 CONCLUSION
The topic of this chapter was the development of models of air pollution in Perth. To
express pollution levels mathematically we need to know the factors which influence
the level of pollution concentration. The development of air pollution in Perth is a
complex process combining wind flow, vehicle emission rate and canyon geometry.
![Page 97: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/97.jpg)
Chapter 3: Causal relationships between traffic and air pollution
79
Causal models demonstrated that wind speed and wind directions have significant
influences on pollution concentration in the city. For the purpose of this study, the main
result was to obtain accurate measures of the contributions to CO and NOx pollution
made by each vehicle entering Perth city. A comparative analysis of the ratio CO/NOx
and the emission rates for the present model and previously developed models indicated
that the results for the present models are well within the ranges of previous estimates.
The next chapter identifies potential measures to control traffic volume in the city. The
impact of those measures is estimated using the air pollution model developed in this
chapter. Chapters 5, 6 and 7 discuss the travel behaviour of travellers to Perth city. The
outcomes of Chapters 5, 6 and 7 and the air pollution model are combined in Chapter 8.
![Page 98: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/98.jpg)
Chapter 3: Causal relationships between traffic and air pollution
80
Appendix-3A
MODEL: ARIMA (111) – CO Model Description: Variable: CO_ppm Regressors: NONE ‘Non-seasonal’ differencing: 1 No ‘seasonal’ component in model. 95.00 percent confidence intervals will be generated. Split group number: 1 Series length: 4368 Number of cases containing missing values: 75 Termination criteria: Parameter epsilon: .001 Maximum Marquardt constant: 1.00E+09 SSQ Percentage: .001 Maximum number of iterations: 10 Initial values: AR1 -.25684 MA1 -.15330 CONSTANT -.00002 Marquardt constant = .001 Adjusted sum of squares = 381.87509 FINAL PARAMETERS: Number of residuals 4292 Standard error .29797092 Log likelihood -898.01901 AIC 1802.038 SBC 1821.1315 Analysis of Variance: DF Adj. Sum of Squares Residual Variance Residuals 4289 381.87399 .08878667 Variables in the Model: B SEB T-RATIO APPROX. PROB. AR1 -.26243707 .13828459 -1.8978042 .05778897 MA1 -.16049131 .14144148 -1.1346835 .25657137 CONSTANT -.00002433 .00414497 -.0058690 .99531755
![Page 99: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/99.jpg)
Chapter 3: Causal relationships between traffic and air pollution
81
Appendix-3B
MODEL: ARIMA (111) –NOx Model Description: Variable: NOx_pphm Regressors: NONE ‘Non-seasonal’ differencing: 1 No ‘seasonal’ component in model. 95.00 percent confidence intervals will be generated. Split group number: 1 Series length: 4368 Number of cases containing missing values: 82 Termination criteria: Parameter epsilon: .001 Maximum Marquardt constant: 1.00E+09 SSQ Percentage: .001 Maximum number of iterations: 10 Initial values: AR1 -.21065 MA1 -.39169 CONSTANT -.00043 Marquardt constant = .001 Adjusted sum of squares = 36485.955 FINAL PARAMETERS: Number of residuals 4285 Standard error 2.9105344 Log likelihood -10665.677 AIC 21337.354 SBC 21356.443 Analysis of Variance: DF Adj. Sum of Squares Residual Variance Residuals 4282 36429.641 8.4712103 Variables in the Model: B SEB T-RATIO APPROX. PROB. AR1 -.05275905 .08352462 -.6316587 .52764361 MA1 -.23312078 .08136505 -2.8651219 .00418879 CONSTANT -.00044728 .05158744 -.0086702 .99308264
![Page 100: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/100.jpg)
Chapter 3: Causal relationships between traffic and air pollution
82
Appendix – 3C
Table 3C1: Coefficients of the explanatory variables for hourly CO level for CM1CO model
Unstandardised Coefficients
Standardised Coefficients t Sig.
B Std. Error Beta
(Constant) 0.465 0.015 30.94 0.000
Wind speed -0.009 0.002 -0.086 -5.62 0.000
Previous period’s wind speed -0.009 0.002 -0.088 -3.71 0.000
Previous period’s north-east wind speed -0.022 0.002 -0.176 -10.57 0.000
Previous period’s south-east wind speed -0.027 0.002 -0.290 -13.75 0.000
Previous period’s south-west wind speed -0.002 0.002 -0.035 -1.32 0.187
Cross product of previous period’s wind speed and previous period’s CO level 0.020 0.001 0.342 20.61 0.000
Traffic (in ‘000) 0.035 0.000 0.488 40.28 0.000
Dependent Variable: hourly CO level
Table 3C2: Coefficients of the explanatory variables for hourly Ln CO level for
CM3CO model
Unstandardised
Coefficients Standardised Coefficients t Sig.
B Std. Error Beta (Constant) -5.280 0.090 -58.55 0.000
Wind speed -0.023 0.002 -0.144 -9.75 0.000
Previous period’s wind speed -0.009 0.004 -0.055 -2.43 0.015
Previous period’s north-east wind speed -0.040 0.003 -0.197 -12.86 0.000
Previous period’s south-east wind speed -0.056 0.003 -0.372 -19.56 0.000
Previous period’s south-west wind speed -0.004 0.003 -0.038 -1.52 0.130
Cross product of previous period’s wind speed and previous period’s CO level 0.028 0.001 0.305 20.57 0.000
Ln of Traffic 0.552 0.011 0.562 51.44 0.000
Dependent Variable: Ln of CO
![Page 101: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/101.jpg)
Chapter 3: Causal relationships between traffic and air pollution
83
Appendix – 3D Table 3D1: Coefficients of the explanatory variables for hourly NOx level for CM1NOx
model
Unstandardised
Coefficients Standardised Coefficients t Sig.
B Std. Error Beta
(Constant) 3.876 0.151 25.62 0.000
Wind speed -0.032 0.016 -0.028 -2.05 0.041
Previous period’s wind speed -0.212 0.024 -0.186 -8.98 0.000
Previous period’s north-east wind speed -0.170 0.021 -0.120 -8.21 0.000
Previous period’s south-east wind speed -0.196 0.019 -0.190 -10.33 0.000
Previous period’s south-west wind speed 0.024 0.018 0.031 1.30 0.193
Cross product of previous period’s wind speed and previous period’s NOx level
0.023 0.001 0.423 28.43 0.000
Traffic (in ‘000) 0.398 0.000 0.488 43.68 0.000Dependent Variable: hourly NOx level Table 3D2: Coefficients of the explanatory variables for hourly Ln NOx level for
CM3NOx model
Unstandardised
Coefficients Standardised Coefficients t Sig.
B Std. Error Beta
(Constant) -5.957 0.102 -58.13 0.000
Wind speed -0.032 0.003 -0.139 -11.43 0.000
Previous period’s wind speed -0.012 0.004 -0.053 -2.82 0.005
Previous period’s north-east wind speed -0.049 0.004 -0.174 -13.22 0.000
Previous period’s south-east wind speed -0.070 0.003 -0.336 -20.43 0.000
Previous period’s south-west wind speed -0.001 0.003 -0.008 -0.36 0.717
Cross product of previous period’s wind speed and previous period’s NOx level
0.002 0.000 0.212 17.24 0.000
Ln of Traffic 0.885 0.012 0.672 72.98 0.000Dependent Variable: Ln of NOx level
![Page 102: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/102.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
84
CHAPTER FOUR Traffic Control Policies to Reduce Pollution in Perth City: a first assessment based on previously estimated elasticities A causal approach to air pollution has been developed in Chapter 3, with separate
models for CO and NOx levels in Perth City. This work has established the significant
effect of traffic in increasing air pollution. Consequently, measures to control traffic
volume are required in order to improve air quality, and the focus of this chapter is to
identify potential means of improvement in Perth city. The first section identifies
possible strategies from a global perspective. Section 4.2 suggests specific measures to
limit traffic and thus reduce pollution. Section 4.3 reviews previously estimated car trip
demand elasticities with respect to various potential measures. Specific responses to
these measures are discussed. Section 4.4 has quantified the impacts on air quality of
the suggested measures individually and collectively.
4.1 INTRODUCTION
Because transportation problems are experienced in most cities in the world, many are
trying to implement a range of policies in order to moderate traffic as well as reducing
air pollution. To assess the behavioural response of travellers to the “green” issue the
study identifies the potential policies to influence travel behaviour leading to improve
air quality in Perth city. The study follows three stages to quantify the effectiveness of
the potential policies. Initially previous travel behaviour estimations have been used to
measure the impact of suggested policies by applying the pollution coefficients reported
in Chapter 3. At this stage the study uses generalised estimates to the travellers’
responses. The following stage (Chapter 5) is to assess private car drivers’ responses in
the specific context of Perth, where transport mode choice behaviour is modelled. The
third stage (Chapters 6 and 7) estimates the actual responses to various charging policies
with the information collected through a Stated Preference survey. This chapter
discusses the first stage in measuring the effectiveness of proposed measures.
The fact that Perth is one of the cities that have experienced high demand for private
cars and has one of the highest car ownership levels in the world is serious from both
![Page 103: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/103.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
85
sustainability and air pollution viewpoints. This chapter identifies measures which can
control air pollution by discouraging private car use, especially for commuting.
Policies used in various countries have been introduced in Chapter 2. Table 4.1
summarises the measures that can be implemented generally in Australia, and
specifically in Perth.
Table 4.1: Summary of potential measures for ameliorating air pollution
Policies How VKT measure Full-cost pricing
o Road pricing o Pollution tax & fees o High charge during peak periods
Discriminatory policies
Charging more for potentially higher pollutant vehicles, like big engine, SUV, diesel engine.
Allow selected licence plate numbers to enter the city on alternate days.
Cars in the city Parking control o Increasing parking fee o Reducing long time parking space o Parking cash-out program
Not allowing any vehicles to enter the inner city Public-transport measure
Offering season ticket High capacity of mass transit system, train, trams, etc.
Cycling and Walking measures
Improve pavements More space given to cyclists and pedestrians Workplace parking for cycles Buffer zone, where cars are not allowed to enter
Vehicle monitoring Regular vehicle testing program Setting high emission standard and random emission test
Fuel measure Improve the quality of fuel Use alternative fuel vehicles CNG, Electric, fuel cell, bio-fuel, etc Use technologically advanced vehicles o Hybrid cars, hydrogen cars
Traffic demand management
Land use plan Lane restriction
Car scrapping program
Offering incentives for scrapping older vehicles
Other measures Working at home 1 or 2 days a week
These are the measures that are used or proposed in various cities in the world in order
to reduce congestion and improve the traffic system.
![Page 104: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/104.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
86
4.2 MEASURES TARGETED TO THE CITY
“If a tax were imposed on only one of two roads, both the speed and travel time would
be better on the ‘toll’ road than on the free road, and the result is increased efficiency”
(Pigou 1920). In a recent study (Sapkota 1999) investigated traffic flows on tolled roads
by income groups. Increased car ownership, increased job opportunities in the city and
shopping in the city area should be taken into account in formulating policies. Some of
the measures in Table 4.1 may be applicable to Perth city.
This study identified seven different measures to control travel behaviour in order to
reduce air pollution (Table 4.2). They can be categorised into 4 types, i) fixed charge,
ii) variable charge, iii) parking measures, and iv) lane restriction. Impacts of these
measures on travel behaviour would vary with the circumstances. Studies reported in
the literature found diverse sensitivity of travel demand with respect to various pricing
and control policies. This sensitivity is measured as elasticity. The literature on this
topic was introduced in Chapter 2 and is reviewed in more detail in this chapter.
Table 4.2: Policies applicable to Perth City
Measure Type A fixed pollution charge for bringing a vehicle into the city at any
time during weekdays Fixed charge
A differential charge imposed with respect to the size of the cars A differential charge imposed with respect to time of a day to
enter the city A variable charge imposed for distance travelled within the city
Variable charge
Increase parking fee for long term and peak period Reduce parking space in city Parking measure
Reduce lanes for the vehicles and provide that space to cyclists, pedestrians, and public transport use Lane restriction
4.3 ELASTICITY ESTIMATION
A wide range of research has been conducted on own (direct) price and cross elasticity
of transport demand. Some studies have estimated both short and long run elasticities,
whereas other estimates are only for the short run. The BTRE database on elasticities
has been consulted but the original source references are given here. Not all previous
estimation can be exactly categorised as being based on i) fixed charge, ii) variable
charge, iii) parking measures, or iv) lane restriction. However the following discussion
tries to relate previously estimated elasticities to these categories. Elasticities are with
![Page 105: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/105.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
87
respect to generalised cost, to take account of cases where there was previously no
charge. The charge is treated as an increase in running cost and time cost in money
terms.
4.3.1 Response to a Fixed Charge
A number of studies have been carried out on road or congestion pricing. The main
objective of this type of pricing is to reduce traffic in the congested area, especially in
the peak period, and thus increase average speed. The standard approach to optimal
congestion pricing depends on three prime elements; those are, the speed-flow
relationship, the demand function, and the generalized cost (Yang et al. 2004).
Although the primary objective is to reduce congestion in a specific area at a specific
time of a day, the supplementary objective is to reduce air pollution. This latter purpose
is getting more attention recently and hence this type of pricing is sometimes called an
“emission fee”. A wide range of studies have attempted to determine the optimal
charge under this approach. Most of them used marginal cost pricing; some even used a
specific trial-and-error approach to optimise pricing. The impact may not be the same
in all cases. Before measuring the impact of pricing we look at some of the successes of
this approach around the world.
First Singapore and then several cities in Norway experimented with congestion charges
for central cities. Recently London has introduced charging for entry to the central area,
in order to reduce congestion levels (Stopher 2004). Taking Singapore first, the Area
Licensing Scheme (ALS) was implemented in 1975 and significantly modified in1994.
The total impact was a 71.1% decrease in number of private vehicles entering the
restricted zone during the morning peak period just after introduction of the scheme.
Tolls ranging from A$0.36 to A$2.15 are collected through 34 non-stop overhead
gantries. The Straits Times reported that within two months of the implementation of
this policy traffic dropped by 20-24% in the restricted zone. Luk (1999) estimates that
toll elasticities in Singapore are -0.19 to -0.58, with an average of -0.34. Cost of
implementing this Electronic Road Pricing (ERP) system was S$192 million (A$160
million), however, it smoothed traffic flow and even increased speed to about 60 km per
hour during the peak (McNulty 2000).
Norway also implemented congestion pricing in three major cities starting in 1986. A
comparison of road pricing in Norwegian cities is shown in Table 4.3.
![Page 106: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/106.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
88
Table 4.3: Comparative performance of cordon pricing for Norwegian cities
Characteristics Bergen Oslo Trondheim
City population 213,000 456,000 138,000
Commencement in 1986 1990 1991
Number of toll stations 7 19 11 (22 in 1998)
Charging period Mon-Fri 6 am to 10 pm
All days All hours
Mon – Fri 6 am to 5 pm
Entry charge for a small vehicle (NOKa) 5 12 10
Traffic impact (traffic reduction) 6-7% 3-4% 10%
a NOK is Norway Kroner equivalent to A$0.201 on 8th March 2006 Source: Tretvik (2003)
London Transport reports that their charging scheme has reduced traffic by 18% inside
the charging zone, and has reduced delay by 30% (Lettice 2004). However, many
people in London are reported to have negative reactions toward this scheme (Lettice
2004).
An electronic road pricing project (1983-1985) in Hong Kong was undertaken
experimentally but not subsequently implemented, although the project was
economically and technically feasible. According to the findings the pricing would
reduce travel time by 20-24%, average speed at the central area during peak period
would be increased by 16%, and traffic flow would be reduced significantly. The
project was not continued for a range of reasons, though the benefits of road pricing
were recognised.
The objective of the Melbourne City Link Project, with road pricing, is to provide the
city link to toll paying travellers. Though the purpose is not to restrict travellers to
Melbourne CBD, the project has at least one toll station at the point of entering the city.
The project has successfully diverted traffic from some other links, thus improving
traffic flow with reduced travel time. At the same time the system is generating revenue
to repay the project cost.
A recent study conducted by Matas and Raymond (2003) summarises previous
estimates of toll elasticities, and develops a model for toll road demand in Spain. They
![Page 107: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/107.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
89
have calculated that short term price elasticities for road tolls range from -0.21 to -0.83,
which is rather higher than previous estimates. Again Arentze et al. (2004) developed
models to estimate toll price elasticity of travel demand. Their estimates are within a
range from -0.13 to -0.19 for the entire system and from -0.35 to -0.39 for congested
areas and times.
From the above discussion it is clear that congestion pricing or emission pricing would
certainly reduce travel demand in a specific area at a specific time. This study evaluates
the application of this pricing approach along with other policy measures in order to
reduce air pollution in the city centre.
4.3.2 Responses to Variable Charges
Three different types of variable charge could be imposed on private vehicle users in
Perth city depending on use of their vehicles. The three categories are: i) variable
charges imposed on peak and off-peak entrance; ii) variable charges imposed with
respect to distance travelled within the city; and iii) variable charges imposed with
respect to the size of the vehicle and/or type of fuel used.
None of the studies reviewed has estimated the impact of these forms of variable charge
on travel demand. However due to the nature of the suggested charges they may be
viewed as additional costs of running a car. Such a charge can easily be matched with
the cost of fuel to run a car. There have been many studies of elasticity of travel
demand and it is still an important area of transport study. Many of these studies tried
to establish both long term and short term relationships with travel behaviour.
Johansson and Schipper (1997) measured long term fuel price elasticity of -0.55 to -0.05
for car travel demand and -0.35 to -0.05 for mean driving distance (per car per year).
The authors’ “best guess” values are -0.3 and -0.2 respectively. Goodwin (1992)
reviewed studies of travel demand elasticity and summarised the elasticities of traffic
levels with respect to fuel price from 11 studies of -0.16 and -0.33 for short-run and
long-run respectively.
Luk and Hepburn (1993) reviewed travel demand elasticities in Australia and
summarised studies relating to different states in Australia. Table 4.4 shows various
estimates of fuel consumption elasticities with respect to fuel price in Western
Australia.
![Page 108: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/108.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
90
Table 4.4: Estimates of elasticity of fuel consumption with respect to fuel price
Author Coverage Data Short run Long run
Schou & Johnson
(1979)
Australia 1955-1976 -0.05 Not available
Donnelly (1981) WA 1966-1980 -0.10 -0.30
Donnelly (1981) WA 1958-1981 -0.19 -0.78
Donnelly (1984) WA 1958-1981 -0.16 -1.03
Australiaa -0.10 -0.42
Australiab -0.12 -0.67 a Estimated using a weighted average of State results. b Estimated using a single national equation. Source: Luk & Hepburn (1993)
A study by Mayeres (2000) indicated the fuel price elasticities of car mileage of -0.16
and -0.43 for peak and off-peak transport respectively for essential trips and -0.43 and
-0.36 for optional trips.
A few other similar studies tried to establish the relationship between out-of-pocket
expenses and travel demand. Button (1993) estimated the elasticity of road travel with
respect to out of pocket expenses of -0.3 to -2.9 for urban commuting. Oum et al.
(1990) reviewed a number of studies on transport demand elasticity. They summarised
elasticities as -0.12 to -0.49 for peak period and -0.06 to -0.88 for off-peak period and
-0.001 to -0.52 for the whole day.
A review by the Industry Commission (1993) summarises travel demand elasticity with
respect to variable car cost and petrol price. Table 4.5 shows the result.
Table 4.5: Travel demand elasticity
Car travel demand w.r.t. Short run Long run
Variable car costs -0.09 to -0.24 -0.22 to -0.31
Petrol price -0.04 to -0.20 -0.30
Source: Industry Commission (1993) Hensher and Young (1990) examined fuel price elasticity of energy demand in Australia
with data for the years from 1961 to 1988. They have estimated this elasticity at -0.17
using ordinary least squares and -0.21 using two-stage least squares methods for
![Page 109: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/109.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
91
passenger cars. A study by De Borger and Wouters (1998) estimated cross elasticities
of travel demand for peak and off-peak period car use (in Table 4.6).
Table 4.6: Peak and Off-peak travel demand elasticity
Elasticity w r t cost of car trip Price
Peak Off-peak
Peak car -0.3 0.048
Off-peak car 0.05 -0.6
Source: De Borger and Wouters (1998)
Taplin et al. (1999) estimated commuter elasticities for public transport and car as
shown in Table 4.7.
Table 4.7: Demand elasticities of car and public transport for work trips
Elasticity w r t fare or cost of trips by Travel mode
Public transport Car
Public transport -0.15 0.17
Car 0.08 -0.09
Source: Taplin et al. (1999)
This section has briefly reviewed the relationship between variable costs of transport
and the demand for it. A major part of variable operating costs is the cost of petrol;
other variable costs are in-vehicle time and parking charges. The analysis in this study
is based on the assumption that the elasticities for variable operating costs (principally
fuel costs) would be the same as those for variable charges imposed as a policy
measure. Some may argue that private car users already pay ample fuel tax, so why
should an additional charge be imposed. The answer is that the targets of the proposed
charges are private car users who enter into the city centre, not all car users. The
argument is that those who create more pollution in a polluted area should pay more.
4.3.3 Responses to Parking Measures
Another set of measures this study considers as means of reducing air pollution would
affect parking. There are two types of measure, i) increased parking fee, and ii) reduced
parking space in the city. Both would discourage private car users from bringing their
cars to the city. The study uses previously estimated elasticities to calculate the impact
of this measure on air pollution.
![Page 110: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/110.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
92
A study by Hensher and King (2001) on parking policy in Sydney CBD suggested that
1% increase in hourly parking rate would result in a 0.54% reduction in CBD parking
and 0.29% increase in public transport use. Hess (2001) estimated price elasticity of
demand for parking at work in Portland CBD with varying daily parking fees. The
elasticity was -0.44 for $6 or more parking fee and -0.07 for $1. The results of a review
by Willson & Shoup (1990) on parking price elasticities is summarised in Table 4.8.
Table 4.8: Parking price elasticity
Study Type City Change Elasticity
Surber et al. 1984 Before/after Los Angeles - near CBD
Ended employer-paid parking for solo drivers
-0.68
Soper 1989 Before/after Los Angeles – suburban
Price of solo driver parking raised to two thirds market rate
-0.32
Transport Canada 1974
Before/after Ottawa Stopped providing free parking
-0.11
Francis & Groninga 1969
With/without Los Angeles – CBD
Comparison employees with & without free parking
-0.29
Shoup & Pickrell 1980
With/without Los Angeles – suburban
Comparison employees with & without free parking
-0.10
Note With/without studies compare commuting behaviour of matched samples of employees with and without employer paid parking. Before/after employer paid parking was eliminated. Source: Willson & Shoup (1990)
ICF Consulting Group (1997) indicated that 1% increase in parking fees would reduce
vehicle miles travelled (VMT) to work by 12% to 39% and would even reduce solo
driving by 66% to 81%. Another study found a price elasticity of on-street parking of
-0.37 (Calthrop 2002). Wilson (1992) commented that “best performing models predict
that between 25 and 34 percent fewer automobiles are driven to work when workers
have to pay to park, as compared to when they park free”.
In summary, parking price policy has a significant impact on travel behaviour.
Increasing price would encourage people not to drive solo to the city centre and also to
take transit to work. Although studies have been done on price elasticity of parking, no
study has been found which addresses the relationship between commuter behaviour
and increasing or decreasing parking space. Therefore, for simplicity of analysis this
![Page 111: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/111.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
93
study considers parking fee and parking space measures as a composite parking price
measure.
4.3.4 Responses to Lane Restriction
To ease congestion and improve traffic speed, transport planners are concerned with
increased road supply. Hensen & Huang (1997) estimate a long term elasticity of lane
capacity and vehicle miles travelled as 0.9 in the metropolitan area and 0.6 to 0.7 at the
county level. They also summarise elasticities from previous studies varying from 0.1
to as high as 0.7 depending on the methodology of the studies. Another study (Noland
2001) suggested that the relationship between lane capacity and vehicle miles travelled
is 0.3 to 0.6 in the short run and 0.7 to 1.0 in the long run. Noland and Cowart (2000)
also estimated a corresponding elasticity of 0.655 for freeways and arterials. Fulton et
al. (2000) measured induced traffic in the US mid-Atlantic region using cross-section
and time series data. The estimated average elasticities of vehicle miles travelled with
respect to lane-miles range from 0.2 to 0.6.
All of these studies focus on increased supply, meaning increased road capacity or more
lanes. However, in the present study one of the suggested pollution control policies is
to reduce lanes for private vehicles in the urban area. For the purpose of estimating the
response to lane restriction the study assumes that estimated elasticities are reversible.
This measure may increase congestion but that effect may be partly offset by
implementing congestion charges, discussed before.
4.3.5 Average Elasticities
Table 4.9 summarises the elasticity estimates reviewed for i) fixed charge, ii) variable
charge, iii) parking measures, and iv) lane restriction. There are short and long term
elasticities of demand for trips with respect to variable charges and lane restriction but
only short term elasticities for fixed charges and parking measures. Long term
elasticities for fixed charge and parking measures are assumed to be double the short
run elasticities, as a similar doubling is observed (approximately) in the case of variable
charges and lane restriction.
There are also cross elasticity effects but these are beyond the scope of this study, which
considers only the own price effect of each measure. In summarising the elasticities,
extreme estimates are ignored (Table 4.9).
![Page 112: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/112.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
94
Table 4.9: Average elasticities for four suggested measures
Type of measure
Average Previously estimated travel demand elasticity with respect to own price
Fixed charge Short run -0.15 -0.06, -0.07, -0.03, -0.04, -0.1, -0.2, -0.24, -0.18, -0.34, -0.21, -0.13, -0.19
Long run -0.30 (assumed to be double the short run elasticity)
Variable charge Short run -0.18 -0.3, -0.16, -0.05, -0.1, -0.19, -0.16, -0.12, -0.16, -0.3, -0.12, -0.49, -0.09, -0.24, -0.17, -0.169, -0.212, -0.3, -0.094
Long run -0.39 -0.33, -0.29, -0.3, -0.78, -0.22, -0.31, -0.3, -0.55, -1.03
Parking
measure
Short run -0.30 -0.54, -0.44, -0.07, -0.12, -0.68, -0.32, -0.11, -0.29, -0.1, -0.39, -0.37, -0.25, -0.34
Long run -0.59 (assumed to be double the short run elasticity)
Lane reduction
measure
Short run 0.43 0.1, 0.7, 0.3, 0.6, 0.655, 0.2, 0.6
Long run 0.83 0.9, 0.7, 1.0, 0.6, 0.9, 0.904 Note: Italicised values in the last column are extreme ones, which are ignored for the calculation of
averages For small changes, elasticity can be expressed in equation (4.1).
e = VP
PV
PPVV
×∂∂
=∂∂
// ............................................... (4.1)
However, for larger changes, the applicable elasticity expression is:
( )( )PP
VVLnLnLnLn
e21
21
−
−=
This can be rewritten as,
( ){ }PPVV LnLneLnExp 2112 −−= ………………….. (4.2)
Where, e is own price elasticity
V1 is initial traffic
V2 is reduced traffic
P1 is initial price/cost
P2 is final price/cost
Both equations (4.1) and (4.2) can be represented graphically as in Figure 4.1. For a
small change in price, the elasticity expression follows the solid line whereas for a
larger change it follows the broken line.
![Page 113: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/113.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
95
The average elasticities (from Table 4.9) for different measures are used in equation
(4.2) to estimate the reduced traffic for different measures.
4.4 IMPACT ON AIR QUALITY
The following section uses the elasticity estimates to quantify reductions in car use in
Perth city leading to reduced CO and NOx levels. Traffic levels are estimated for the
various measures using average elasticity, then CO and NOx levels are determined by
using the air pollution models developed in Chapter 3.
4.4.1 Impact of a Fixed Charge
Long term price elasticity of travel demand with respect to a fixed charge in any area at
any time is estimated as -0.30 (Table 4.9). To estimate the traffic response to a charge
using equation (4.2), we need the base cost (P1) to which the fixed charge is added.
Taylor and Taplin (1998) estimated equilibrium cost per km for both social cost and
private cost. This study uses private cost for the analysis, as it is considering out-of-
pocket expenses for commuters. Taylor and Taplin (1998) consider only fuel cost and
time value for calculating private cost, while Bray and Tisato (1997) identified various
approaches to private costs, such as i) time costs and fuel costs, ii) time costs, fuel costs
and parking costs, iii) time costs, fuel costs and vehicle maintenance costs. Estimated
private cost per km is $0.264 which has been updated to 2004 from the figure indicated
in Taylor and Taplin (1998) using the consumer price index. Average car kms travelled
Figure 4.1: Price elasticity for small and large change
V
P
![Page 114: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/114.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
96
per trip is 12.6 in 2004 (Perth and Regional Transport Survey). Therefore, average cost
per trip for the commuter in Perth is $3.33. This figure is used to calculate the impact of
a fixed charge.
The proposed fixed charge would be levied on private vehicles each time they enter the
city regardless of the time of a day. This fixed charge is subject to further research;
however social cost may be about $ 2.29 (in 2004 value) more per trip than private costs
(based on Taylor and Taplin 1998). The present study investigated the long term impact
on air pollution of a $1 charge per trip. Table 4.10 shows impacts on CO and NOx
levels for four different levels of charge.
Table 4.10: Impact of fixed charge: percentage reduction in pollutants and traffic
Amount charged Pollutants & traffic $0.5 $1.0 $1.5 $2.0
CO 2 4 6 7
NOx 2 3 5 6
Traffic 4 8 11 13
Table 4.10 shows that $1.0 per trip extra charge would reduce average daily traffic by
8%, which would lead to reduction of 4% and 3% in daily average of CO and NOx
levels respectively.
0.000
0.200
0.400
0.600
0.800
1.000
1.200
1.400
1.600
100
300
500
700
900
1100
1300
1500
1700
1900
2100
2300
hour
ppm
0
5000
10000
15000
20000
25000
30000tr
affic
CO-no charge CO-fixed charge traffic-no charge traffic-fixed charge
Figure 4.2a: Impact of fixed charge of $1.0 on hourly CO level (6-month average data)
![Page 115: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/115.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
97
0.00
2.00
4.006.00
8.00
10.00
12.0014.00
16.00
18.00
100
300
500
700
900
1100
1300
1500
1700
1900
2100
2300
hour
pphm
0
5000
10000
15000
20000
25000
30000
traffi
c
NOx-no charge NOx-fixed charge traffic-no charge traffic-fixed charge
The reductions in pollution levels are not uniform. Figures 4.2a and 4.2b show that
traffic in the morning and afternoon peaks are at about the same level, whereas both CO
and NOx in the afternoon peak are higher than in the morning peak. The reasons have
already been discussed in Chapter 3. In each hour the vehicle emissions combine with
lingering emissions from previous hours that eventually build up to the highest point at
around 6 PM even though the traffic level is falling.
4.4.2 Impact of Variable Charges
Long term elasticity of travel demand with respect to variable costs is estimated from
previous studies as -0.39 (Table 4.9). This study considers charges which vary by time
of day. Three time periods are identified for this analysis: i) peak period from 6 am to
10 am, ii) during the day from 10 am to 5 pm, and iii) other times of the day. The peak
starts with the build-up of traffic and ends when it declines. Emissions accumulate
rapidly in this period. The proposed rate would be $0.45 per km in the peaks, $0.40 per
km between peaks, and $0.35 per km for the rest of the day. This charge is again
arbitrary, however it is not baseless as total social cost per trip is about $5.60 (indexed
up to 2004) (Taylor and Taplin 1998). For the average trip, the proposed variable
charges together with the fixed charge come to a total of $8.74, $8.25, and $7.76 per trip
for the three periods during a day. Table 4.11 also shows two other alternative charging
scenarios.
Figure 4.2b: Impact of fixed charge of $1.0 on hourly NOx level (6-month average data)
![Page 116: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/116.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
98
Table 4.11: Impact of variable charge by time of day (peak/between peaks/rest of day): percentage reduction in pollutants and traffic
Alternative charging scenarios ($ per km) Pollutants & traffic $0.4/$0.35/$0.3 $0.45/$0.4/$0.35 $0.5/$0.45/$0.4
CO 5 8 10
NOx 4 6 8
Traffic 10 14 18
The suggested variable charges would reduce traffic by 14% which leads to 8% and 6%
reductions in daily average of CO and NOx levels respectively. The effects by time of
day are shown in Figures 4.3a and 4.3b for CO and NOx respectively. They are similar
to Figures 4.2a and 4.2b, the only difference being a scale effect.
0.000
0.200
0.400
0.600
0.800
1.000
1.200
1.400
1.600
100
300
500
700
900
1100
1300
1500
1700
1900
2100
2300
hour
ppm
0
5000
10000
15000
20000
25000
30000
traf
fic
CO-no charge CO-variable charge traffic-no charge traffic-variable charge
0.002.004.006.008.00
10.0012.0014.0016.0018.00
100
300
500
700
900
1100
1300
1500
1700
1900
2100
2300
hour
pphm
0
5000
10000
15000
20000
25000
30000
traf
fic
NOx-no charge NOx-variable charge traffic-no charge traffic-variable charge
Figure 4.3b: Impact of variable charges of $0.4/$0.35/$0.3 for three periods of a day on hourly NOx (6-month average data)
Figure 4.3a: Impact of variable charges of $0.4/$0.35/$0.3 for three periods of a day on hourly CO (6-month average data)
![Page 117: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/117.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
99
Impacts of variable charges on pollution levels are generally similar to those of a fixed
charge. However the proposed charges would reduce pollution levels more than the
fixed charge.
4.4.3 Impact of the Parking Measures
Long term elasticity of travel demand with respect to parking price is estimated from the
previous studies as -0.59 (Table 4.9). The proposed measure is to increase parking fees
per hour in the city to $4 in the peak (6 am to 10 am) and $3 off-peak (rest of the day).
Current parking fees in the city vary from $0.8 to $3.5 (City of Perth 2004). Traffic as
well as pollution levels would be reduced in the city centre after imposing additional
parking fees. Air pollution levels are shown with varying parking fees for peak and off-
peak periods in Table 4.12 with three other scenarios.
Table 4.12: Impact of parking measure (peak/off-peak): percentage reduction in pollutants and traffic
Alternative charging scenarios Pollutants & traffic $ 3.5/$3.0 $ 4.0/$2.5 $ 4.0/$3.0 $ 4.5/$3.5
CO 9 5 9 13
NOx 7 5 8 11
Traffic 16 10 18 25
The suggested parking fees would reduce daily traffic by 18% leading to 9% and 8%
reductions of average daily CO and NOx levels respectively. The hourly result is shown
in Figures 4.4a and 4.4b for CO and NOx respectively.
0.000
0.200
0.400
0.600
0.800
1.000
1.200
1.400
1.600
100
300
500
700
900
1100
1300
1500
1700
1900
2100
2300
hour
ppm
0
5000
10000
15000
20000
25000
30000
traf
fic
CO-no charge CO-park measure traffic-no charge traffic-park measure
Figure 4.4a: Impact of parking measure of $0.4.0/$3.0 on hourly CO (6-month average data)
![Page 118: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/118.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
100
0.00
2.00
4.00
6.00
8.00
10.00
12.00
14.00
16.00
18.00
100
300
500
700
900
1100
1300
1500
1700
1900
2100
2300
hour
pphm
0
5000
10000
15000
20000
25000
30000
traffi
c
NOx-no charge NOx-park measure traffic-no charge traffic-park measure
The parking fee measure would reduce pollution levels, but not as much as it would
reduce traffic.
4.4.4 Impact of Lane Restriction
Long term elasticity of travel demand with respect to lane capacity is estimated from
previous studies to be 0.83 (Table 4.9). This value indicates that expanded road supply
increases travel demand by this proportion in the long run. On the assumption that the
relationship is reversible, this elasticity is used to calculate the effect of reducing lane
availability on private vehicle traffic in the city. At this point, the study considers a
25% reduction in lanes open to private vehicles. This means that the left lane of any
4-laned road in the city would be closed to private vehicle users and restricted to public
transport, pedestrians and cyclists. Figure 4.5 gives an example.
Figure 4.4b: Impact of parking measure of $0.4.0/$3.0 on hourly NOx (6-month average data)
Restricted lane
Figure 4.5: Example of lane restriction at William Street and Wellington Street intersection Source: based on Main Roads Western Australia
William St Horseshoe Bridge
![Page 119: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/119.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
101
A sensitivity analysis of lane reduction is shown in Table 4.13. There would be 21%
reduction of private traffic leading to 11% and 10% reductions in daily average of CO
and NOx respectively from a 25% lane restriction policy. Of total traffic in Perth in
2002, 82% was private vehicles, 17% commercial vehicles, and 1% buses. Figures 4.6a
and 4.6b show the reduction of traffic and pollution levels for CO and NOx respectively.
Table 4.13: Impact of lane restriction: percentage reduction in pollutants and traffic
Proportion of lane reduction Pollutants & traffic 25% 50% 75%
CO 11 23 36
NOx 10 20 31
Traffic 21 44 69
0.000
0.200
0.400
0.600
0.800
1.000
1.200
1.400
1.600
100
300
500
700
900
1100
1300
1500
1700
1900
2100
2300
hour
ppm
0
5000
10000
15000
20000
25000
30000
traf
fic
CO-no charge CO-lane restriction traffic-no charge traffic-lane restriction
Figure 4.6a: Impact of 25% lane restriction on hourly CO (6-month average data)
![Page 120: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/120.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
102
0.00
2.00
4.00
6.00
8.00
10.00
12.00
14.00
16.00
18.00
100
300
500
700
900
1100
1300
1500
1700
1900
2100
2300
hour
pphm
0
5000
10000
15000
20000
25000
30000
traf
fic
NOx-no charge NOx-lane restriction traffic-no charge traffic-lane restriction
4.4.5 Combined Impact
If we assume that the effects of all the policies can be combined linearly then the overall
impact on air pollution would be substantial. There may even be a synergistic effect
when a variety of different measures are implemented simultaneously. The impact of
combined effects can be either stronger or weaker than the total of individual effects
(Shiftan and Suhrbier 2002). Table 4.14 shows the long term combined impacts of
pollution and traffic levels. The sum of the individual impacts on traffic, CO and NOx
is more than the combined policy effect which is not estimated by the simple addition of
individual effects. The combined effect is calculated with equation (4.3) which is the
same as equation (4.2) except that the second part of the right hand side of the equation
is in terms of a summation of four policies.
The reduced traffic is applied to the air pollution models developed in Chapter 3. Thus
the impact of the combined policy is a 49% reduction in average daily traffic and 26%
reduction in CO and 22% reduction in NOx.
( )⎥⎦
⎤⎢⎣
⎡−−= ∑
=
4
12112
iiii PPV LnLneLnVExp ……………………………. (4.3)
Where: V2 = combined reduced traffic
V1 = existing traffic P = price level i = 1,2,3,4 policy measures
Figure 4.6b: Impact of 25% lane restriction on hourly NOx (6-month average data)
![Page 121: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/121.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
103
Table 4.14: Combined impact of policy measures: percentage reduction of pollutants and traffic
Impacts Fixed charge
Variable charge
Parking measure
Lane restriction Combined
CO 4 8 9 11 26
NOx 3 6 8 10 22
Traffic 8 14 18 21 49
The reductions can be converted to totals for the Perth airshed on an annual basis. The
area of the City of Perth is 8.75 Square km. The dimension of the Perth city airshed was
considered in Chapter 3 as an 8.75 square kilometres area by a 25 metre elevation. The
annual reduction of CO and NOx (in tonnes) for the Perth airshed is shown in Table 4.15
(unit conversion is taken from Colls 1997).
Table 4.15: Annual reduction of pollution in tonnes in the Perth airshed
Pollution level
Fixed charge
Variable charge
Parking measure
Lane restriction Combined
CO 2 4 5 7 15
NOx 0.3 0.3 0.3 0.4 0.9
The short and long term combined impacts of pollution are compared in Figures 4.7a
and 4.7b for CO and NOx respectively. In the short run both CO and NOx levels are
moderately reduced but in the long run there is a much greater impact. For any
transport policy one would expect the impact to reach equilibrium in the long run.
CO Level
0.0000.2000.4000.6000.8001.0001.2001.4001.600
100
300
500
700
900
1100
1300
1500
1700
1900
2100
2300
hour
ppm
no charge long term combined policy short term combined policy
Figure 4.7a: Short and long term impact of combined policy on hourly CO
![Page 122: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/122.jpg)
Chapter 4: Traffic Control Policies to Reduce Pollution
104
NOx Level
0.002.004.006.008.00
10.0012.0014.0016.0018.00
100
200
300
400
500
600
700
800
900
1000
1100
1200
1300
1400
1500
1600
1700
1800
1900
2000
2100
2200
2300
2400
hour
pphm
no charge long term combined policy short term combined policy
4.5 CONCLUSION
This chapter formulated four measures to reduce pollution due to traffic in Perth city.
Average price elasticities of travel demand have been used in calculating the resulting
traffic flows. The air pollution models (developed in Chapter 3) for hourly CO and NOx
levels in relation to traffic and meteorological factors are used to estimate the pollution
levels. The measures would have significant impacts in reducing CO and NOx levels in
Perth city. This chapter also estimated the combined effect of the policies and found
significant improvement of air pollution in both short and long run.
In identifying feasible measures to reduce traffic in Perth city and thus improve air
quality, this chapter has also provided a preliminary assessment of policy impacts. The
next stage of this study assesses actual travel behaviour in the Perth context. The
policies suggested in this chapter would target private transport users. In order to
estimate the effects of implementing those policies in Perth it is necessary to estimate
transport mode choice behaviour. Chapter 5 analyses transport mode selection
behaviour for travellers’ to the Perth city.
Figure 4.7b: Short and long term impact of combined policy on hourly NOx
![Page 123: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/123.jpg)
Chapter 5: Factors influencing car use
105
CHAPTER FIVE
Factors Influencing Car Use: A Revealed Preference Analysis
Perth city is a prime candidate for car suppression. A rule of thumb is that about 80%
of travellers use public transport to go to the major city centres in the world and 20%
use cars. However the Perth and Regional Travel Survey (PARTS) found the converse.
About 70% use car and 30% use public transport to go to Perth city.
Policies for suppressing car use were identified in Chapter 4 and initial estimates of
their potential for controlling air pollution were made. They showed that pricing and
control measures could reduce CO and NOx levels in Perth city by reducing traffic.
Generalised estimates indicated the likely effectiveness of the proposed policies. This
chapter deals with the next step, estimating private car drivers’ responses in the specific
context of Perth.
Individual responses and mode selection are based mainly on the level of service
provided. Level of service includes travel time and trip cost. Other attributes
associated with each mode include reliability, comfort, and safety, but these are difficult
to quantify. Consequently, the problem of ridership attraction has been discussed
largely in qualitative rather than quantitative terms (Ben-Akiva and Morikawa 2002).
To overcome the quantification problem, researchers may also include socio-
demographic characteristics of individuals in the model to estimate travel demand and
assess travel behaviour.
A mode choice model is developed using the Perth and Regional Travel Survey
(PARTS) data. Section 5.2 discusses the methods used to analyse the choice models.
Section 5.3 refers to the data structure and its description. After that, section 5.4
describes the few assumptions needed to make the database ready for use in choice
modelling. Section 5.5 reports the empirical models using discrete choice analysis and
interprets the models through elasticities and value of travel time savings (VTTS). The
whole chapter is designed to provide insight into traveller mode selection and
behaviour.
![Page 124: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/124.jpg)
Chapter 5: Factors influencing car use
106
5.1 A TWO-PHASE MODELLING APPROACH
Discrete choice analysis is used to model the choice of one among a set of mutually
exclusive alternatives. The estimation of discrete choice models is often based on only
one type of data, usually revealed preference (RP) data based on actual trip records
(Ortuzar and Iacobelli 1998). Another source of information is stated preference (SP)
which captures respondents’ preferences in hypothetical situations. The revealed
preference method has been used widely to analyse travel demand and behaviour in the
transport research field (Caldas and Black 1997). The advantage of RP modelling is
that the data set is based on the individual’s actual behaviour.
In cases where responses to hypothetical stated preference (SP) scenarios are being
tested, there is always an element of doubt about reliabilty and the degree of ‘contextual
realism’ (Swait et al. 1994, Louviere et al. 2000). The now conventional way of
overcoming the difficulties is to combine SP and RP data. The SP data set can provide
measures of the impact of potential air pollution control policies but may not give
unbiased predictions of car travel reactions if respondents misjudge how they would
behave in a real situation. Being based on what has already happened, RP models in
contrast are expected to give unbiased estimates of travel parameters, subject to accurate
model specification and quality of data.
In general, the SP model should not be used to estimate future impacts unless the
parameters are adjusted by a scale factor but for a single data set it is not possible to
estimate a scale factor and it is usually normalised to the constant 1 (Adamowicz et al.
1997, Boxall et al. 2003). In addition to the scale factor problem, SP data have not been
used widely for estimation of predictive models due to unreliability of information from
hypothetical scenarios (Ben-Akiva et al. 1991, Huang et al. 1997, Ortuzar and Iacobelli
1998). Ben-Akiva et al. (1991) refer to the reliability in terms of ‘validity’ and
‘stability’. Lack of validity involves the discrepancy between stated and actual
behaviour of respondents, whereas lack of stability refers to the magnitude of the
random error in SP data.
There is a well established method of combining SP and RP in a special type of nested
logit joint estimation; the two data sets are combined and a relative scale parameter
estimated (Louviere et al. 2000). Morikawa (1994) and others (Ben-Akiva and
Morikawa 1990, Hensher and Bradley 1993, Louviere et al. 2000, Cherchi and Ortuzar
![Page 125: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/125.jpg)
Chapter 5: Factors influencing car use
107
2002) have recommended using SP and RP data jointly to exploit their advantages and
overcome their limitations. The process of pooling RP and SP data and estimating a
model from the pooled data has been called data enrichment (Louviere et al. 2000) and
the purpose of data enrichment is to produce a model which can be used to forecast real
future market scenarios. A number of studies have reported that a combined SP-RP
model produces more efficient estimates. These studies include Adamowicz et al.
(1997), Boxall et al. (2003), Ben-Akiva et al. (1991), Ortuzar and Iacobelli (1998),
Hensher et al. (1999) and Hensher et al. (2005) among many others.
Despite the general acceptance of the SP-RP joint estimation procedure, ‘sequential
estimation’ as presented in Swait et al. (1994) and discussed in Louviere et al. (2000) is
an alternative in which the SP and RP estimations are done separately but the results are
combined. In their discussion of this procedure, Swait et al. (1994) commented: “In our
presentation and empirical application, we used RP and SP data collected from the same
respondents. This need not be the case, of course. The RP data might come from
existing data sets, collected in a form completely independent of the SP data.”
In the present study, combined SP-RP model estimation was not feasible because of the
inherent limitations of a car user survey. An SP survey testing car driver responses to
hypothetical charges could have no RP counterparts to these responses. The only
meaningful answer to an SP scenario was whether the respondent would take their car to
the city or not. The factual section of the study could seek socio-demographic
information about the respondent but there could be no mode choice in the RP data
except taking a car to the city. The consequences are discussed in Chapter 6.
An alternative approach was adopted, dividing choice modelling into two phases. The
first was to develop an RP model of mode selection by travellers to Perth city using a
subset of the Perth and Regional Transport Survey (PARTS) data. However the
questions in the survey limited the estimation of mode choice parameters to trip costs
and parking charges – as well as travel time. Parking charge alone is too generic for the
purposes of this study.
Consequently a second phase was needed to differentiate between potential responses to
hypothetical charges as well as response to a possible lane restriction. The hypothetical
charges would be for entering the city, for large car size and for entry time, as well as a
possible increase in parking charge. The Car Trip Response Survey 2005 was
![Page 126: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/126.jpg)
Chapter 5: Factors influencing car use
108
conducted as the basis for an SP model assessing reactions to the suggested policy
measures. As already noted, the SP data collection could not generate matching RP data
because of different choice sets. The SP data covered the behaviour of car travellers
only.
The problem of the parameters estimated for the detailed measures being based entirely
on the SP responses is addressed by integrating them into the estimated RP model. The
relevant SP model coefficients are converted to the equivalent of the parking fee
coefficient in the RP model. The conversion is made because the SP scenarios are
hypothetical whereas the RP response to the parking fee is an actual response. In reality
any pricing policy imposed on the motorist may be viewed as the cost of taking a car to
a specific location, equivalent to a parking fee. Once the SP estimates are converted to
parking fee equivalents then this value is used through an RP model simulation process.
Details of this method are discussed in Section 8.3. In effect the simulated model
rescales the SP coefficients through the RP parking fee coefficient so that the probable
impacts of the potential policy measures can be realistically assessed. This means that
the impact of a charge for entering the city or a charge for a large vehicles or a charge
according to entry time can be calculated, as well as the impact of an increased parking
fee.
5.2 METHODOLOGY
5.2.1 The Revealed Preference (RP) Model
In the marketing discipline or any other field where consumers make choices, several
steps in reaching a decision are recognised. The first is that consumers become aware
of the needs and/or problems, then they search for information about the products or
services that could satisfy their needs. In searching for information, consumers identify
the features or attributes associated with the products or services. Once consumers have
assessed the attributes of the alternatives, they develop a preference ordering about the
products or services by trading off attributes to maximise satisfaction (utility). Train
(2003) reports that to fit within the discrete choice framework, the set of alternatives
needs to have three characteristics. First, the alternatives must be mutually exclusive
from a decision maker’s perspective. Second, the choice set must be exhaustive, in that
all possible alternatives are included. Third, the number of alternatives must be finite.
![Page 127: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/127.jpg)
Chapter 5: Factors influencing car use
109
This process is also applicable to choosing a transport mode from alternatives to travel
to any destination. Travellers make a choice of either taking a car or riding a bus or
train (depending on availability) to the destination. In making a selection, travellers
usually assess the attributes of modes in terms of in-vehicle time, out of vehicle time
and trip fare or cost. Then they are assumed to maximise satisfaction (utility) in terms
of the attributes associated with the modes and their socio-demographic characteristics.
According to the random utility approach, the probability of choosing a particular
alternative can be expressed as in equation (5.1).
Piq = Pr (Uiq > Ujq) ................................................... (5.1)
= Pr (Viq + εiq > Vjq + εjq)
= Pr (Viq - Vjq > εjq - εiq)
Where Vi is the observed component of the utility function and εi is the unobserved
(random) component. An expanded form of the utility function is shown in equation
(5.2).
iqikikii XU εγβα +++= ……………………….. (5.2)
Where αi is the alternative-specific constant for choice alternative i
βik is the parameter associated with attribute k of choice alternative i
Xik is attribute k of choice alternative i
γq is the systematic (observed) component associated with the individual response
εi is the random (unobserved) component of the individual response
The multinomial logit (MNL) choice model is based on the principles of utility
maximisation and has the advantage of simple mathematical structure (Koppelman and
Wen 1998, Train 2003). However, a basic assumption made in using the MNL model in
discrete choice modelling is the IID assumption, that the variances associated with the
unobserved component of the utility function for each alternative are identical, and
these effects are not correlated between any pair of alternatives (Louviere et al. 2000).
Researchers normalise this unobserved variance term to any number. The simplest and
easiest way of doing that is to attach a scale parameter (τ) to this unobserved term and
normalise the scale parameter by making τ = 1. Multiplying the scale parameter on both
sides of the utility function does not make any difference in choosing an alternative to
maximise utility.
![Page 128: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/128.jpg)
Chapter 5: Factors influencing car use
110
The mathematical expression of the MNL model to estimate the probability of choosing
alternative i from choice set C is shown in equation (5.3).
∑∈
++
++
∑
∑=
Cj
X
X
ik
jjkjkj
kiikiki
e
epεβα
εβα
…...…...………........……… (5.3)
This model implies that when the attributes of one alternative improve (e.g. decreasing
travel time), the probability of choosing that alternative rises and there is a shift to this
alternative from other alternatives. The logit model implies a certain pattern of
substitution across alternatives (Train 2003). For any two alternatives i and m from j
alternatives, the ratio of the logit probabilities is:
mqiq
mq
iq
jq
mq
jq
iq
VVV
V
j
V
Vj
V
V
mq
iq eee
ee
ee
PP −===
∑
∑ ....................................... (5.4)
This ratio does not depend on any alternatives other than i and m. Since, the ratio is
independent of other alternatives, it is said to be independent from irrelevant
alternatives. The logit model is based on this assumption of Independence of Irrelevant
Alternatives (IIA). While the IIA property is realistic in some choice situations, it is
clearly inappropriate in others (Train 2003, Chipman 1960, Debreu 1960). Often the
researcher is unable to capture all sources of correlation explicitly, so that the
unobserved components of utility are correlated and IIA does not hold. In this situation
a more general model than standard logit is needed (Train 2003). The most widely used
general MNL model is Nested Logit (NL) or Hierarchical Logit (HL) which allows
interdependence between the pairs of alternatives in a common group. This assumption
can also be relaxed when the model uses a ‘variable choice set’ for the individual.
Nested logit reflects a more generalised form of multidimensional structure of the
choice set (Ben-Akiva and Lerman 1985).
In this study a nested logit choice model has been developed because the structure of the
choice set can be arranged hierarchically. The modes chosen by the travellers are
mainly car, bus and train. A basic classification of the modes is private and public.
Bus and train are public modes and car is private. About 30% of those who used cars
![Page 129: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/129.jpg)
Chapter 5: Factors influencing car use
111
were passengers and 70% drivers. Hence, the private mode is again divided into car use
as a driver and car use as a passenger categories. The convenient way to picture the
substitution patterns is with a tree diagram. The tree diagram in this case is shown in
Figure 5.1.
The diagram shows two nests with two alternatives in each nest. It is assumed that
unobserved components are more correlated within the nest and less correlated between
the nests. This correlation or justification of using Nested Logit can be measured with
the estimation of the inclusive value (log sum). This term will be discussed in the
subsequent section.
The probability of choosing the alternative car as a driver, for example, using the above
tree diagram can be estimated by using a Bayes probability. This probability is the
product of the conditional probability of choosing car as a driver given that the private
mode is chosen and the marginal probability of choosing the private mode. This
probability is expressed mathematically in equation (5.5).
cqciqiq PPP |= ........................................... (5.5)
Where Piq|c is the conditional probability of individual q choosing alternative i given
that the person chooses nest c, and Pcq is the marginal probability of individual q
choosing nest c. This decomposes Piq in such a way that both the components can take
the logit form. The marginal and conditional probabilities can be expressed as:
∑ +
+
=lqlcl
cqccq
IZ
IZ
cq eeP τ
τ
....................................... (5.6)
Private Public
Car as driver
Car as passenger
Bus Train
Figure 5.1: Hierarchical structure of mode distribution for travellers to Perth City
![Page 130: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/130.jpg)
Chapter 5: Factors influencing car use
112
∑
=cij
ciq
Y
Y
ciq eeP τ
τ
/
/
| ........................................ (5.7)
Zcq is the observed component of utility which is variable over the nests, but not over
the alternatives within each nest, and Yiq is another observed component which is
variable over alternatives within a nest. ∑= ciqYcq eI τ/ln , is called the inclusive value.
The value of Icq links the upper and lower models by bringing information from the
lower model into the upper model. A higher value of τc means greater independence
and less correlation, which leads to a lower inclusive value. This model is applicable
where the dataset can be arranged as in Figure 5.1.
5.2.2 Elasticities
Although the probabilities estimated from the dataset are important in an appropriate
model, it is often useful to have a generalised measure of response to a change in some
observed factor. This is done by computing the elasticity. Estimating own and cross
elasticities using the logit model helps to assess people’s responsiveness to any attribute
in choosing any alternative.
The probabilities in equations (5.5, 5.6, and 5.7) can be used to calculate the own or
direct elasticity as well as the cross-elasticities of demand for the mode. The first step
in calculating the weighted average is the probability weighted direct elasticity for
person q is expressed in equation (5.8).
iqiq
ikq
ikq
iqPx P
PX
XP
E iq
ikq..
∂∂
= …………………….....……. (5.8)
Therefore the probability weighted direct point elasticity for person q from the logit
model is:
iqiqikqikPx PPXE iq
ikq)1( −= β ................................................ (5.9)
And the probability weighted cross elasticity of person q’s choice mode i with respect to
attribute Xjkq of mode j is:
iqjqjkqjkPx PPXE iq
jkqβ−= ........................................................... (5.10)
These weighted individual elasticities are summed and divided by the sum of the
weights Piq to obtain a weighted average elasticity, which is shown in equation (5.11).
![Page 131: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/131.jpg)
Chapter 5: Factors influencing car use
113
∑∑=
iq
PX
w PE
Eiq
ikq
……………………………………. (5.11)
In this case the elasticities measure how an increase in trip cost on one mode decreases
the demand for that mode and increases demand for other modes.
5.2.3 Value of travel time saving (VTTS)
A by-product of this analysis is an estimate of the value of travel time saving (VTTS).
If the utility model contains a travel-time (tt) attribute and trip-cost (tc) attribute then
VTTS can be estimated by the simple calculation shown in equation (5.12) (Hess et al.
2005).
tcVttVVTTS
∂∂∂∂
=//
........................................................................ (5.12)
Equation (5.12) reduces to tctt ββ / , where βtt and βtc are the time and the cost
coefficients in the choice model. Equation (5.12) is based on the assumption that the
derivative of the unobserved part of utility with respect to travel-time and trip-cost is
zero.
The choice elasticities of transport modes and the value of travel time saving have been
estimated using a nested logit model with a dataset extracted from the Perth and
Regions Travel Survey (PARTS). This is an on-going project started in 2002. The time
frame of the data set used in this study is between 2002 and 2003.
5.3 DATA STRUCTURE
The PARTS database was designed for other purposes than this study. The data were
collected in two different forms. One is information about the respondents’ households
and the other is about daily trips. The entire database contains around 15000 trip
records. In this analysis, the records selected were for those who stopped first at Perth
city on their travel day. The number of those records is 406; however 30 who cycled or
walked to the city and the one who used taxi were excluded from the analysis. The
study considers those trips where only car or bus or train were used as a mode of
transport; this number of records is 375. Table 5.1 summarises the characteristics of the
![Page 132: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/132.jpg)
Chapter 5: Factors influencing car use
114
travellers. Some descriptive statistics of this dataset are provided in the following
paragraphs.
Car use dominates other modes. 70% of the travellers used car, 14% used bus and 16%
train. Of those who used cars about 30% rode as passengers. This passenger group can
be identified by licence status or being in the minor age group.
Table 5.1: Characteristics of sampled travellers to Perth city (from PARTS survey 2002-03)
Frequency Percent Main Mode
Car as driver 188 50.1 Car as passenger 75 20.0 Bus 54 14.4 Train 58 15.5
Gender
Female 190 50.7 Male 185 49.3
Income
Not reported 65 17.3 No income 31 8.3 $1 - $199 per week 35 9.3 $200 - $399 per week 34 9.1 $400 - $599 per week 35 9.3 $600 - $799 per week 48 12.8 $800 - $999 per week 41 10.9 $1000 - $1499 per week 50 13.3 $1500+ per week 36 9.6
Purpose of trip Work 143 38.1 Non-work 232 61.9 No. of vehicles in household
No car 10 2.7 1 car 94 25.1 2 cars 180 48.0 3 cars 58 15.5 4 cars 22 5.9 5 cars 10 2.7 6 cars 1 0.3
Licence status
Full licence 318 84.8 P-plates 8 2.1 Learners permit 6 1.6 No licence 43 11.5
Mean SD Age 39.10 15.80 Travel time (min) 23.83 12.12 Distance travelled (km) 13.52 9.12
![Page 133: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/133.jpg)
Chapter 5: Factors influencing car use
115
An important characteristic is income which was reported in a range per week.
However, about 17% of the respondents did not report their income.
Many travellers made their trips to Perth city by public transport even though they had
car(s) in their household. About 72% of the reduced sample of households had 2 or
more cars and 3% had no car. Among the respondents about 11% had no driver’s
licence. This group would not have the choice alternative of car as driver.
Travel time is one of the major considerations in making a mode selection decision.
Mean travel time is 39.1 min with standard deviation of 12.12 min. Mean distance
travelled is 13.52 km with standard deviation of 9.12 km.
The descriptive statistics give an overview of those who travel to the city on a regular or
occasional basis. As the survey was done for different purposes from the objectives of
this study, data needed to be prepared to be useful for a mode choice model by making
some reasonable assumptions.
5.4 ASSUMPTIONS FOR DATA IMPUTATION
The PARTS database can be used to develop a mode choice model after making some
logical assumptions about each individual’s choice set. The main attributes of the
modes are travel-time and trip-cost. The database contains only actual travel time spent
on the mode used by the traveller. There is no estimated travel time for other
alternatives. A logical approach is used to estimate travel time and trip cost for each
alternative mode in each case. Assumptions used for imputing data are:
a) In-vehicle travel times for car use as a driver and as a passenger are assumed to
be the same.
b) In-vehicle travel time for car is the actual time spent by the travellers using car.
It is assumed that the same time from the same suburb would be the option for
those who haven’t used their car.
c) In-vehicle travel time for bus is estimated using the Transperth web site
http://www.transperth.wa.gov.au/DesktopDefault.aspx. The “Journey Planner”
link provides alternative routes with estimated duration of trip if someone used
only bus from a particular suburb to ‘William Street’ in Perth city. The quickest
time is taken to be the travel-time by bus.
![Page 134: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/134.jpg)
Chapter 5: Factors influencing car use
116
d) The same procedure is used to estimate travel-time for train only. However,
some of the suburbs do not have train service. For them the train mode is not an
alternative choice.
e) After estimating in-vehicle time, access and egress time are added for different
modes. Five minutes egress time is added to in-vehicle time for the car as
driver mode, whereas 2 minutes are added for car as passenger mode. On the
other hand a total of 15 minutes are added as access and egress time for both bus
and train modes.
f) Trip-costs for car as driver and car as passenger are considered to be the same.
For the car mode, trip-cost is considered to be only fuel cost. Fuel consumption
is estimated by assuming average performance by the car used in this case.
According to the Bureau of Transport and Regional Economics
(www.btre.gov.au/docs/r107/r107.pdf) the average on-road fuel performance of
cars in Australian cities is 11-12 litres per 100 km. A performance of 11.5 litres
per 100 km is used as the estimate of car fuel consumption.
g) It is assumed that only unleaded petrol is used. Monthly average unleaded petrol
price per litre is used to calculate fuel cost. Average monthly petrol price for the
years 2002 and 2003 (Appendix-5A) has been collected from the Australian
Automobile Association’s web site (http://www.aaa.asn.au/petrol.htm).
h) The product of fuel consumption and monthly average petrol price gives trip-
cost for the car mode.
i) In the case of bus and train, a standard ‘MultiRider 40’ rate is used to estimate
the trips fare. This rate varies among Transperth zones. The fare is estimated
according to each traveller’s origin zone (Appendix-5B).
j) Hourly parking fee is imputed on the basis of individual situations. First the
specific location of the destination (according to Main Roads WA zone number)
is identified for each individual and then the closest parking place located from
the parking map of the City of Perth. Then the hourly parking fee is recorded
for that parking space assuming that the individual would park at that location.
In the choice model travel-time and trip-cost are used as attributes associated with the
modes.
![Page 135: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/135.jpg)
Chapter 5: Factors influencing car use
117
5.5 MODEL ESTIMATION
To estimate the parameters of the utility functions the LIMDEP statistical package was
used. Every choice alternative for a respondent required one row of data. That means
for one respondent there will be 4 rows of information for 4 mode choice alternatives
with their corresponding attributes. A sample of data presentation is shown in
Appendix-5C.
Before formulating the model the number of choices available for each individual was
identified. The maximum number of choice alternatives was 4, car as driver, car as
passenger, bus, and train, but not all of them were available to all travellers, and the set
of choices varies between 1 and 4. This variable choice set is determined on the basis of
physical and logical availability of the alternatives.
• Those who do not have a drivers licence will not have the car as driver choice.
• Those who live in suburbs where train service is not offered will not have the
train choice.
• Those who do not have a car will not have car as driver or car as passenger
choices.
On the basis of the above conditions the choice sets are as follows:
i) CSET = 1, means only Bus
ii) CSET = 2, means EITHER CarP and Bus OR Bus and Train
iii) CSET = 3, means EITHER CarD, CarP, & Bus OR CarP, Bus, & Train
iv) CSET = 4, means CarD, CarP, Bus, & Train
Where CSET is variable choice set
CarD is car as driver
CarP is car as passenger
The independent variables used in developing the logit model are:
Travel Time (TRAVELTIME): Total time spent on the mode including access
and egress time (in minutes).
Trip Cost (TRIPCOST): Fuel cost for CarD and CarP, and fare for Bus and
Train ($ per trip).
![Page 136: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/136.jpg)
Chapter 5: Factors influencing car use
118
Parking fee (PARKHOUR): Parking fee per hour ($).
Age (AGE): Age in years of the respondent.
Gender (GENDER): A dummy variable, 1 for males and 0 for females.
The study has gone through several steps. First the MNL model was developed with
only attributes associated with the modes, and then another MNL model including some
socio-demographic factors was developed. After that, the NL model was formulated
and finally a NL model with different travel time parameters for different modes was
developed.
5.5.1 Multinomial Logit (MNL) Model
The first model, a preliminary model using only the attributes associated with the
modes, travel time and trip cost, without socio-demographic variables, gave results
which were not good. The log likelihood was -350.99 with pseudo R2 of 0.24 and
t-ratios for travel time and trip cost were poor (Appendix-5D).
The second model, an MNL with socio-demographic variables had these utility
functions:
UcarD = αcarD + βtt * TRAVELTIME + βtc* TRIPCOST + βpark* PARKHOUR
UcarP = αcarP + βtt * TRAVELTIME + βtc* TRIPCOST + βage* AGE + βgender* GENDER
UBus = αBus + βtt * TRAVELTIME + βtc* TRIPCOST
UTrain = βtt * TRAVELTIME + βtc* TRIPCOST
Where, βtt is the coefficient for travel time, βtc trip cost, βpark for hourly parking fee, βage
for age, βgender for gender (a dummy variable), and α is the alternative specific constant
(ASC). There is no ASC for train so that the other ASCs are estimated relative to the
train alternative. Because the socio-demographic variables have the same values across
all alternatives, they have been included in only some utility functions. The minor age
group can be logically included in the utility function for car as a passenger. Clearly
parking cost is associated with the person driving the car. The expected signs of the
coefficients for travel time, trip cost, and parking fee are negative as people maximise
utility by minimising costs. Again, if the sign of the ASC for car as a passenger mode
is positive, then the expected signs for gender and age are negative, implying that males
are more likely to drive and minors are likely to be a passenger.
![Page 137: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/137.jpg)
Chapter 5: Factors influencing car use
119
The estimated MNL model coefficients using the above model specification are shown
in Table 5.2 and the model output from LIMDEP is provided in Appendix-5E.
Table 5.2: Estimated results: MNL model with socio-demographic variables
Parameters Coefficient Std. Error t-ratio
βtt -0.0073 0.008 -0.89
βtc -0.3499 0.259 -1.35
βpark -0.2388 0.317 -0.75
βage -0.0301 0.009 -3.17
βgender -0.8233 0.295 -2.78
αcarD 0.132 0.469 0.28
αcarP 0.104 0.452 0.23
αBus -1.353 0.258 -5.23
In the results the coefficients for travel-time, trip-cost, and parking fee are negative, as
expected. Travel time, trip cost, and parking fee are inversely related to mode selection,
meaning that travellers try to maximise utility by reducing travel time and trip cost. The
t-ratios indicate generally low levels of confidence in the estimated parameters, which
may reflect misspecification of the model or poor quality of data. The log likelihood of
the model, used for comparing with other models, is -340.80 with pseudo R2 of 0.26.
The closer the log likelihood to zero the better the model.
5.5.2 Nested Logit (NL) Model
A more appropriate model was developed using the NL model with a tree structure as in
Figure 5.1. Two nests were specified as private and public, with two alternatives under
each of these nests. The nested logit model is more appropriate here as people using
private and public modes may be influenced by different factors. To capture this
heterogeneity of individuals, the NL model is more realistic. The NL model produces
comparatively better results with the log likelihood of -339.88. Adjusted Pseudo R2 is
0.34, which again does not mean much except to compare with other models. The
model is shown in Table 5.3 (for detail see Appendix-5F).
![Page 138: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/138.jpg)
Chapter 5: Factors influencing car use
120
Table 5.3: Estimated results with NL model
Parameters Coefficient Std. Error t-ratio
βtt -0.0135 0.01 -1.33
βtc -0.398 0.20 -1.90
βpark -0.295 0.32 -0.93
βage -0.031 0.01 -3.24
βgender -0.804 0.29 -2.74
αcarD 0.444 0.51 0.87
αcarP 0.357 0.46 0.76
αBus -1.493 0.31 -4.77
IV parameters, tau(j|i,l),sigma(i|l),phi(l)
PRIVATE 1.000 0.00 Fixed
PUBLIC 0.780 0.144 5.41
This model produces better results as t-ratios are appreciably larger in absolute value
than in the MNL models. The inclusive value (IV) parameter for the private mode was
fixed to estimate IV for the public mode. The estimated IV parameter for public of 0.78
implied that the two nests are not highly correlated, indicating the superiority of the NL
model over the MNL model. An IV parameter approaching zero would imply
independent nests. The success table (crosstab) for the NL model is shown in Table 5.4.
Table 5.4: Success table for NL model (Successes are in bold on the diagonal)
Car as a driver
Car as a passenger
Bus Train Total
Car as a driver 114 29 24 22 188
Car as a passenger 30 27 12 5 75
Bus 25 10 14 6 54
Train 20 9 4 25 58
5.5.3 Nested Logit Model with different time parameters (NLDT)
Other associated attributes such as ability to read during the trip mean that a given time
on car, bus and train may not be viewed as the same. Therefore another NL model was
![Page 139: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/139.jpg)
Chapter 5: Factors influencing car use
121
developed using different travel time parameters for car, bus, and train. The results are
shown in Table 5.5 (details in Appendix-5G).
Table 5.5: Estimated results with NL model with different travel time parameter (NLDT)
Coefficient Std. Error t-ratio
βtt_car -0.010 0.01 -0.65
βtt_bus -0.066 0.03 -2.27
βtt_train 0.034 0.02 1.44
βtc -0.706 0.31 -2.27
βpark -0.285 0.32 -0.89
βage -0.031 0.01 -3.18
βgender -0.834 0.29 -2.82
αcarD 1.591 0.72 2.19
αcarP 1.525 0.68 2.23
αBus 2.388 1.24 1.91
IV parameters, tau(j|i,l),sigma(i|l),phi(l)
PRIVATE 1.000 0.00 Fixed PUBLIC 0.621 0.14 4.35
Although the t-ratios for the time parameters raise difficulties, the log likelihood of
-329.07 is better than for the simpler NL model. The Pseudo R2 (0.36) also indicates a
better model. One of the main issues here is the positive sign of the travel time
parameter for train. Hess et al. (2005) report that the use of an unbounded distribution
(Normal) may lead to a non-zero probability of a positive travel-time coefficient. The
sign could be an artefact of the model specification or the poor quality of the data used
in the model (Hess et al. 2005). Few cases have been found where the disutility of
travel time by train is estimated to be less than for car travel time but it is just possible
that this estimate partly reflects the opportunity to read in comfort on the train.
The estimate of train travel time was based on the Transperth web site from ‘suburb
train station’ to Perth city station which may be too short. In some cases, car travel time
from the same suburb to the Perth city is more than the estimated train travel time. The
problem is due to not knowing the exact location of the traveller’s origin point. Precise
location of the origin would help to estimate travel time accurately. The success table
(Table 5.6) gives better predictions than before.
![Page 140: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/140.jpg)
Chapter 5: Factors influencing car use
122
Table 5.6: Success table for NL model with different travel times (Successes are in bold on the diagonal)
Car as a driver
Car as a passenger
Bus Train Total
Car as a driver 116 29 24 19 188
Car as a passenger 30 28 13 4 75
Bus 25 10 15 5 54
Train 18 8 3 28 58
Table 5.7 shows comparative results for the different models. Although the NLDT
model produces better log likelihood and pseudo R2 and even better crosstabs, the
unreliable coefficient estimates for car and train travel-time weaken the model.
Consequently the simpler NL model is considered the best estimator for mode choice
decisions from this dataset.
Table 5.7: Comparative results from different models, coefficient (t-ratio) MNL without
socio-demo MNL with socio-demo
NL NLDT
βtt -0.007 (-0.91) -0.007 (-0.89) -0.014 (-0.87)
βtt_car -0.010 (-0.65)
βtt_bus -0.066 (-2.27)
βtt_train 0.034 (1.44)
βtc -0.358 (-1.38) -0.350 (-1.35) -0.398 (-1.90) -0.706 (-2.27)
βpark -0.238 (-0.75) -0.295 (-0.93) -0.285 (-0.89)
βage -0.030 (-3.17) -0.031 (-3.24) -0.031 (3.18)
βgender -0.823 (-2.78) -0.804 (-2.74) -0.834 (-2.82)
αcarD -0.131 (-0.48) 0.132 (0.28) 0.444 (0.87) 1.591 (2.19)
αcarP -1.365 (-4.65) 0.104 (0.23) 0.357 (0.76) 1.525 (2.23)
αBus -1.404 (-5.40) -1.353 (-5.23) -1.493 (-4.77) 2.388 (1.91)IV parameters
PRIVATE 1.000 (fixed) 1.000 (fixed)PUBLIC 0.780 (5.41) 0.621 (4.35)
Log likelihood for function -350.99 -340.80 -339.88 -337.59
Pseudo R2 0.34 0.36
Further exploratory study identified two groups of respondents, work and non-work.
Two separate nested logit models were estimated with the same model specification as
![Page 141: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/141.jpg)
Chapter 5: Factors influencing car use
123
the first NL model. Neither provided a better model, mainly because of small sample
sizes. Only 143 respondents entered the city for work purposes and 232 for non-work
purposes (Table 5.1). These two groups are small in size for discrete choice modelling.
5.5.4 Elasticity Estimation
The NL model is used to estimate direct and cross elasticities of mode choice with
respect to trip cost. The NL model output has been used to estimate a set of probability
weighted direct and cross elasticities (top part of Table 5.8). The SUMPRODUCTs of
each column and the number of trips for the top part of Table 5.8 are not zero, which
conflicts with the requirement that the total number of trips before and after switching
modes should be the same. This means that there is no trip generation effect (Taplin
1982, Taplin et al. 1999). The bottom part of Table 5.8 has been adjusted with Solver
to satisfy the following conditions.
• The Sumproduct of each column and the number of trips is zero, i.e. a traveller
changing from one mode must travel by another.
• The cross-elasticities below the diagonal are symmetric with those above.
Expressed in equation (5.13):
jii
jij e
ExpExp
e = ....................................................... (5.13)
Where, eij is choice elasticity for mode i with respect to cost of mode j
eji is choice elasticity for mode j with respect to cost of mode i
Expj is expenditure on mode j
Expi is expenditure on mode i
• The cross-elasticities are assumed to be non-negative as these modes are
substitutes for one another.
![Page 142: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/142.jpg)
Chapter 5: Factors influencing car use
124
Table 5.8: Direct and Cross-elasticities with respect to the trip cost
Original
Car as driver cost
Car as passenger
cost
Bus fare Train fare
Car as driver -0.229 0.092 0.086 0.070
Car as passenger 0.230 -0.399 0.113 0.069
Bus 0.270 0.150 -0.532 0.080
Train 0.192 0.079 0.076 -0.395
Adjusted Trips
Car as driver -0.229 0.159 0.066 0.035 188
Car as passenger 0.399 -0.399 0.000 0.000 75
Bus 0.159 0.000 -0.532 0.301 54
Train 0.079 0.000 0.281 -0.395 58
Column sumproduct 0.000 0.000 0.000 0.000
On the no-generation assumption, if the bus fare is increased by 1% then the demand for
bus would be reduced by 0.53%, and at the same time the demand for car as driver and
train would be increased by 0.07%, and 0.28% respectively, but there would be no shift
from car as a passenger mode. These elasticities are comparable to the estimates made
by Louviere et al. (2000).
5.5.5 Value of Travel Time Savings (VTTS) Estimation
Although it is a by-product of the study, the estimate of the value of travel time saving
(VTTS) provides a means of comparison and validation in relation to previous studies.
On the average, travellers will trade off travel time against trip cost on the different
modes. The VTTS is estimated according to equation (5.11). The NLDT model has the
opportunity to estimate VTTS for different modes, but a model indicating a non-zero
probability of positive travel-time coefficient should not be used in VTTS calculation
(Hess et al. 2005). The VTTS of $2.04 per hour is estimated using the simpler NL
model. This value is comparable to the estimate by Louviere et al. (2000).
5.6 DISCUSSION AND CONCLUSION
The modelling work reported in this chapter has provided a set of estimates relating
specifically to travel to Perth city. The most important is the estimate of response to
travel cost which can be used to predict the effects of car suppression measures.
![Page 143: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/143.jpg)
Chapter 5: Factors influencing car use
125
Unfortunately the estimated coefficient with respect to parking fees has a small
t-statistics so that it is not as reliable as had been hoped.
Thus the model provided estimates indicating that further refinement was needed. As
the available data source had been exhausted, this could only be achieved by a targeted
survey using stated choice.
Two alternative multinomial logit models and two nested logit models had been
developed for travellers’ mode choice. Travellers to Perth city used mainly four modes:
car as driver, car as passenger, bus, and train. This part of the study investigated
reasons for using different modes to travel to Perth city. Travel-time and trip-cost are
the main attributes travellers consider at the time of mode selection. However, some
other socio-demographic factors also influence their decisions. Two MNL models were
developed, one with only travel-time and trip-cost and another including some socio-
demographic factors. Both models produced poorer fit as compared to NL models.
Two nested logit models provided better results from this dataset.
This part of the study provides insight into the behaviour of people who travel to Perth
city regularly, especially with regard to the costs of their own and other modes. As the
main objectives of this project is to assess the behaviour of car users when subjected to
charges and/or other measures, the stated preference survey reported in the next chapter
was needed to give a more complete assessment of travellers’ reactions to the various
measures indicated in Chapter 4.
![Page 144: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/144.jpg)
Chapter 5: Factors influencing car use
126
Appendix-5A
Table 5A1: Monthly average unleaded petrol price
Month Perth Metro Average
(cents per litre) October 2002 92.5 November 2002 89.8 December 2002 90.6 January 2003 95.1 February 2003 98.7 March 2003 102.0
Source: www.aaa.asn.au/petrol.htm (Australian Automobile Association)
![Page 145: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/145.jpg)
Chapter 5: Factors influencing car use
127
Appendix-5B
Table 5B1: Public Transport Fares
Cash MultiRider 10 MultiRider 40 Standard Concession Standard Concession Standard Concession 2 Section $ 1.30 $ 0.50 $ 11.05 $ 4.25 $ 39.00 $ 15.00 1 Zone $ 2.00 $ 0.80 $ 17.00 $ 6.80 $ 60.00 $ 24.00 2 Zone $ 3.00 $ 1.30 $ 25.50 $ 11.05 $ 90.00 $ 39.00 3 Zones $ 3.80 $ 1.60 $ 32.30 $ 13.60 $ 114.00 $ 48.00 4 Zones $ 4.50 $ 1.90 $ 38.25 $ 16.15 $ 135.00 $ 57.00 5 Zones $ 5.50 $ 2.10 $ 46.75 $ 17.85 $ 165.00 $ 63.00 6 Zones $ 6.40 $ 2.40 $ 54.40 $ 20.40 $ 192.00 $ 72.00 7 Zones $ 7.30 $ 2.80 $ 62.05 $ 23.80 $ 219.00 $ 84.00 8 Zones $ 8.00 $ 3.10 $ 68.00 $ 26.35 $ 240.00 $ 93.00 DayRider $ 7.50 $ 3.00 NA $ 25.50 NA $ 90.00 FamilyRider $ 7.50 NA NA NA NA NA
Source: http://www.transperth.wa.gov.au/DesktopDefault.aspx?tabid=26
![Page 146: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/146.jpg)
Chapter 5: Factors influencing car use
128
Appendix-5C
Table 5C1: First 16 observations of the data set
ID choice cset mode travel time trip cost park fee gender age
1 0 3 2 32 2.39 0.00 1 161 0 3 3 85 2.85 0.00 1 161 1 3 4 36 2.85 0.00 1 162 0 3 1 35 2.44 1.50 1 302 1 3 2 32 2.44 0.00 1 302 0 3 3 85 2.85 0.00 1 303 1 3 1 35 2.55 1.20 0 273 0 3 2 32 2.55 0.00 0 273 0 3 3 85 2.85 0.00 0 274 1 1 3 50 2.25 0.00 1 435 1 1 3 50 2.25 0.00 0 726 0 3 1 25 1.13 1.30 0 346 0 3 2 22 1.13 0.00 0 346 1 3 3 50 2.25 0.00 0 347 0 3 1 25 1.04 1.50 0 307 0 3 2 22 1.04 0.00 0 307 1 3 3 50 2.25 0.00 0 308 1 4 1 30 1.39 0.70 0 238 0 4 2 27 1.39 0.00 0 238 0 4 3 45 2.25 0.00 0 238 0 4 4 26 2.25 0.00 0 239 0 3 1 30 1.16 0.70 0 299 0 3 2 27 1.16 0.00 0 299 1 3 3 60 2.25 0.00 0 29
10 1 3 1 25 1.19 1.30 1 4810 0 3 2 22 1.19 0.00 1 4810 0 3 3 55 2.25 0.00 1 4811 0 3 1 30 1.22 1.20 1 7511 1 3 2 27 1.22 0.00 1 7511 0 3 3 55 2.25 0.00 1 7512 0 3 2 17 0.67 0.00 0 1512 0 3 3 30 1.50 0.00 0 1512 1 3 4 26 1.50 0.00 0 1513 1 4 1 20 1.09 1.20 0 3513 0 4 2 17 1.09 0.00 0 3513 0 4 3 42 2.25 0.00 0 3513 0 4 4 31 2.25 0.00 0 3514 1 3 1 20 1.13 1.40 0 4714 0 3 2 17 1.13 0.00 0 4714 0 3 3 35 2.25 0.00 0 4715 0 3 1 20 1.09 1.50 0 1915 1 3 2 17 1.09 0.00 0 1915 0 3 3 35 2.25 0.00 0 1916 1 4 1 35 1.14 1.20 1 3116 0 4 2 32 1.14 0.00 1 3116 0 4 3 47 2.25 0.00 1 3116 0 4 4 115 2.25 0.00 1 31
![Page 147: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/147.jpg)
Chapter 5: Factors influencing car use
129
Appendix – 5D
Multinomial Logit Model (MNL) without socio-demographic variable --> sample;all$ --> NLOGIT; lhs=CHOICE,CSET,MODE; CHOICES=carD,carP,bus,train; MODEL: U(carD)=A_carD+time*TRAVELTI+cost*TRIPCOST/ U(carP)=A_carP+time*TRAVELTI+cost*TRIPCOST/ U(bus)=A_bus +time*TRAVELTI+cost*TRIPCOST/ U(train)= time*TRAVELTI+cost*TRIPCOST; crosstab; $ Normal exit from iterations. Exit status=0. +---------------------------------------------+ | Discrete choice (multinomial logit) model | | Maximum Likelihood Estimates | | Model estimated: Dec 21, 2005 at 11:21:27AM.| | Dependent variable Choice | | Weighting variable None | | Number of observations 375 | | Iterations completed 5 | | Log likelihood function -350.9941 | | Number of parameters 5 | | Info. Criterion: AIC = 1.89864 | | Finite Sample: AIC = 1.89907 | | Info. Criterion: BIC = 1.95099 | | Info. Criterion:HQIC = 1.91942 | | R2=1-LogL/LogL* Log-L fncn R-sqrd RsqAdj | | Constants only. Must be computed directly. | | Use NLOGIT ;...; RHS=ONE $ | | Chi-squared[ 2] = 224.85927 | | Prob [ chi squared > value ] = .00000 | | Response data are given as ind. choice. | | Number of obs.= 375, skipped 0 bad obs. | +---------------------------------------------+ +---------+--------------+----------------+--------+---------+ |Variable | Coefficient | Standard Error |b/St.Er.|P[|Z|>z] | +---------+--------------+----------------+--------+---------+ A_CARD -.13108203 .26901136 -.487 .6261 TIME -.00753565 .00826683 -.912 .3620 COST -.35783243 .25957887 -1.379 .1680 A_CARP -1.36572973 .29347376 -4.654 .0000 A_BUS -1.40384979 .25974305 -5.405 .0000 +------------------------------------------------------+ | Cross tabulation of actual vs. predicted choices. | | Row indicator is actual, column is predicted. | | Predicted total is F(k,j,i)=Sum(i=1,...,N) P(k,j,i). | | Column totals may be subject to rounding error. | +------------------------------------------------------+ Matrix Crosstab has 5 rows and 5 columns. CARD CARP BUS TRAIN Total +----------------------------------------------------------- CARD | 112.00000 33.00000 21.00000 22.00000 188.00000 CARP | 31.00000 23.00000 14.00000 6.00000 75.00000 BUS | 24.00000 11.00000 14.00000 6.00000 54.00000 TRAIN | 21.00000 8.00000 5.00000 24.00000 58.00000 Total | 188.00000 75.00000 54.00000 58.00000 375.00000
![Page 148: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/148.jpg)
Chapter 5: Factors influencing car use
130
Appendix – 5E
Multinomial Logit Model (MNL) with socio-demographic variable --> sample;all$ --> NLOGIT; lhs=CHOICE,CSET,MODE; CHOICES=carD,carP,bus,train; MODEL: U(carD)=A_carD+time*TRAVELTI+cost*TRIPCOST+park*PARKHOUR/ U(carP)=A_carP+time*TRAVELTI+cost*TRIPCOST+age*AGE+sex*SEX/ U(bus)=A_bus +time*TRAVELTI+cost*TRIPCOST/ U(train)= time*TRAVELTI+cost*TRIPCOST; crosstab; $ Normal exit from iterations. Exit status=0. +---------------------------------------------+ | Discrete choice (multinomial logit) model | | Maximum Likelihood Estimates | | Model estimated: Dec 21, 2005 at 11:20:54AM.| | Dependent variable Choice | | Weighting variable None | | Number of observations 375 | | Iterations completed 5 | | Log likelihood function -340.8038 | | Number of parameters 8 | | Info. Criterion: AIC = 1.86029 | | Finite Sample: AIC = 1.86134 | | Info. Criterion: BIC = 1.94406 | | Info. Criterion:HQIC = 1.89355 | | R2=1-LogL/LogL* Log-L fncn R-sqrd RsqAdj | | Constants only. Must be computed directly. | | Use NLOGIT ;...; RHS=ONE $ | | Chi-squared[ 5] = 245.23980 | | Prob [ chi squared > value ] = .00000 | | Response data are given as ind. choice. | | Number of obs.= 375, skipped 0 bad obs. | +---------------------------------------------+ +---------+--------------+----------------+--------+---------+ |Variable | Coefficient | Standard Error |b/St.Er.|P[|Z|>z] | +---------+--------------+----------------+--------+---------+ A_CARD .13207640 .46911504 .282 .7783 TIME -.00728143 .00819382 -.889 .3742 COST -.34996669 .25983471 -1.347 .1780 PARK -.23888875 .31748547 -.752 .4518 A_CARP .10402306 .45207203 .230 .8180 AGE -.03017605 .00952802 -3.167 .0015 SEX -.82329925 .29572224 -2.784 .0054 A_BUS -1.35370226 .25880361 -5.231 .0000 +------------------------------------------------------+ | Cross tabulation of actual vs. predicted choices. | | Row indicator is actual, column is predicted. | | Predicted total is F(k,j,i)=Sum(i=1,...,N) P(k,j,i). | | Column totals may be subject to rounding error. | +------------------------------------------------------+ Matrix Crosstab has 5 rows and 5 columns. CARD CARP BUS TRAIN Total +------------------------------------------------------------- CARD | 114.00000 29.00000 23.00000 22.00000 188.00000 CARP | 30.00000 28.00000 12.00000 6.00000 75.00000 BUS | 24.00000 10.00000 14.00000 6.00000 54.00000 TRAIN | 19.00000 9.00000 5.00000 24.00000 58.00000 Total | 188.00000 75.00000 54.00000 58.00000 375.00000
![Page 149: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/149.jpg)
Chapter 5: Factors influencing car use
131
Appendix – 5F Nested Logit Model (NL) with socio-demographic variable --> sample;all$ --> NLOGIT; lhs=CHOICE,CSET,MODE; CHOICES=carD,carP,bus,train; Tree=mode[Private(carD,carP),Public(bus,train)]; IVSET:(PRIVATE)=[1]; MODEL: U(carD)=A_carD+time*TRAVELTI+cost*TRIPCOST+park*PARKHOUR/ U(carP)=A_carP+time*TRAVELTI+cost*TRIPCOST+age*AGE+sex*SEX/ U(bus)=A_bus +time*TRAVELTI+cost*TRIPCOST/ U(train)= time*TRAVELTI+cost*TRIPCOST; effects:tripcost(carD,carP,bus,train); crosstab; $ Normal exit from iterations. Exit status=0. +---------------------------------------------+ | FIML Nested Multinomial Logit Model | | Maximum Likelihood Estimates | | Model estimated: Dec 21, 2005 at 11:29:25AM.| | Dependent variable CHOICE | | Weighting variable None | | Number of observations 1211 | | Iterations completed 19 | | Log likelihood function -339.8810 | | Number of parameters 9 | | Info. Criterion: AIC = .57619 | | Finite Sample: AIC = .57631 | | Info. Criterion: BIC = .61408 | | Restricted log likelihood -519.8604 | | Chi squared 359.9587 | | Degrees of freedom 9 | | Prob[ChiSqd > value] = .0000000 | | R2=1-LogL/LogL* Log-L fncn R-sqrd RsqAdj | | No coefficients -519.8604 .34621 .33909 | | Constants only. Must be computed directly. | | Use NLOGIT ;...; RHS=ONE $ | | At start values -429.9295 .20945 .20085 | | Response data are given as ind. choice. | +---------------------------------------------+ +---------+--------------+----------------+--------+---------+ |Variable | Coefficient | Standard Error |b/St.Er.|P[|Z|>z] | +---------+--------------+----------------+--------+---------+ Attributes in the Utility Functions (beta) A_CARD .44488124 .51069273 .871 .3837 TIME -.01352926 .01018200 -1.329 .1839 COST -.39840195 .20936806 -1.903 .0571 PARK -.29537137 .31799156 -.929 .3530 A_CARP .35774450 .46919161 .762 .4458 AGE -.03078216 .00950570 -3.238 .0012 SEX -.80485260 .29403670 -2.737 .0062 A_BUS -1.49335336 .31308826 -4.770 .0000 IV parameters, tau(j|i,l),sigma(i|l),phi(l) PRIVATE 1.00000000 ......(Fixed Parameter)....... PUBLIC .78047141 .14405139 5.418 .0000 +------------------------------------------------------+ | Cross tabulation of actual vs. predicted choices. | | Row indicator is actual, column is predicted. | +------------------------------------------------------+ Matrix Crosstab has 5 rows and 5 columns. CARD CARP BUS TRAIN Total +------------------------------------------------------------- CARD | 114.00000 29.00000 24.00000 22.00000 188.00000 CARP | 30.00000 27.00000 12.00000 5.00000 75.00000 BUS | 25.00000 10.00000 14.00000 6.00000 54.00000 TRAIN | 20.00000 9.00000 4.00000 25.00000 58.00000 Total | 188.00000 75.00000 55.00000 57.00000 375.00000
![Page 150: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/150.jpg)
Chapter 5: Factors influencing car use
132
Appendix – 5G
Nested Logit Model (NL) with socio-demographic variable and different time parameter --> sample;all$ --> NLOGIT; lhs=CHOICE,CSET,MODE; CHOICES=carD,carP,bus,train; Tree=mode[Private(carD,carP),Public(bus,train)]; IVSET:(PRIVATE)=[1]; MODEL: U(carD)=A_carD+time_C*TRAVELTI+cost*TRIPCOST+park*PARKHOUR/ U(carP)=A_carP+time_C*TRAVELTI+cost*TRIPCOST+age*AGE+sex*SEX/ U(bus)=A_bus +time_B*TRAVELTI+cost*TRIPCOST/ U(train)= time_T*TRAVELTI+cost*TRIPCOST; crosstab; $ Normal exit from iterations. Exit status=0. +---------------------------------------------+ | FIML Nested Multinomial Logit Model | | Maximum Likelihood Estimates | | Model estimated: Dec 21, 2005 at 11:22:10AM.| | Dependent variable CHOICE | | Weighting variable None | | Number of observations 1211 | | Iterations completed 22 | | Log likelihood function -329.0757 | | Number of parameters 11 | | Info. Criterion: AIC = .56164 | | Finite Sample: AIC = .56183 | | Info. Criterion: BIC = .60796 | | Info. Criterion:HQIC = .57908 | | Restricted log likelihood -519.8604 | | Chi squared 381.5694 | | Degrees of freedom 11 | | Prob[ChiSqd > value] = .0000000 | | R2=1-LogL/LogL* Log-L fncn R-sqrd RsqAdj | | No coefficients -519.8604 .36699 .35855 | | Constants only. Must be computed directly. | | Use NLOGIT ;...; RHS=ONE $ | | At start values -331.1821 .00636 -.00689 | | Response data are given as ind. choice. | +---------------------------------------------+ +---------+--------------+----------------+--------+---------+ |Variable | Coefficient | Standard Error |b/St.Er.|P[|Z|>z] | +---------+--------------+----------------+--------+---------+ Attributes in the Utility Functions (beta) A_CARD 1.59149655 .72626926 2.191 .0284 TIME_C -.01047026 .01614767 -.648 .5167 COST -.70597135 .31151130 -2.266 .0234 PARK -.28513365 .31971276 -.892 .3725 A_CARP 1.52515097 .68412985 2.229 .0258 AGE -.03062060 .00963337 -3.179 .0015 SEX -.83448256 .29649016 -2.815 .0049 A_BUS 2.38858171 1.24844344 1.913 .0557 TIME_B -.06622050 .02918450 -2.269 .0233 TIME_T .03442719 .02387648 1.442 .1493 IV parameters, tau(j|i,l),sigma(i|l),phi(l) PRIVATE 1.00000000 ......(Fixed Parameter)....... PUBLIC .62177206 .14298972 4.348 .0000 Matrix Crosstab has 5 rows and 5 columns. CARD CARP BUS TRAIN Total +------------------------------------------------------------- CARD | 116.00000 29.00000 24.00000 19.00000 188.00000 CARP | 30.00000 28.00000 13.00000 4.00000 75.00000 BUS | 25.00000 10.00000 15.00000 5.00000 54.00000 TRAIN | 18.00000 8.00000 3.00000 28.00000 58.00000 Total | 188.00000 75.00000 55.00000 57.00000 375.00000
![Page 151: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/151.jpg)
Chapter 6: Stated Preference Survey
133
CHAPTER SIX Stated Preference Survey of car travel to Perth city
Although the nested logit discrete choice study, based on available survey data, of
Chapter 5 provided estimates for trips to Perth city specifically, it left serious gaps. As
indicated at the end of Chapter 5, the travel behaviour of car users can be assessed more
adequately by obtaining their stated responses to various car suppression scenarios. The
previous chapter evaluated travel behaviour in choosing the mode of transport to the
city; however what exactly car users would do if constraints were imposed on them is
the main concern of the present chapter. The focus is to report the details of the Car
Trip Response Survey 2005, which was conducted to obtain responses to the pricing and
control measures outlined in Chapter 4, using an efficient experimental design. The
chapter first discusses the appropriate models to be developed with SP data and then the
experimental design for the survey.
Section 6.2 deals with models to estimate the expected reactions using the survey
responses. Stated Preference (SP) design, the data collection instrument, sampling and
sample frame, and data collection are discussed in Section 6.3. Descriptive information
about the sample is reported in Section 6.4.
6.1 INTRODUCTION
The principal concern of this chapter is to assess travellers’ reactions to policies
designed to reduce pollution in Perth city. The aim of the analysis is to measure the
effectiveness of strategies to achieve this. Chapter 2 has identified several strategies to
reduce air pollution, which are mainly effective in the long run. The most effective
action plans in the short run involve pricing policy. Nijkamp and Shefer (1998) have
considered several measures to address urban transport externalities. They have
categorised the measures into control measures, market-based measures, and land use
& physical planning measures. Pricing policy is considered as a market-based measure.
This chapter suggests a policy combining control measures and market-based measures,
leaving the third category aside because of its long term nature. A convenient name is
air quality control policy (AQCP).
![Page 152: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/152.jpg)
Chapter 6: Stated Preference Survey
134
Many studies have used stated preference methods to observe travel behaviour with
respect to the attributes of travel time and trip costs, however not many of these have
been aimed at controlling air pollution. A study by Saelensminde (1999) used the stated
choice method to value air pollution caused by urban traffic with scenarios involving
polluted environment, travel time, and trip cost attributes, but not constraints to control
car use. The present study deals with travel responses to penalties on taking a car to the
city. The fixed charge, variable charge, parking fee and lane restriction were identified
in Chapter 4 as measures which can be applied in the city centre, and expected
responses have been investigated by applying previously estimated elasticities. The
analysis of both short and long term responses projected a significant improvement of
air quality in Perth city with reductions in CO and NOx concentrations. However the
measurement of Perth travellers’ actual reactions to this policy is the main concern of
the study. As the actual reactions of travellers could not be estimated with revealed
preference information, because the policy does not exist, a stated preference (SP)
method has been used to determine the travellers’ specific responses. This part of the
study is designed to measure the effectiveness of the AQCP by assessing the travel
responses in terms of taking a car to the city.
6.2 POLICY REACTION MODEL
To develop a model that can assess the travellers’ reaction to air quality control policy
(AQCP) a binary choice specification is used, both stated preference and socio-
demographic data being used to estimate the model. The dependent variable is choice
of taking a car to the city during a specific time of day under different situations with
regard to various price and other factors. In the mathematical models, binary choice is
the dependent variable and a few dichotomous and polychotomous variables are the
independent variables. The objective is to estimate the likelihood of taking a car to the
city under several levels of predictor variables.
The inapplicability of combining SP-RP data in this study has already been considered
in Chapter 5 and is discussed further in Section 6.2.2. However the SP model is
integrated into the RP model, developed in Chapter 5, by assuming that all charges can
be expressed as equivalent costs and incorporated into the RP model which has trip cost
and parking fee attributes. Thus in Chapter 8, the SP estimates are scaled to the RP
estimates. As noted earlier, the AQCP policy does not exist at present in Perth;
![Page 153: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/153.jpg)
Chapter 6: Stated Preference Survey
135
therefore the SP approach is the only source from which travellers’ reactions can be
assessed.
6.2.1 The Model
Design must satisfy the properties of the probabilistic discrete choice model which is
hypothesised to underlie the response data (Louviere et al. 2000). A universal choice
set of {Yes, No} is used for the binary logit model to estimate the reactions of travellers
with respect to the policy measures. The random utility model is the base of this choice
model, which can be expressed as iqiqiq VU ε+= (i is one alternative, either yes or no,
for individual q), where Uiq is utility, Viq is the systematic (observed) utility component
and εiq is the random (unobserved) component. The unobserved component is that
important element in the utility function which is not measurable or understandable by
the analyst. In the binary choice model the probability of an individual choosing Yes is
expressed as:
Pn(yes) = Pr(Uyes > Uno)
= Pr(Vyes + εyes > Vno + εno)
= Pr(Vyes - Vno> εno – εyes) ........................................ (6.1)
Ben-Akiva and Lerman (1985) argued that the specification of a binary choice model
considers only the difference of random components (εno – εyes) instead of each element
separately. They also argued that there is no real difference between shifting the mean
of the random component of one alternative and shifting the systematic component by
the same amount. This implies that as long as one can add a constant to the systematic
component, the means of random components can be defined as equal to any constant
without loss of generality. Therefore the most convenient assumption is that all the
random components have zero means. As a result we can re-write equation (6.1) as:
P(yes)=Pr(Vyes > Vno) ......................................................... (6.2)
The probability of choosing the Yes alternative can be estimated using the binary logit
model. The model is expressed as:
noyes
yes
VV
V
n eeenoyesyesP+
=),|( ............................(6.3)
![Page 154: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/154.jpg)
Chapter 6: Stated Preference Survey
136
As we know that the systematic component of the utility function for the No alternative
can be set to zero with no loss of generality, equation (6.3) can be rewritten as:
1),|(
+=
yes
yes
V
V
n eenoyesyesP .................................. (6.4)
Moreover, if we represent the odds of responding Yes relative to No, we see that
no
yes
yes
no
yes
yes
V
V
V
V
V
V
ee
ee
ee
noyesnoPnoyesyesP
=
+
+=
1
1),|(),|(
............................. (6.5)
Again, since Vno = 0, noVe would be one, if we take natural logarithms of both sides of
(6.5), we get,
yese Vp
pLog =⎟⎟⎠
⎞⎜⎜⎝
⎛−1
............................................................ (6.6)
where p represents the probability of choosing the yes alternative.
The systematic (observed) component Vyes is assumed to be homogeneous across the
population in terms of relative importance of those attributes contained in Vyes. This
component is also assumed to be a linear and additive function of the attributes which
determine the utility of the yes alternative. Thus the expression can be:
∑∑ +=q
qqk
kkyes ZXV αβ ....................................... (6.7)
Where βk is a vector associated with k attribute vectors, Xk; and αq is a vector associated
with q individual characteristics, Zq. We have control over the Xk by designing them to
satisfy the properties of interest; but we have less (if not no) control over Zq. These
parameters are estimated for the binary logit model using either SPSS or LIMDEP
software.
Although the logit model estimates the parameters (βk) associated with the attributes
and with the individual characteristics (αq), direct interpretation of them is difficult in a
binary logit model (Hosmer and Lemeshow 2000, Louviere et al. 2000). The marginal
effect of any variable is a meaningful way of presenting the results of a binary logit
![Page 155: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/155.jpg)
Chapter 6: Stated Preference Survey
137
model. In such a model marginal effects are the marginal changes in expected
probability. Mathematically, the marginal effect for a logit model can be expressed in
equation (6.8).
)1(**)|(
qqkkqk
qkq ppX
XpE−==
∂
∂βϕ ....................................... (6.8)
From the above expression it is evident that marginal effects for different individuals
are different. There are several ways to summarise these effects. One convenient way
of summarising them is to calculate the marginal effects of all observations in the
sample and report the mean of these effects. The interpretation of the marginal effect of
attribute k is the percentage change in probability of choosing yes (ϕk) in the choice
model for a one unit change in that attribute.
Whereas a marginal effect is the most useful behavioural output in the continuous cases,
for binary independent variables an odds ratio (OR) provides a meaningful
interpretation. An odds ratio estimates how much more likely (less likely) is an
outcome (yes) among those who have a particular attribute (present) than those who do
not have that attribute (absent). The expression of odds ratio is shown in equation (6.9).
⎟⎟⎠
⎞⎜⎜⎝
⎛
⎟⎟⎠
⎞⎜⎜⎝
⎛
=
absentCabsentCpresentCpresentC
OR
no
yes
no
yes
||
||
................................................................. (6.9)
Where (Cyes|present) is the number of observations for those who choose the yes
alternative given that the attribute is present. A similar meaning is applicable for other
parameters. An odds ratio can also be expressed as:
keOR β= ............................................................................. (6.10)
To ensure efficient estimation of the model a well-designed data collection instrument is
essential.
6.2.2 Inapplicability of combined SP-RP
As discussed in Chapter 5, the SP model should not be used alone to estimate future
impacts because of its hypothetical nature which leads to lack of “validity” and
![Page 156: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/156.jpg)
Chapter 6: Stated Preference Survey
138
“stability”. On the other hand, an RP model can provide unbiased estimates as it
reflects travellers’ actual behaviour. Hence, Morikawa (1994) and others (Louviere et
al. 2000, Ben-Akiva and Morikawa 1990, Cherchi and Ortuzar 2002) have
recommended combining SP and RP data to exploit their advantages and overcome their
limitations by adjusting scale factors of the two data sets.
In this study however there was no opportunity to combine RP and SP data. Choices in
the RP study in Chapter 5 and in this SP study could not be the same, so that RP and SP
data could not be combined to estimate a single model. The RP study developed a
mode choice model with the four modes covered in the PARTS survey, whereas the SP
study focused on car driver behaviour. Even in the SP study, revealed and stated
information could not be used to develop a combined model. The choice in the SP
questions was whether respondents would take a car to the city or not, and the RP
section of the same study sought information about those who took a car to the city.
Therefore, there was no mode choice except taking a car to the city.
Using only the SP model to predict travellers’ behaviour may not be efficient and, for
the purpose of prediction, the SP coefficients are used to simulate responses within the
RP model presented in Chapter 5. Details of the simulation process are given in Section
8.3 in Chapter 8.
6.3 DESIGNING THE SP MODEL
6.3.1 Experimental design
An experiment is designed by manipulating attributes and their levels to permit rigorous
testing of certain hypotheses of interest (Louviere et al. 2000). Efficient experimental
designs are widely used in many fields of study, especially in agriculture. The approach
is also common in the transportation field. A design may be classified as fully or
fractionally factorial. A full factorial design is one where each level of each attribute is
combined with each level of all other attributes. Although this design ensures that all
effects of the attributes are captured, it is only practical when a small number of
attributes and levels are of interest. A fractional factorial design can minimise the
number of combinations by selecting a particular subset or sample of complete
factorials so that particular effects of interest can be estimated as efficiently as possible:
the orthogonality of the variables inherent in the full factorial design is still preserved in
the fractional factorial.
![Page 157: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/157.jpg)
Chapter 6: Stated Preference Survey
139
Seven policy measures (attributes) were identified in chapter 4 (Table 4.2). Three of
these attributes had 3 levels of value and others had 2 levels. Therefore, if we consider
a complete factorial design the total number of combinations would be 432 (=33 X 24)
profiles, which would be difficult to collect from respondents. As a result a fractional
factorial design is a realistic option in this case. The attributes are shown in Table 6.1.
Table 6.1: Attributes and their levels used for the decision process
Attributes Levels of attributes
Units
Fuel price $1, $1.5, $2 per litre of petrol
Fixed charge $0, $1, $2 per entry into city disregarding time of day
Car size charge $0, $1 for a large car per entry
Entry time charge $0, $4 per entry into the city between 7am and 10am
Parking fee $0, $2, $5 per hour
Parking space Limited, un-limited
Lane restriction for cars yes, no between 7am and 10 am
The attributes are explained as follows.
• Fuel price is unleaded petrol price per litre. It is assumed that diesel and other
fuels move similarly.
• Fixed charge is a charge to be imposed on a car each time it enters Perth city.
The charge is assumed to be collected electronically without any delay (similar
to Melbourne City Link).
• Car size charge is a charge to be imposed electronically on a relatively large car
each time it enters the city. Examples of large cars are Toyota Camry,
Mitsubishi Magna, Mazda6, Kia Optima (2.4L), Hyundai Sonata (2.7L),
Holden Commodore, Ford Falcon, and most 4WDs.
• Entry time charge is a charge to be imposed electronically on each car entering
the city between 7am and 10am.
• Parking fee is an hourly charge imposed for parking a car in the city.
• There are two values of Parking space: ‘difficult’ or ‘easy to find’.
![Page 158: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/158.jpg)
Chapter 6: Stated Preference Survey
140
• Lane restriction is defined as the left lane in the main city streets (e.g. St.
Georges Tce, William St., Barrack St.) being closed to cars and used for other
purposes such as cycling or walking.
The attributes were combined to create profiles and respondents were asked “whether
they would take a car to Perth city”. The choice response was binary, yes or no. The
simplest form of design is a main effect only design and an orthogonal design ensures
the attributes are not correlated. The smallest main effects orthogonal design in this
case contains only 16 profiles. These combinations can be in different forms. One
possible combination is shown in Table 6.2; this was adopted in the study. A structured
questionnaire was developed using these 16 scenarios and the respondents were asked
whether they would take a car to the city under each of these scenarios.
Table 6.2: Orthogonal main effects design profile
Profiles Fuel price ($ per litre)
Fixed charge ($ per entry)
Car size charge ($ per
large car)
Entry time charge
($ at morning peak)
Parking fee ($ per
hr)
Parking space
Lane restriction
for cars
1 1.5 0 1 4 2 limited yes
2 1 2 1 4 0 un-limited yes
3 1 1 0 4 2 un-limited yes
4 2 0 1 4 5 un-limited no
5 1 0 0 0 0 limited yes
6 2 0 0 4 0 limited yes
7 1 2 1 4 0 limited no
8 1.5 2 0 0 5 un-limited yes
9 1 1 0 4 5 limited no
10 1 0 1 0 5 limited yes
11 1.5 1 1 0 0 limited no
12 2 1 1 0 0 un-limited yes
13 1.5 0 0 4 0 un-limited no
14 1 0 1 0 2 un-limited no
15 1 0 0 0 0 un-limited no
16 2 2 0 0 2 limited no
6.3.2 Data collection instrument
A survey, called the Car Trip Response Survey 2005 containing three sections, was
developed. The SP section of the questionnaire was designed mainly to present the 16
scenarios and to collect responses under the scenarios. There were two other sections to
![Page 159: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/159.jpg)
Chapter 6: Stated Preference Survey
141
collect responses about the traveller’s last trip to Perth city and their household. The
respondent was asked to choose from a binary choice of {yes and no} for a question
“would you take your car to Perth City?” under certain conditions. However to make
the choice set exhaustive, a follow up question was also asked for {yes} answer groups
“whether they would take the car to the city between 7am and 10am”. A complete
questionnaire is provided in Appendix 6A.
While we recognise that peoples’ choice decisions are mainly based on the attributes of
the alternatives, in many cases the decision may be influenced by socio-demographic
factors. Therefore in order to improve model fit the questionnaire asks for each
respondent’s demographic profile. Thus the three sections of the questionnaire are:
Section 1 asking about the respondent’s last car trip to Perth city, Section 2 asking for
choice of alternative under each of the 16 scenarios, and Section 3 concerning
household information.
Information about the last car trip to the city is important to analyse the present status of
the respondent’s travel activity and behaviour. In this section respondents are asked
about the purpose of their last trip to the city. They are also asked about the size of the
car they have used, entry time into the city, cost of fuel and parking. One question
included in this section was about the alternatives available if taking a car to the city
was not convenient on the last occasion. This information is considered as the no
response to each of the choice questions in Section 2.
In Section 2 containing SP questions related to the stated choice of respondents, sixteen
different scenarios were presented. At the beginning of this section detailed
explanations were given for each attribute used. As the scenarios do not exist in reality,
respondents were asked to respond to them as if they were real.
Section 3 contained only three questions regarding the respondent’s household. This
section was limited so that respondents would not find it unduly intrusive. Only the
number of cars, number of driving licences, and the suburb in which the household is
located were asked in this section. At the end of the questionnaire a Perth City map was
included to show the boundary of the city mentioned in the questionnaire.
In designing the questionnaire several issues were considered to make it more
acceptable and simple for the respondents. While the sequence of questions is a very
important issue to be considered in face-to-face interviews, it is less important for mail-
![Page 160: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/160.jpg)
Chapter 6: Stated Preference Survey
142
out questionnaires (Dillman 1978, Dillman 2000, Ayidiya & McClendon 1990, and
Schwarz & Hippler 1995, Alwin 1978). Principles of questionnaire design followed
included putting demographic questions at the end, and organising responses vertically
rather than horizontally. Finally, the size of the survey booklet and the font size were
considered in order to make it acceptable to the respondents.
6.3.3 Sampling frame and sample size
“Within individuals, responses to successive profiles may depend in some way on
previous responses. Between individuals, differences in preferences lead to violation of
the Independently and Identically Distributed (IID) assumption because the joint
distribution of utility parameters (β) is not the convolution of independent random
variables” (Louviere et al. 2000). Thus logistic regression or a logit model would be
appropriate if each separate profile were randomly assigned to 100 respondents (i.e.
1600 total respondents) rather than all 16 profiles being evaluated by 100 respondents.
However, in this study a sample size of 2000 was selected and all 16 profiles provided.
Keeping the IID assumption in mind, the model is analysed as if based on panel data or
as a multi-period logit model.
The sample frame defines the universe of respondents from which a finite sample is
drawn to collect data. The objective of the study often influences the sample frame. As
the objective was to assess the reactions of travellers to Perth city to environmental
control policies, the sample frame should have been all members of households who
travel to the city. In fact, for the purpose of this study, the sample frame was taken to be
households in Perth Metropolitan area. Data from the Perth and Regional Travel Survey
(PARTS), an ongoing project, found that people come to Perth city for various purposes
from about 102 suburbs. About 70% use a car (as driver or as a passenger) as their
main mode of transport.
An eventual sample size of 300 to 400 is convenient for the purpose of this study. It
was expected that the response rate would be about 20% in the case of a mail survey.
Keeping this rate in mind, a sample of 2000 households was selected from the 464,901
households listed in the White Page Telephone Book for the Perth Metropolitan area.
According to Louviere et al. (2000) this sample size is within the size range of a sample
for simple random sampling.
![Page 161: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/161.jpg)
Chapter 6: Stated Preference Survey
143
6.3.4 Data collection
A complete survey set containing a survey booklet (12 pages), a covering letter (1
page), and a return envelope, was posted to each sample addressee on 20 May 2005.
There was a total of 401 responses, and the usable number was 369 for stated preference
analysis (effective response rate18%). The time pattern of responses is shown in Figure
6.1. The first group of responses was received on the third working day. The number
of responses increased on day 4 and then gradually declined over the next few days.
Almost all responses were received within 4 weeks of mail out. About 11% of the
survey was undelivered due to insufficient or incorrect addresses.
0
10
20
30
40
50
60
70
80
3 4 5 6 7 8 9 10 11 12 13 14 15 16
Late
r
Days after mail-out
# of
resp
onse
s
6.4 SURVEY OUTCOMES
The responses were entered into the computer for analyses and the data used to develop
a binary logit model on the travellers’ reactions to the policy measures. The factual
responses to sections 1 and 3 indicated that people come to the city from at least 169
suburbs. Descriptive statistics are presented in Table 6.3. The total number of
observation for descriptive statistics varies between 369 and 376 depending on non-
responses to some questions. The sample proportions correspond fairly closely to the
Census 2001 data for the Perth workforce (Table 6.3).
Figure 6.1: Response pattern of the survey
![Page 162: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/162.jpg)
Chapter 6: Stated Preference Survey
144
Table 6.3: Respondents profile from their last car trip to Perth city Sample
Frequency Sample
Percentage Perth Census
2001 (percentage)
Frequency of trip to Perth city Once a week or more 112 29.8 About once a month 72 19.1 Less frequently 192 51.1 Purpose of last trip to the city Work 106 28.4 Education 6 1.6 Shopping 94 25.2 Personal business or recreation 122 32.7 Others 45 12.1 Work status in Perth City Work full time 58 15.5 17.3 Not work full time 317 84.5 82.7 Size of car used Small car 169 45.9 Large car 199 54.1 Alternative option in case of inconvenience of taking car to the city
Change mode 264 71.4 Change time of day 17 4.6 Cancel activity 40 10.8 Perform activity in another location 49 13.2 Modal split for change mode alternative Public transport (Bus/Train) [Average estimated time of
travel = 36 min] 240 90.9
Walk 3 1.1 Cycle 6 2.3 Taxi 15 5.7 Entry time into the city Before 7 am 16 4.3 Between 7 am and 10 am 151 40.9 Between 10 am and 5 pm 167 45.3 After 5 pm 35 9.5
Table 6.3 shows that the majority (58%) of people driving into Perth city did so for the
purposes of shopping, personal business and recreation, though about 28% go for work.
Half of those who go to the city to work (work purpose group) work full time. Around
half of the respondents used large cars to drive into the city.
About 71% of the respondents are willing to change mode of transport if taking a car to
the city is not convenient, yet 13% say they would change the location of the activity
![Page 163: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/163.jpg)
Chapter 6: Stated Preference Survey
145
and 10% say they would cancel the activity. Almost all of those who would change
mode would choose public transport to get to the city. It is also shown in Table 6.5 that
the alternative choices for both work and non-work groups are similar. This
information suggested that people are willing to use an alternative to their car if it is
required.
Table 6.4: Summary of metric variables
Mean St. Dev. Time spent on last trip to Perth city (min) 175.98 147.83
Price of petrol per litre (cent) 101.73 5.32
Parking fee per hour ($) 1.36 1.49
Travel time on public transport (min) 36.07 20.30
Number of cars in a household 2.01 1.00
Number of driver’s licences in a household 2.04 0.81
The average time spent in the city was 6 hours for work purpose and 3 hours for non-
work. The mean metric variables (Table 6.4) were average petrol price per litre of
101.73¢, mean parking fee per hour of $1.36, average travel time on public transport of
36.07 min, average number of cars in a household 2.01, and average number of driver’s
licences 2.04.
Cross-classifications are also of interest. One of the useful groupings is into the work
purpose and non-work purpose (those who go to the city for other than work) groups.
Some of the informative comparisons are presented in Table 6.5.
Table 6.5: Classification by purpose (% of cases)
Alternative choices Work Non-work
Change mode 73 (69.5) 190 (72.2)
Change time of day 7 (6.7) 10 (3.8)
Cancel activity 13 (12.4) 27 (10.3)
Perform activity to another location 12 (11.4) 36 (13.7)
Entry time
Before 7am 13 (12.4) 3 (1.1)
Between 7am and 10 am 62 (59.0) 88 (33.5)
Between 10 am and 5 pm 23 (21.9) 144 (54.8)
After 5 pm 7 (6.7) 28 (10.6)
![Page 164: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/164.jpg)
Chapter 6: Stated Preference Survey
146
In Table 6.3 we see a large group of people (45%) enter the city before 10 am, while the
remainder enter after 10 am. These two groups roughly approximate to the work and
non-work groups (see Table 6.5). About 71% (=12.4% + 59.0%) of the work purpose
group enters the city at or before the morning peak whereas about 66% (= 54.8% +
10.6%) of the non-work purpose group go after the morning peak.
The relationship between the purpose of travel to Perth city and selected alternatives if it
were not convenient to take a car to the city is shown in Table 6.6. It is observed that a
good proportion (=35.4% + 31.3%) of people whose purpose was either shopping or
personal business or recreation are willing to change the location of their activities.
Table 6.6: Relation between trip purpose and selected alternative if not taking a car (% of column)
Purpose/Alternatives Change mode
Change time of day
Cancel activity
Perform activity at another location
Work 73 (27.8) 7 (41.2) 13 (32.5) 12 (25.0)
Education 3 (1.1) 0 (0.0) 1 (2.5) 1 (2.1)
Shopping 70 (26.6) 4 (23.5) 3 (7.5) 17 (35.4)
Personal business or recreation 84 (31.9) 2 (11.8) 19 (47.5) 15 (31.3)
Others 33 (12.5) 4 (23.5) 4 (10.0) 3 (6.3)
Table 6.7 shows the relation between size of the car used and purpose of the trip.
People who travel to the city for work purposes tend to prefer (62.3%) a large car,
whereas those who go for a non-work purpose are as likely to use a small as a large car.
Table 6.7: Car size and trip purpose (% of column)
Car size/Purpose Non-work Work
Small car 128 (49.0) 40 (37.7)
Large car 133 (51.0) 66 (62.3)
A summary of SP responses is presented in Table 6.8. Percentages of yes and no
responses corresponding to the 16 scenarios are shown in the table.
![Page 165: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/165.jpg)
Chapter 6: Stated Preference Survey
147
Table 6.8: Responses to SP profiles: Proportion of respondents who would take their car to the city
Attributes Response (%)
Scenario
Fuel price ($ per litre)
Fixed charge ($ per entry)
Car size charge ($ per
large car)
Entry time charge ($ at
morning peak)
Parking fee ($ per
hr)
Parking space
Lane restriction
for cars Yes No
1 1.5 0 1 4 2 Limited yes 36.8 63.2
2 1 2 1 4 0 un-limited yes 50.7 49.3
3 1 1 0 4 2 un-limited yes 48.1 51.9
4 2 0 1 4 5 un-limited no 17.3 82.75 1 0 0 0 0 Limited yes 86.2 13.8
6 2 0 0 4 0 Limited yes 51.6 48.4
7 1 2 1 4 0 Limited no 45.7 54.3
8 1.5 2 0 0 5 un-limited yes 21.6 78.4
9 1 1 0 4 5 Limited no 19.7 80.3
10 1 0 1 0 5 Limited yes 23.5 76.5
11 1.5 1 1 0 0 Limited no 67.7 32.3
12 2 1 1 0 0 un-limited yes 60.4 39.6
13 1.5 0 0 4 0 un-limited no 65.8 34.2
14 1 0 1 0 2 un-limited no 68.7 31.3
15 1 0 0 0 0 un-limited no 91.9 8.1
16 2 2 0 0 2 limited no 39.9 60.1
We can observe that almost all (91.9%) of the respondents would take a car to the city
under scenario 15, in which no charges and restrictions are imposed. On the other hand,
most of the respondents (82.7%) would not take a car to the city in scenario 4. In this
profile fuel is expensive and extreme charges are applied although parking space is
unlimited and lane capacity is not restricted. It is evident that people are less willing to
take a car to the city when parking fees are very high (scenarios 8, 9, 10), which
indicates high sensitivity to parking fees.
A similar summary is presented for the work and non-work groups in Table 6.9.
Percentages of responses to the 16 scenarios show some clear distinctions between the
two different groups but in most of the scenarios both groups have similar responses.
Scenarios 4 and 15 have extreme responses for both groups which is also evident in
Table 6.8 for aggregated responses. However, in scenarios 2, 3, 6, and 7, the two
![Page 166: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/166.jpg)
Chapter 6: Stated Preference Survey
148
groups have contrasting views. The non-work group is more sensitive to charges and
restrictions.
Table 6.9: Responses to SP profiles for work and non-work groups
Attributes Work purpose
group (%) Non-work purpose
group (%)
Scenario
Fuel price
($ per
litre)
Fixed charge ($ per entry)
Car size
charge ($ per large car)
Entry time
charge ($ at
morning peak)
Parking fee ($ per hr)
Parking space
Lane restriction
for cars
Yes No Yes No 1 1.5 0 1 4 2 Limited yes 48.6 51.4 33.0 67.0
2 1 2 1 4 0 un-limited yes 67.9 32.1 44.4 55.6
3 1 1 0 4 2 un-limited yes 59.0 41.0 44.1 55.9
4 2 0 1 4 5 un-limited no 29.5 70.5 12.6 87.4
5 1 0 0 0 0 Limited yes 92.3 7.7 84.2 15.8
6 2 0 0 4 0 Limited yes 67.3 32.7 46.2 53.8
7 1 2 1 4 0 limited no 59.6 40.4 40.8 59.2
8 1.5 2 0 0 5 un-limited yes 36.5 63.5 16.2 83.8
9 1 1 0 4 5 limited no 34.6 65.4 14.2 85.8
10 1 0 1 0 5 limited yes 39.4 60.6 17.3 82.7
11 1.5 1 1 0 0 limited no 76.0 24.0 65.1 34.9
12 2 1 1 0 0 un-limited yes 72.1 27.9 56.3 43.7
13 1.5 0 0 4 0 un-limited no 76.0 24.0 62.8 37.2
14 1 0 1 0 2 un-limited no 71.2 28.8 68.6 31.4
15 1 0 0 0 0 un-limited no 92.3 7.7 92.0 8.0
16 2 2 0 0 2 limited no 57.7 42.3 33.3 66.7
Details of the model building process using this sample dataset are discussed in the next
chapter.
6.5 SUMMARY
This chapter focused on the design of the stated preference survey and summarising the
responses. Previous chapters identified the policy instruments and estimated the
impacts on air quality control based on an elasticity approach, using reported results in
one case and new econometric model for Perth in the other. However, actual responses
of travellers have been clarified by the stated choice study.
![Page 167: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/167.jpg)
Chapter 6: Stated Preference Survey
149
The summaries of the socio-demographic characteristics of the respondents revealed
that most people travel to Perth for the purpose of shopping or personal business or
recreation. Therefore, a useful grouping for further analysis is work purpose and non-
work purpose. In addition to their socio-demographic profiles, these two groups have
contrasting responses to some of the stated preference scenarios. The next chapter
reports on the development of a binary logit model to assess car travel behaviour, using
the survey data.
![Page 168: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/168.jpg)
Chapter 6: Stated Preference Survey
150
Appendix 6A
Car Trip Response Survey 2005 Survey Booklet
This is the Car Trip Response Survey 2005 booklet. It is asking you to provide information about your car trips to Perth City and your reactions to various car trip situations. The booklet contains 3 sections and the Perth City map.
• Section 1 is asking about your last car trip to Perth City, • Section 2 is about choosing alternatives under 16 situations, and • Section 3 contains three questions about your household.
Planning and Transport Research Centre (PATREC) Business School
University of Western Australia WA 6009
![Page 169: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/169.jpg)
Chapter 6: Stated Preference Survey
151
Completion of the questionnaire is considered evidence of consent to participate in the study.
Section 1
Please tick (√) appropriate box, and write if necessary. 1. How often do you drive to Perth City?
Once a week or more How many times per week? ………… About once a month Less frequently
2. Do you work full-time in Perth City?
Yes No
3. What was the purpose of your last trip to Perth City?
Work Education Shopping Personal Business or recreation Other
4. What type of car did you use on your last trip to Perth City?
Small car Large car (or 4WD) [see box]
Some of the large cars are:
Toyota Camry, Mitsubishi Magna, Mazda6, Kia Optima (2.4L), Hyundai Sonata (2.7L), Holden Commodore, Ford Falcon, most 4WDs and similar
5. How much time did you spend on your last trip to Perth City? ………….. 6. At what time did you enter the City? …………AM …………..PM 7. What was the price per litre when you last bought fuel? …………………. 8. What was the parking fee per hour when you last parked your car in the City?
…………………… (write 0 for free parking)
9. Suppose it was not convenient to take your car on your last trip to Perth City, please suggest an alternative (tick the most likely one).
Use a different transport mode Change time of day Cancel activity Perform activity in another location
Next section is about the choice situation
Which one would you choose (at least one)? Bus or Train estimated trip time…..… Walk estimated trip time…..… Cycle estimated trip time…..… Taxi estimated trip time…..…
![Page 170: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/170.jpg)
Chapter 6: Stated Preference Survey
152
Section 2 The air quality in Perth City is deteriorating due to exhaust emissions from cars. Therefore, the following questions are seeking your reactions to various scenarios. You are asked to make only 16 choices. Suppose you have a reason to take a car (private or business) to Perth City. Would you take the car under the following scenarios (even though some may not necessarily be realistic)? Please do your best to complete these questions. They are very important for the study. At the bottom of each scenario you are asked to respond to questions about taking your car to Perth City (see map at page 9). For each decision you are asked to select either YES or NO (NO means an alternative suggested in question 9 of section 1). Features used in these questions are:
• Fuel price: unleaded petrol price per litre [assume diesel and other fuels move similarly].
• Fixed charge: a charge imposed on a car each time it enters Perth City (see map). The charge would be collected electronically without any delay (similar to Melbourne City Link and other cities in the world).
• Car size charge: a charge imposed electronically on a relatively large car (see box) each time it enters the city.
Some of the large cars are:
Toyota Camry, Mitsubishi Magna, Mazda6, Kia Optima (2.4L), Hyundai Sonata (2.7L), Holden Commodore, Ford Falcon, most 4WDs and similar
• Entry time charge: a charge imposed electronically on each car entering the city between 7am and 10am.
• Parking fee: an hourly charge imposed for parking a car in the city. • Parking space: whether finding parking space is difficult or easy in the city. • Lane restriction: the left lane in the main city streets (e.g. St. Georges Tec,
William St., Barrack St.) closed to cars and used for other purposes such as cycling or walking.
Decision Scenario 1 Features values Units
Fuel price $1.50 per litre Fixed charge $0 per entry into Perth City disregarding time Car size charge $1.00 for a large car per entry Entry time charge $4.00 per entry into the city between 7am & 10 am Parking fee $2.00 per hour Parking space limited Lane restriction for cars yes between 7am and 5pm
Under these conditions would you take the car to Perth City? (tick √ ) If YES would you enter Perth City (tick √):
No Yes
between 7am and 10am at another time
![Page 171: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/171.jpg)
Chapter 6: Stated Preference Survey
153
Decision Scenario 2 Features values units
Fuel price $1.00 per litre Fixed charge $2.00 per entry into Perth City disregarding time Car size charge $1.00 for a large car per entry Entry time charge $4.00 per entry into the city between 7am & 10 am Parking fee $0 per hour Parking space un-limited Lane restriction for cars yes between 7am and 5pm
Under these conditions would you take the car to Perth City? (tick √ ) If YES would you enter Perth City (tick √):
Decision Scenario 3 Features values units
Fuel price $1.00 per litre Fixed charge $1.00 per entry into Perth City disregarding time Car size charge $0 for a large car per entry Entry time charge $4.00 per entry into the city between 7am & 10 am Parking fee $2.00 per hour Parking space un-limited Lane restriction for cars yes between 7am and 5pm
Under these conditions would you take the car to Perth City? (tick √ ) If YES would you enter Perth City (tick √):
Decision Scenario 4 Features values units
Fuel price $2.00 per litre Fixed charge $0 per entry into Perth City disregarding time Car size charge $1.00 for a large car per entry Entry time charge $4.00 per entry into the city between 7am & 10 am Parking fee $5.00 per hour Parking space un-limited Lane restriction for cars no between 7am and 5pm
Under these conditions would you take the car to Perth City? (tick √ ) If YES would you enter Perth City (tick √):
No Yes
between 7am and 10am at another time
No Yes
between 7am and 10am at another time
No Yes
between 7am and 10am at another time
![Page 172: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/172.jpg)
Chapter 6: Stated Preference Survey
154
Decision Scenario 5 Features values units
Fuel price $1.00 per litre Fixed charge $0 per entry into Perth City disregarding time Car size charge $0 for a large car per entry Entry time charge $0 per entry into the city between 7am & 10 am Parking fee $0 per hour Parking space limited Lane restriction for cars yes between 7am and 5pm
Under these conditions would you take the car to Perth City? (tick √ ) If YES would you enter Perth City (tick √):
Decision Scenario 6 Features values units
Fuel price $2.00 per litre Fixed charge $0 per entry into Perth City disregarding time Car size charge $0 for a large car per entry Entry time charge $4.00 per entry into the city between 7am & 10 am Parking fee $0 per hour Parking space limited Lane restriction for cars yes between 7am and 5pm
Under these conditions would you take the car to Perth City? (tick √ ) If YES would you enter Perth City (tick √):
Decision Scenario 7 Features values units
Fuel price $1.00 per litre Fixed charge $2.00 per entry into Perth City disregarding time Car size charge $1.00 for a large car per entry Entry time charge $4.00 per entry into the city between 7am & 10 am Parking fee $0 per hour Parking space limited Lane restriction for cars no between 7am and 5pm
Under these conditions would you take the car to Perth City? (tick √ ) If YES would you enter Perth City (tick √):
No Yes
between 7am and 10am at another time
No Yes
between 7am and 10am at another time
No Yes
between 7am and 10am at another time
![Page 173: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/173.jpg)
Chapter 6: Stated Preference Survey
155
Decision Scenario 8 Features values units
Fuel price $1.50 per litre Fixed charge $2.00 per entry into Perth City disregarding time Car size charge $0 for a large car per entry Entry time charge $0 per entry into the city between 7am & 10 am Parking fee $5.00 per hour Parking space un-limited Lane restriction for cars yes between 7am and 5pm
Under these conditions would you take the car to Perth City? (tick √ ) If YES would you enter Perth City (tick √):
Decision Scenario 9 Features values units
Fuel price $1.00 per litre Fixed charge $1.00 per entry into Perth City disregarding time Car size charge $0 for a large car per entry Entry time charge $4.00 per entry into the city between 7am & 10 am Parking fee $5.00 per hour Parking space limited Lane restriction for cars no between 7am and 5pm
Under these conditions would you take the car to Perth City? (tick √ ) If YES would you enter Perth City (tick √):
Decision Scenario 10 Features values units
Fuel price $1.00 per litre Fixed charge $0 per entry into Perth City disregarding time Car size charge $1.00 for a large car per entry Entry time charge $0 per entry into the city between 7am & 10 am Parking fee $5.00 per hour Parking space limited Lane restriction for cars yes between 7am and 5pm
Under these conditions would you take the car to Perth City? (tick √ ) If YES would you enter Perth City (tick √):
No Yes
between 7am and 10am at another time
No Yes
between 7am and 10am at another time
No Yes
between 7am and 10am at another time
![Page 174: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/174.jpg)
Chapter 6: Stated Preference Survey
156
Decision Scenario 11 Features values units
Fuel price $1.50 per litre Fixed charge $1.00 per entry into Perth City disregarding time Car size charge $1.00 for a large car per entry Entry time charge $0 per entry into the city between 7am & 10 am Parking fee $0 per hour Parking space limited Lane restriction for cars no between 7am and 5pm
Under these conditions would you take the car to Perth City? (tick √ ) If YES would you enter Perth City (tick √):
Decision Scenario 12 Features values units
Fuel price $2.00 per litre Fixed charge $1.00 per entry into Perth City disregarding time Car size charge $1.00 for a large car per entry Entry time charge $0 per entry into the city between 7am & 10 am Parking fee $0 per hour Parking space un-limited Lane restriction for cars yes between 7am and 5pm
Under these conditions would you take the car to Perth City? (tick √ ) If YES would you enter Perth City (tick √):
Decision Scenario 13 Features values units
Fuel price $1.50 per litre Fixed charge $0 per entry into Perth City disregarding time Car size charge $0 for a large car per entry Entry time charge $4.00 per entry into the city between 7am & 10 am Parking fee $0 per hour Parking space un-limited Lane restriction for cars no between 7am and 5pm
Under these conditions would you take the car to Perth City? (tick √ ) If YES would you enter Perth City (tick √):
No Yes
between 7am and 10am at another time
No Yes
between 7am and 10am at another time
No Yes
between 7am and 10am at another time
![Page 175: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/175.jpg)
Chapter 6: Stated Preference Survey
157
Decision Scenario 14 Features values units
Fuel price $1.00 per litre Fixed charge $0 per entry into Perth City disregarding time Car size charge $1.00 for a large car per entry Entry time charge $0 per entry into the city between 7am & 10 am Parking fee $2.00 per hour Parking space un-limited Lane restriction for cars no between 7am and 5pm
Under these conditions would you take the car to Perth City? (tick √ ) If YES would you enter Perth City (tick √):
Decision Scenario 15 Features values units
Fuel price $1.00 per litre Fixed charge $0 per entry into Perth City disregarding time Car size charge $0 for a large car per entry Entry time charge $0 per entry into the city between 7am & 10 am Parking fee $0 per hour Parking space un-limited Lane restriction for cars no between 7am and 5pm
Under these conditions would you take the car to Perth City? (tick √ ) If YES would you enter Perth City (tick √):
Decision Scenario 16 Features values units
Fuel price $2.00 per litre Fixed charge $2.00 per entry into Perth City disregarding time Car size charge $0 for a large car per entry Entry time charge $0 per entry into the city between 7am & 10 am Parking fee $2.00 per hour Parking space limited Lane restriction for cars no between 7am and 5pm
Under these conditions would you take the car to Perth City? (tick √ ) If YES would you enter Perth City (tick √):
Next section is about some household information
No Yes
between 7am and 10am at another time
No Yes
between 7am and 10am at another time
No Yes
between 7am and 10am at another time
![Page 176: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/176.jpg)
Chapter 6: Stated Preference Survey
158
Section 3
Please write for the following questions. Your household information This section is the minimum information about your household required to interpret the study results. This information will be strictly confidential. 1: The suburb you live in is ……………………………………………………….
2: The number of cars and other motor vehicles in your household is ……………
3: The number of people in your household who have a driver’s licence is ………..
End of Survey
![Page 177: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/177.jpg)
Chapter 6: Stated Preference Survey
159
Perth City [final page of the questionnaire]
![Page 178: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/178.jpg)
Chapter 7: Modelling Policy Reaction
160
CHAPTER SEVEN
Modelling the reactions of car travellers to Perth city
The task of this chapter is to develop models which best exploit the data collected in the
Car Trip Response Survey 2005. As discussed in Chapter 6, the aim is to develop a
model to assess reactions to potential pollution alleviation measures. Chapter 6 also
presented the survey and sample characteristics, which are used for model estimation in
this chapter.
Section 7.2 discusses the odds ratios for policy measure variables calculated from the
raw data. Section 7.3 starts with model estimation using the logit model. Sub-sections
of 7.3 deal with the selection of the appropriate model for this dataset. After the
development of a panel data model and a latent class model, binary logit models were
estimated for work and non-work groups. Section 7.4 reports the marginal effects of
different variables for both work and non-work groups. A separate binary logit model is
developed in Section 7.6 for the question of taking the car to the city between 7am and
10am if the respondent chooses to take a car.
7.1 INTRODUCTION
The strength of the travel modelling reported in Chapter 5 was based on actual travel
data (RP) but its weakness was in the unsatisfactory estimates of coefficients required to
assess the impact of measures to limit car use in Perth city. This chapter reports on the
results of the stated choice (SP) study which indirectly rectifies the weakness of the RP
modelling. However many analysts would regard it as unsound to apply purely SP
coefficients as estimated. In Chapter 8 they are combined with RP coefficients of
Chapter 5 using a procedure which, in effect, scales the magnitude of the SP estimates
back to those of the RP coefficients.
In this chapter, model estimation is based on three alternative structures, each giving
insights into particular aspects of traveller response to restrictive measures. Stated
choice responses to alternative scenarios were collected in the Car Trip Response
Survey 2005 (Chapter 6) which was designed to assess car traveller reaction to the
hypothesised Air Quality Control Policy (AQCP) initially identified in Chapter 4.
![Page 179: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/179.jpg)
Chapter 7: Modelling Policy Reaction
161
The SP choice was binary (yes, no) in response to the question whether the respondent
would take a car to the city under each set of pricing and control measures. Whereas
Multinomial Logit (MNL) or Nested Logit (NL) or any of the family of multinomial
logit models are used for multiple discrete choice analysis, in the binary case a logistic
regression or simply a logit model is appropriate. Before constructing any model, odds
ratios are calculated with the raw data to provide information about the likelihood of
taking a car to the city if the values of attributes are changed.
7.2 REACTIONS TO ATTRIBUTE LEVELS
Five of seven attributes in the SP questions contain metric values and the other two
contain categorical values. All of the charges are in monetary terms; however they were
presented in polychotomous form. Consequently it would be of interest in this analysis
to know the respondents’ reaction to a change in the value from one level to the next.
Odds ratios can explain the responses to different levels of the attributes. Some of the
attributes have 3 levels and some have 2. Table 7.1 summarises the odds ratios for
changing from the 1st level to the 2nd and in a few cases to the 3rd.
Table 7.1: Odds ratios for the attributes
Attributes Levels 2nd level 3rd level
Fuel $1, $1.5, $2 0.78 0.62
Fixed charge $0, $1, $2 0.78 0.52
Car size charge $0, $1 0.76
Entry time charge $0, $4 0.54
Parking fee $0, $2, $5 0.50 0.14
Parking space Un-limited, Limited 0.77
Lane restriction No, Yes 0.82
The interpretation of 0.78 for fuel’s 2nd level is that people are 22% (=1-0.78) less likely
to take a car to the city if fuel price increases from $1.00 to $1.50. Similarly people are
38% less likely to take a car if fuel price increases from $1.00 to $2.00. People are
again 22% less likely to take a car if a fixed charge of $1.00 is imposed on taking the
car into the city, and 48% less likely to take a car if the fixed charge is $2.00.
Sensitivity was greatest with respect to the parking fee. People are 50% less likely to
take a car to the city if the parking fee is changed from free parking to $2.00 per hour,
![Page 180: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/180.jpg)
Chapter 7: Modelling Policy Reaction
162
and 86% less likely if it is $5.00. This set of information provides insight into the
behaviour regarding taking a car to the city under various levels of policy measure.
The study further investigated the differences in choice preferences between the work
and non-work groups. Table 7.2 shows comparative odds ratios for these two groups.
Table 7.2: Odds ratios of attributes for two groups
Work group Non-work group Attributes Levels
2nd level 3rd level 2nd level 3rd level
Fuel $1, $1.5, $2 0.80 0.72 0.78 0.57
Fixed charge $0, $1, $2 0.83 0.68 0.75 0.46
Car size charge $0, $1 0.76 0.76
Entry time charge $0, $4 0.60 0.50
Parking fee $0, $2, $5 0.46 0.17 0.51 0.11
Parking space Un-limited, Limited 0.86 0.73
Lane restriction No, Yes 0.92 0.78
As observed in the marginal effects analysis, on most of the attributes the non-work
group is more sensitive to the change in levels than the work group, particularly the
severe charges. For example, the work group is 28% less likely to take a car to the city
if fuel price increases from $1.00 to $2.00, whereas the non-work group is 43% less
likely to take a car for the same change. The lesser responsiveness of the work group is
expected as they may have less choice to avoid the situation unless they change to
public transport. The non-work group has much more flexibility.
Only in the case of the attribute parking fee is the work group more sensitive than the
non-work group. A person in the work group is 54% less likely to take a car to the city
if parking fee per hour increases from zero (free parking) to $2.00, but a person in the
non-work group is 49% less likely. One could argue that many of the work group may
not pay for parking due to employer provision of parking space so that they would be
more sensitive to paying $2.00.
7.3 MODEL ESTIMATION
A number of models are estimated with this dataset. The SP data alone are used to
estimate a model of choosing to take a car to the city. The socio-demographic data are
also used to improve model fit. The dependent variable is binary in nature (0,1). In the
![Page 181: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/181.jpg)
Chapter 7: Modelling Policy Reaction
163
data set two dependent variables are used to estimate the models; these are from two SP
questions. The first one is whether respondents would take a car to the city under
certain conditions, and the second one is if they take the car to the city whether they will
take it at a specific time of day. These two variables are identified as Q1 and Q2 in the
database.
This study developed the models using a random utility approach, keeping in mind that
other approaches such as latent regression and conditional mean function are available.
Under the random utility approach the respondent derives the utility from the
alternatives. In estimating a logit model the dependent variable may be in grouped or
individual form. In this analysis both Q1 and Q2 are in individual form. A logit model
is developed using LIMDEP software and SPSS software is used to verify the results.
The following discussions consider the development of various logit models with Q1
and Q2 as the dependent variables.
7.3.1 Binary logit model for Q1: Whether to take the car
The SP data alone were used to estimate the model initially. In the SP data the
independent variables are the seven policy measures mentioned before. Five of these
contain metric values and the other two contain categorical values. The list of variables
is given below:
Dependent variable ⇒ Q1 binary response [1=yes, 0=no] for a question “would you take a car to the city?”
Independent variables ⇒ fuelprice (X1) metric value [fuel price per litre in $] ⇒ fixedcharge (X2) metric value [fixed charge in $] ⇒ sizecharge (X3) metric value [car size charge in $] ⇒ entrytime (X4) metric value [charge in $ to enter the
city between 7am and 10am] ⇒ parkfee (X5) metric value [hourly parking fee in $] ⇒ parkspace (X6) categorical value [parking space
limited=1 and unlimited=0] ⇒ lane (X7) categorical value [the left lane in the
main city streets is closed to cars=1 and not closed to cars=0]
The model specification can be expressed as in equation (7.1), which is essentially the
expanded form of equation (6.7). The estimated parameters for this specification using
![Page 182: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/182.jpg)
Chapter 7: Modelling Policy Reaction
164
the logit model (Q1SP) are provided in Table 7.3 (LIMDEP output is shown in
Appendix-7A).
76543arg2arg1 XXXXXXXV laneparkspaceparkfeeentrytimeesizechefixedchfuelpriceyes βββββββα +++++++= ............................................ (7.1)
Table 7.3: Binary logit model for Q1 with only SP data (Q1SP)
Variables Coefficient Std. Err. t-ratio
Constant 2.768 0.140 19.68
βfuelprice -0.651 0.072 -8.93
βfixedcharge -0.369 0.035 -10.43
βsizecharge -0.381 0.060 -6.33
βentrytime -0.193 0.015 -12.79
βparkfee -0.419 0.015 -26.86
βparkspace -0.283 0.059 -4.75
βlane -0.204 0.059 -3.41
Sample size 5728 (358 individuals in 16 scenarios)
Log likelihood function -3357.81
Pseudo R2 0.15
χ2 1224.16
The signs of the coefficients are negative as expected, implying that an increase in the
attribute values (mostly increased charges) would reduce the likelihood of taking a car
to the city. The pseudo R2 value is not high, but the t-ratios show high reliability for the
coefficients of the independent variables. The coefficients of this model are not easy to
interpret directly as the dependent variable is in log form. However, odds ratios and
marginal effects have meaningful interpretations, which will be discussed later. This
model is used to estimate predicted probability of the odds of taking a car to the city. It
correctly predicts 68% of taking or not taking a car to the city (Appendix-7A, last table).
The SP question asks the car traveller’s choice of whether to take a car to the city under
various policies and the choice model is improved by adding socio-demographic
variables. After several investigations, the model was finalised by adding three
variables. These are – i) number of cars per licence, ii) dummy variable for work and
![Page 183: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/183.jpg)
Chapter 7: Modelling Policy Reaction
165
non-work purpose, and iii) dummy variable for a large car. The results are shown in
Table 7.4 (LIMDEP output is shown in Appendix-7B).
Table 7.4: Binary logit model for Q1 with SP and socio-demographic data (Q1SPSD)
Variables Coefficient Std. Err. t-ratio
Constant 1.757 0.173 10.14
βfuelprice -0.675 0.074 -9.08
βfixedcharge -0.384 0.036 -10.62
βsizecharge -0.395 0.061 -6.42
βentrytime -0.202 0.015 -13.02
βparkfee -0.439 0.016 -27.21
βparkspaec -0.297 0.061 -4.87
βlane -0.214 0.061 -3.49
βcar/licence 0.726 0.103 7.03
βworkpurpose 0.711 0.068 10.40
βcarsize 0.377 0.061 6.19
Sample size 5728
Log likelihood function -3241.48
Pseudo R2 0.18
χ2 1456.81
This model (Q1SPSD) shows a somewhat better fit. The signs are as expected with
socio-demographic variables. The number of cars per licence has a positive influence
which is expected. The model also shows that the work purpose group is more likely to
take a car to the city and that people with large cars are more likely to take a car to the
city; this could be due to many reasons. Furthermore, t-ratios and other model fit
statistics of this model are better than the Q1SP model and this model predicts 71% of
respondents’ choice decisions correctly (Appendix-7B, last table).
Despite the satisfactory estimates, it is recognised that this model treats 16 responses by
one individual as if they were made by 16 different individuals. The unique
characteristics of longitudinal data (successive profile responses) with repeatable events
allow one to control for unobserved individual characteristics (Powers & Xie 2000). In
a binary logit model we assume the observations are independent across individuals, but
![Page 184: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/184.jpg)
Chapter 7: Modelling Policy Reaction
166
not necessarily across successive responses of one individual. A previous event induces
a change in individual behaviour. Therefore a panel data model was worth investigating
in this case.
7.3.2 Panel Data Model
Louviere et al. (2000) stated that in the case of successive profiles one response may
depend in some way on previous responses. The basic formulation of the panel data
mode is:
)(
)(
1 qqt
qqt
x
x
iqt eeP αβ
αβ
+
+
+= ........................................................ (7.2)
where alternative i is chosen by individual q at the tth profile. The αq is an individual
heterogeneity term, which can be expressed as:
∑=
′−−−=iT
tqqtqqtq bxxyy
1)()(α ...................................(7.3)
Here ∑ ==
T
t qtq yy1
and ∑ ==
T
t qtq xx1
, where yqt is choice of individual q at time period t
and xqt is the vector for individual q at time period t.
A model is developed by considering panel observations. That means 16 choice
responses per respondent are considered as data for 16 steps or ‘periods’. The results of
a panel data model for binary choice are shown in Table 7.5 (LIMDEP output is shown
in Appendix-7C).
This model (Q1SPP) seems very good as compared with the base model (Q1SP), though
data for 78 individuals (out of 358) were excluded because αq is not estimable. This
group contains all responses that were the same (either all 1s or all 0s). Powers & Xie
(2000) stated that this model is affected by an incidental parameter problem because
there is a unique αq term for each individual. This unique term can be factored out
considering only those binary sequences where a change in responses in all profiles
occurs. The model is developed using eventually 280 (=358-78) individual series of
responses which are different in different ‘periods’. The model provides outstanding
fitness results because of excluding those who gave the same response to all questions.
However, the exclusions mean that the responsiveness represented in the estimated
coefficients (Table 7.5) is exaggerated.
![Page 185: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/185.jpg)
Chapter 7: Modelling Policy Reaction
167
Table 7.5: Panel data model for Q1 with only SP data (Q1SPP)
Variables Coefficient Std. Err. t-ratio
βfuelprice -1.910 0.14 -13.36
βfixedcharge -0.866 0.06 -13.66
βsizecharge -1.074 0.11 -9.64
βentrytime -0.538 0.03 -17.68
βparkfee -1.173 0.04 -28.27
βparkspace -0.546 0.10 -5.23
βlane -0.284 0.10 -2.68
Sample size 4480
Log likelihood function -1332.00
Pseudo R2 0.60
χ2 4051.61
The coefficients of the panel data model (Q1SPP) show higher values for all of the
attributes than the Q1SP model. Each group has its own parameter vector, qi δββ +=′ ,
where δq is a scalar for the individual. This circumstance suggests that an individual
specific model, which captures individual heterogeneity, needs to be developed. The
latent class model (LCM) is such a model that can analyse heterogeneity between
individuals.
7.3.3 Latent Class Model
The underlying theory of the latent class model assumes that individual behaviour
depends on observable attributes and on latent heterogeneity that varies with factors
which are unobservable to the analyst (Greene and Hensher 2002). Segmentation or
classification is established with respect to the intrinsic preferences of the choice.
Respondents may vary their responses to the choice scenario alternatives with respect
to, say, imposed charges. This heterogeneity in charge responsiveness may be related to
socio-demographic characteristics. Even after including basic demographic
characteristics in the model, there are several sources of heterogeneity which often are
unobserved but have an important influence on the choice behaviour (Abramson et al.
1998). Swait (1994) argued that classes or segments can be defined not only on the
![Page 186: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/186.jpg)
Chapter 7: Modelling Policy Reaction
168
basis of attitudinal and socio-demographic data, but also on observed choice behaviour
and attributes of the alternatives.
Swait (1994) suggested that classes can be characterised by variance differences, so that
members of class c have taste parameter, βc and scale λc. If the utility function is
ciqiqcccicciq XU ||| εβλαλ ++= and ciq|ε is conditionally IID extreme value type I within
class, then the choice probability for members of class c is expressed as
∑= )(
)(
| jqcc
iqcc
X
X
ciq eeP βλ
βλ
..................................................... (7.4)
If the probability of being in class c is given by Wqc, then the unconditional probability
of choosing alternative i is
qcC
c ciqiq WPP ∑ ==
1 | ..................................................... (7.5)
The probability, Wqc, is the prior probability attached (by the analyst) to membership of
being in class c. This probability is individual specific if individual characteristics
sharpen the prior probability, but in many applications Wqc is simply a constant (Wc).
There are many ways to parameterise Wqc, a convenient one being the multinomial logit
form (Greene 2005, Kamakura et al. 1994).
∑=
= C
k
Z
Zq
qcqk
c
e
eW
1
αγ
αγ
................................................................ (7.6)
Here α is the scale factor of the membership function, γc is the class parameter, and
vector Zq is an unknown segment specific parameter containing both a psychographic
construct (based on choice behaviour) and the socio-demographic information for
individual q. People with invariant characteristics will be in one class. The class
specific probabilities may be a set of fixed constants if no such characteristics are
observed. Bartholomew (1987) reported that the conditional choice probabilities can be
decomposed into weighted averages of latent choice probabilities. This model does not
impose the Independence-from-Irrelevant Alternatives (IIA) property on the observed
probabilities (Greene 2002). In latent class modelling a response to one profile is
assumed to be independent of a response to other profiles. In other words, a response to
one item tells us nothing about a response to another item once we take class
membership into account (Flaherty 2002). Another assumption of the latent class model
is that the classes are mutually exclusive and exhaustive. In principle the graphical
![Page 187: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/187.jpg)
Chapter 7: Modelling Policy Reaction
169
structure of the latent class model is expressed in Figure 7.1, where a different segment
or class is C, and yes and no responses are i and j respectively.
When the number of classes is unknown, choosing the number of classes becomes a
model selection issue. That means one should select the best model from a set of
models with different numbers of classes. However, we cannot compare the models
using a log-likelihood ratio test because those conditional tests do not follow the χ2
distribution. Therefore the AIC (Akaike Information Criteria) and BIC (Bayes
Information Criteria) are the alternatives to select the model (Moustaki & Papageorgiou
2005, Flaherty 2002, Swait 1994).
The LIMDEP’s default number of latent classes is five, but this is fairly high (Greene
2002). This study investigated the model fit for class numbers 2, 3, and 4 using AIC and
BIC. A series of latent class models were also developed by identifying variables for
the segmentations. None of the variables produced a significantly better model.
Although a model with 4 classes provides a better model in terms of AIC and BIC,
further observations in terms of magnitudes and signs of coefficients, standard errors,
marginal effects, and t-ratios show that models with 3 classes and 4 classes are not
practically useful. Hence the model with 2 classes was selected for this dataset as the
signs of the parameters are correct and their significance levels are fairly high.
The results of the latent class model (Q1LC) developed in this study are shown in Table
7.6 (LIMDEP output is shown in Appendix-7D).
C1 C2 Cn
i j i j i j
Figure 7.1: Latent class model structure
![Page 188: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/188.jpg)
Chapter 7: Modelling Policy Reaction
170
Table 7.6: Latent class model with SP and socio-demographic variables (Q1LC)
Latent class 1 (202 members) Latent class 2 (156 members)
Coefficient Std. err. t-ratio Coefficient Std. err. t-ratio Constant 1.910 0.21 9.10 5.259 1.41 3.73
βfuelprice -1.085 0.12 -8.95 -1.209 0.37 -3.25
βfixedcharge -0.513 0.08 -6.10 -0.725 0.26 -2.78
βsizecharge -0.683 0.13 -5.28 -0.578 0.24 -2.37
βentrytime -0.383 0.03 -14.26 -0.283 0.08 -3.53
βparkfee -0.703 0.03 -22.76 -0.858 0.07 -11.87
βparkspace -0.436 0.12 -3.77 -0.862 0.28 -3.06
βlane -0.095 0.15 -0.62 -0.799 0.36 -2.20
βcar/licence 0.723 0.06 12.27 1.360 0.10 13.35
βworkpurpose 0.738 0.07 10.45 1.627 0.15 10.63
βcarsize 0.279 0.06 4.57 1.240 0.08 15.87
Prior probabilities for class membership
0.56 0.03 20.86 0.44 0.03 16.20
Log likelihood function -2303.40
Pseudo R2 0.29
χ2 1876.18
This model produces a better fit than the basic logistic model (Q1SPSD) in terms of log-
likelihood and pseudo R2. The two classes show their uniqueness through the estimated
parameters. We can see that members in class 2 appear to be more sensitive to the fixed
charge and parking fee. Although the levels of confidence in the class 2 estimates are
not as high, some of them are significantly different from the class 1 estimates. A
significant difference test is done with the following asymptotically normal test statistic:
)()( 21
21
kk
kk
VarVarz
ββ
ββ
+
−= …………………………………… (7.7)
The effects of socio-demographic factors on class 2 are higher than on class 1.
Although these two classes are fairly similar in terms of choice attributes, except
parking fee, they are significantly different (at 95% confidence level) with respect to the
effect of socio-demographic characteristics.
![Page 189: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/189.jpg)
Chapter 7: Modelling Policy Reaction
171
The model can certainly reveal the heterogeneity of the individuals in the dataset. Table
7.7 shows the clear distinction in terms of choice behaviour. The members in class 1
predominantly (72%) choose the no alternative, whereas members in class 2 prefer
(80%) choosing the yes alternative.
Table 7.7: Cross tabulation of class members and choice alternatives (percentage)
Class 1 Class 2
No 72 20
Yes 28 80
The main purpose of the latent class model is to segment the sample on the basis of
homogeneity. Members within a class should have one or more similar characteristics,
which may not be known to the analyst. The study further investigated the socio-
demographic profile (available with this data set) of the class members. Noteworthy
factors in the data set are i) purpose of the trip to the city, ii) car size, iii) whether full-
time worker in the city or not, iv) number of cars in household, v) entry time to the city,
which are used to identify the relationship with the class membership.
The mean values of different variables for class 1 and class 2 are presented in Table 7.8.
Only metric variables are shown in the table; other non-metric (categorical) variables
are presented in cross-tabulation form in a later section. Table 7.6 shows that class 1
and class 2 are only slightly different in terms of the variables presented. Members of
both classes drove to the city on average about 3.5 times a week, spent almost 3 hours,
entered the city around 11 am, paid about $1.00 a litre for petrol and took 36 minutes
travel time on public transport. Only in cars and licences per household did they differ
a little.
![Page 190: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/190.jpg)
Chapter 7: Modelling Policy Reaction
172
Table 7.8: Mean values of selected variables for class 1 and class 2
Variables
Class 1
(202 members)
Class 2
(156 members)
Weekly car trips to Perth city 3.6 3.5
Time spent on last trip to Perth city (min) 174.9 177.4
Time of entry on last trip 11am 11am
Fuel price per litre (¢) 100.3 101.5
Parking fee per hour ($) 1.2 1.5
Travel time on public transport (min) 36.0 36.1
Number of cars in household 1.9 2.2
Number of licences in household 2.0 2.2
Furthermore, cross tabulations between class members and categorical variables also
provide inconclusive evidence of differentiation. To investigate the relationship
between class membership and trip purpose, a cross tabulation is presented in Table 7.9.
In both classes the majority of members are non-work travellers, and also the ratio
between work and non-work are very similar for both classes.
Table 7.9: Latent class and purpose group membership (% of class in brackets)
Non-work purpose Work purpose
Class 1 148 (73.2) 54 (26.7)
Class 2 107 (68.6) 49 (31.4)
Table 7.10 shows a cross-tabulation between class membership and selected variables.
The only variable in which there is an appreciable difference is number of cars. Class 2
has a higher proportion of 2 or more car households but the difference is not great
enough for distinctive segmentation. Frequency of trips to Perth is not a useful variable
to classify the segments. In both classes a little more or less than 30% go to the city
once a week, about 20% go once a month and about 50% go less frequently.
A relationship between class membership and alternative options available in case it is
inconvenient to take a car to the city is also inconclusive. Finally, the tabulation of class
and parking fee per hour shows that a smaller proportion of class 1 member pay more
![Page 191: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/191.jpg)
Chapter 7: Modelling Policy Reaction
173
than $3 per hour than class 2 members, but it is not conclusive in segmenting these two
groups.
Table 7.10: Latent class and selected variables (in brackets, % of class in each case)
Class 1
(202 members)
Class 2
(156 members)
Cars in household
1car in household 77 (38.1) 31 (19.9)
2 or more car in household 125 (61.9) 125 (80.1)
Frequency of trip to Perth
Once a week 54 (26.7) 53 (34.0)
About once a month 39 (19.3) 31 (19.9)
Less frequently 109 (54.0) 72 (46.2)
Alternatives of not taking a car to Perth
Change mode 156 (77.0) 99 (63.2)
Change time of day 4 (2.0) 13 (8.4)
Cancel activity 20 (10.0) 19 (12.3)
Perform activity to another location 22 (11.0) 25 (16.1)
Parking fee per hour
Free parking 73 (36.1) 51 (32.4)
up to $0.75 7 (3.7) 3 (2.1)
$0.75 to $1.5 50 (24.6) 32 (20.4)
$1.5 to $3.0 63 (31.4) 55 (35.2)
More than $3.0 8 (4.2) 15 (9.9)
Abramson et al. (1998) stated that latent class models may indicate the variability of
consumers’ intrinsic preferences but they cannot be used to identify individuals with a
strong positive or negative response. An important finding obtained in this latent class
analysis is that the segmentation is unable to capture a behavioural difference between
members of the two classes. Intrinsic preference is not observed; however there could
be a strong relationship between class membership and other socio-demographic factors
such as income, age, gender, etc. which were not collected in this survey. Although
![Page 192: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/192.jpg)
Chapter 7: Modelling Policy Reaction
174
Table 7.6 shows greater sensitivity to some charges by class 2 members, the differences
were not as great as the differences between the work and non-work groups. The next
section deals with models for these two groups of respondents – work purpose and non-
work purpose.
7.3.4 Binary logit models for work and non-work groups
Table 6.3 in Chapter 6 shows the differences in purposes of trips to the city. Table 7.11
(reproduced from Table 6.9) shows that substantial differences in travel behaviour are
associated with the purpose of trips. Percentages of Yes responses for the two groups
show a clear dissimilarity in the 16 scenarios.
Table 7.11: Responses to SP profiles for work and non-work groups
Attributes
% giving a Yes response
(whether to go to the city by car)
Scenario
Fuel price
($/ litre)
Fixed charge
($/ entry)
Car size charge
($/ large car)
Entry time charge ($ at
morning peak)
Parking fee ($/
hr)
Parking space
Lane restriction
for cars Work
purpose group
Non-work
purpose group
1 1.5 0 1 4 2 Limited yes 48.6 33.0
2 1 2 1 4 0 un-limited yes 67.9 44.4
3 1 1 0 4 2 un-limited yes 59.0 44.1
4 2 0 1 4 5 un-limited no 29.5 12.6
5 1 0 0 0 0 Limited yes 92.3 84.2
6 2 0 0 4 0 Limited yes 67.3 46.2
7 1 2 1 4 0 limited no 59.6 40.8
8 1.5 2 0 0 5 un-limited yes 36.5 16.2
9 1 1 0 4 5 limited no 34.6 14.2
10 1 0 1 0 5 limited yes 39.4 17.3
11 1.5 1 1 0 0 limited no 76.0 65.1
12 2 1 1 0 0 un-limited yes 72.1 56.3
13 1.5 0 0 4 0 un-limited no 76.0 62.8
14 1 0 1 0 2 un-limited no 71.2 68.6
15 1 0 0 0 0 un-limited no 92.3 92.0
16 2 2 0 0 2 limited no 57.7 33.3
![Page 193: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/193.jpg)
Chapter 7: Modelling Policy Reaction
175
It is clear that the two groups differ in their responses. Therefore, separate binary logit
models for the work purpose and non-work purpose groups have been developed. Table
7.12 shows the results of these two models (LIMDEP output is shown in Appendix-7E).
The coefficients for car size charge, entry time charge, parking space, lane restriction,
and car per licence are not significantly different. However the important coefficients
for parking fee are significantly different at the 95% level and also for car size (99%).
The fuel price and fixed charge coefficients differ significantly at the 90% level. To
most of the policy measures the non-work group is more responsive than the work
group, except for car size charge which is also reflected in the actual car size variable.
Travel by the non-work group is generally discretionary so that these people have more
freedom of choice and are therefore more responsive. The coefficients for cars per
licence indicate that people in the work group are more inclined to take a car to the city
than those in the non-work group when this ratio is higher. More detailed discussion of
the group behaviour in terms of policy measures is in a later section.
Table 7.12: Binary logit model for the work (Q1SPSDW) and the non-work (Q1SPSDNW) purpose group with SP and socio-demographic data
Work purpose Non-work purpose
Coefficient Std. Err. t-ratio Coefficient Std. Err. t-ratio Constant 1.344 0.34 3.97 2.146 0.20 10.49
βfuelpricl -0.486 0.14 -3.53 -0.747 0.09 -8.37
βfixedcharge -0.283 0.07 -4.17 -0.420 0.04 -9.69
βsizecharge -0.415 0.12 -3.60 -0.379 0.07 -5.14
βenrtytime -0.168 0.03 -5.83 -0.214 0.02 -11.50
βparkfee -0.392 0.03 -13.88 -0.464 0.02 -23.24
βparkspace -0.196 0.11 -1.72 -0.325 0.07 -4.47
βlane -0.128 0.11 -1.12 -0.231 0.07 -3.16
βcar/licence 0.970 0.20 4.94 0.625 0.12 5.14
βcarsize 0.816 0.12 7.03 0.205 0.07 2.85
Sample size 1648 4080
Log likelihood function -927.15 -2296.25
Pseudo R2 0.15 0.18
χ2 338.08 1039.06
![Page 194: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/194.jpg)
Chapter 7: Modelling Policy Reaction
176
7.4 MARGINAL EFFECTS ANALYSIS
The literature indicates that marginal effects (Equation 6.8) are more meaningful
measures than coefficients from a logit model (Hosmer & Lemeshow 2000). The utility
parameters are not the marginal effects (Louviere et al. 2000). The marginal effects of
Q1SPSDW and Q1SPSDNW models are provided in Table 7.13.
Table 7.13: Marginal effects on choice of car for the work and non-work groups
Attribute Work group Non-work group
Fuel -0.11 -0.19
Fixed charge -0.06 -0.10
Car size charge -0.09 -0.09
Entry time charge -0.04 -0.05
Parking fee -0.09 -0.11
Parking space -0.05 -0.08
Lane restriction -0.03 -0.06
Car per licence 0.22 0.15
Car size 0.19 0.05
As an example (Table 7.13), a $1 increase in fuel price reduces the probability of taking
a car to the city by 11% and 19% for the work and non-work groups respectively. On
the other hand, the probability of taking a car is increased by 22% and 15% for the work
and non-work groups with one unit increase in cars per licence. In almost all of the
policy measures the non-work group is more sensitive than the work purpose group. In
contrast, the work group is more affected than the non-work group by changes in socio-
demographic variables. These results imply that the non-work group has alternatives to
taking a car to the city. They can perform their activities in other locations, change
entry time of day, use public transport or even cancel the activity in the city, whereas
the work group may not have that flexibility. A relationship between marginal effect
and odds ratio can be expressed in equation (7.8).
)()1( 2 ORLn
ORORME+
= ....................................... (7.8)
Where, ME is marginal effect and OR is odds ratio.
![Page 195: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/195.jpg)
Chapter 7: Modelling Policy Reaction
177
Previously calculated odds ratios (shown in Table 7.2) can be converted to marginal
effects using equation (7.8). Odds ratios of the fuel attribute for both the work and non-
work groups are transformed into marginal effects for demonstration. The odds ratios
of fuel price increases from $1 to $2 were 0.72 and 0.57 for the work and non-work
groups. Marginal effects derived from these two figures (by equation 7.8) are -0.08 and
-0.13 compared to -0.11 and -0.19 in Table 7.13. The marginal effects estimated for the
same attribute from the binary logit model are not expected to be the same but close
enough to indicate consistency.
Elasticity estimation is not appropriate in those cases where the attribute’s base value is
zero (non-existence in reality). The marginal effect takes the place of elasticity. In all
cases, marginal effects play a significant role in assessing the reaction of travellers to
the air quality control policy. However, fuel price elasticity can be calculated as actual
fuel prices paid by the respondents were collected in the survey.
7.5 FUEL PRICE ELASTICITY
The models developed in this chapter produce different coefficients for the same
attribute. They are not directly comparable because of the different model
specifications. These produce different scale factors in the model so that comparison of
coefficients is inappropriate. However comparison can be made after computing
elasticities for the same attribute. Choice elasticities are probably the most useful
output from discrete choice analysis for policy purpose (Taplin et al. 1999). As
discussed in Chapter 5 (5.2.2), elasticity should be calculated using the probability
weighted mean of the sample. The direct elasticity of individual q choosing alternative i
is expressed in equation (7.9).
)1( iqfqffq PXE −= β .......................................... (7.9)
Where, βf is fuel price coefficient
Xfq is fuel price paid by q individual
Piq is probability of choosing i alternative by q individual
A weighted mean is calculated from the individual elasticities:
![Page 196: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/196.jpg)
Chapter 7: Modelling Policy Reaction
178
∑∑ −
=
qiq
qiqiqfqf
f P
PPXE
)1(β ................................................. (7.10)
Various models developed in this chapter provide different fuel price coefficients.
Table 7.14 shows fuel price elasticities from various models with their fuel coefficients.
The estimated elasticities from various models are within a range between -0.095 and
-0.192. These figures are well within previously estimated fuel price elasticities in
various places including the capital cities in Australia and can be compared with the
short term variable elasticities presented in Table 4.9 in Chapter 4. Such results suggest
that the estimates made by SP alone may not be far out of line with actually observed
behaviour in this case.
Table 7.14: Fuel price elasticities for various models
Model
Fuel
coefficient
Fuel price
elasticity
Model with only SP data -0.650 -0.133
Model with SP and socio-demographic data -0.675 -0.132
Panel Data model -1.910 -0.192
Latent Class Model
Class 1 -1.084 -0.145
Class 2 -1.208 -0.126
Work group model with SP and socio-demographic data -0.486 -0.095
Non-work group model with SP and socio-demographic data -0.747 -0.145
Range of estimates from previous studies (excluding extremes) -0.09 to -0.3
Fuel elasticities for the work and non-work groups show that working people are less
responsive in fuel price change than non-work group. For 1% increase in fuel price,
work group is 0.095% less likely to take a car to the city, whereas non-work group is
0.145% less likely to take a car to the city.
7.6 BINARY LOGIT MODEL FOR Q2
Conditional question (Q2) followed from the answer to the first question. The question
was whether respondents would take a car to the city between 7am and 10am if they
intended to take a car. The response to this question is also in binary form. People are
expected to be influenced by two SP attributes; these are entry time charge and lane
![Page 197: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/197.jpg)
Chapter 7: Modelling Policy Reaction
179
restriction. Binary logit model (Q2SP) gave the results in Table 7.15 (LIMDEP output
is shown in Appendix-7F).
Table 7.15: Binary logit model for Q2 with only SP data (Q2SP)
Variables Coefficient Std. Err. t-ratio
Constant 0.519 0.0603 8.6
βentrytime_charge -0.360 0.0205 -17.6
βlane_restriction -0.125 0.0795 -1.6
The Q2SP model (Table 7.15) shows the expected inverse relationships. A slightly
improved model is obtained by adding a dummy variable to represent the work purpose
group. The results are shown in Table 7.16 (LIMDEP output is shown in Appendix-
7G).
Table 7.16: Binary logit model for Q2 with SP and work purpose (Q2SPSD)
Variables Coefficient Std. Err. t-ratio
Constant 0.525 0.0604 8.69
βentrytime_charge -0.361 0.0205 -17.66
βlane_restriction -0.123 0.0796 -1.55
βworkpurp 0.0012 0.0006 1.99
Sample size 2925
Log likelihood function -1844.53
Pseudo R2 0.09
χ2 354.88
This model (Q2SPSD) shows that the dummy variable has a very small influence, but it
is logical to include it. All these models are good estimators for assessing people’s
reaction to policy measures.
7.7 SUMMARY AND CONCLUSION
The focus of this chapter is on assessing the reactions of travellers to potential policies
to control air pollution in Perth city. The collected data (Chapter 6) were used to
develop a policy reaction model. A range of models are developed which enable one to
gain the insights into travel behaviour with respect to charging policies.
![Page 198: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/198.jpg)
Chapter 7: Modelling Policy Reaction
180
A latent class model was developed to segment groups with respect to their response
behaviour and unknown influences. It gave fairly good model fit results but failed to
identify the class members’ characteristics in terms of socio-demographic attributes.
Instead, grouping on the basis of work and non-work gave models which are most
appropriate for further analysis. Marginal effects analysis shows that the non-work
group is more sensitive to charges than the work group. The same conclusion is
obtained from fuel price elasticities. Fuel price elasticities from the various models
indicated a general consistency and reliability as they are well within the range of
previously estimated elasticities in Australia.
The results reported in this chapter indicate that the behaviour of travellers to Perth city
in response to the hypothesised Air Quality Control Policy (AQCP) would make that
policy effective in improving air quality in Perth. The majority of travellers are in the
non-work purpose group and they are more sensitive to the proposed policy. Chapter 8
combines the results of this chapter and the econometric model developed in Chapter 5.
Then the combined model’s simulation results are used to determine the impact on air
quality in Perth through the air pollution model developed in Chapter 3.
![Page 199: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/199.jpg)
Chapter 7: Modelling Policy Reaction
181
Appendix – 7A Binary Logit Model (Q1SP) for taking a car choice with only stated preference data --> LOGIT ;lhs=q1 ;rhs=one,fuel,fixed,size,entytime,parkfee,parkspac,lane $ Normal exit from iterations. Exit status=0. +---------------------------------------------+ | Multinomial Logit Model | | Maximum Likelihood Estimates | | Model estimated: Jun 23, 2006 at 07:01:01PM.| | Dependent variable Q1 | | Weighting variable None | | Number of observations 5728 | | Iterations completed 5 | | Log likelihood function -3357.816 | | Number of parameters 8 | | Info. Criterion: AIC = 1.17522 | | Finite Sample: AIC = 1.17522 | | Info. Criterion: BIC = 1.18451 | | Info. Criterion:HQIC = 1.17845 | | Restricted log likelihood -3969.895 | | Chi squared 1224.157 | | Degrees of freedom 7 | | Prob[ChiSqd > value] = .0000000 | | Hosmer-Lemeshow chi-squared = 13.22925 | | P-value= .10420 with deg.fr. = 8 | +---------------------------------------------+ +---------+--------------+----------------+--------+---------+-------+ |Variable | Coefficient | Standard Error |b/St.Er.|P[|Z|>z] | Mean of X| +---------+--------------+----------------+--------+---------+-------+ Characteristics in numerator of Prob[Y = 1] Constant 2.76857682 .14064857 19.684 .0000 FUEL -.65056735 .07282527 -8.933 .0000 1.37500000 FIXED -.36911304 .03539368 -10.429 .0000 .75000000 SIZE -.38160019 .06026813 -6.332 .0000 .50000000 ENTYTIME -.19385051 .01516029 -12.787 .0000 2.00000000 PARKFEE -.41974356 .01562544 -26.863 .0000 1.75000000 PARKSPAC -.28348123 .05972747 -4.746 .0000 .50000000 LANE -.20478177 .05999277 -3.413 .0006 .50000000 +--------------------------------------------------------------------+ | Information Statistics for Discrete Choice Model. | | M=Model MC=Constants Only M0=No Model | | Criterion F (log L) -3357.81617 -3969.89452 -3970.34705 | | LR Statistic vs. MC 1224.15672 .00000 .00000 | | Degrees of Freedom 7.00000 .00000 .00000 | | Prob. Value for LR .00000 .00000 .00000 | | Entropy for probs. 3357.81618 3969.89452 3970.34705 | | Normalized Entropy .84572 .99989 1.00000 | | Entropy Ratio Stat. 1225.06174 .90505 .00000 | | Bayes Info Criterion 6776.20418 8000.36090 8001.26595 | | BIC - BIC(no model) 1225.06177 .90505 .00000 | | Pseudo R-squared .15418 .00000 .00000 | | Pct. Correct Prec. 68.29609 .00000 50.00000 | | Means: y=0 y=1 y=2 y=3 y=4 y=5 y=6 y>=7 | | Outcome .4937 .5063 .0000 .0000 .0000 .0000 .0000 .0000 | | Pred.Pr .4937 .5063 .0000 .0000 .0000 .0000 .0000 .0000 | | Notes: Entropy computed as Sum(i)Sum(j)Pfit(i,j)*logPfit(i,j). | | Normalized entropy is computed against M0. | | Entropy ratio statistic is computed against M0. | | BIC = 2*criterion - log(N)*degrees of freedom. | | If the model has only constants or if it has no constants, | | the statistics reported here are not useable. | +--------------------------------------------------------------------+
![Page 200: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/200.jpg)
Chapter 7: Modelling Policy Reaction
182
+----------------------------------------+ | Fit Measures for Binomial Choice Model | | Logit model for variable Q1 | +----------------------------------------+ | Proportions P0= .493715 P1= .506285 | | N = 5728 N0= 2828 N1= 2900 | | LogL = -3357.81617 LogL0 = -3969.8945 | | Estrella = 1-(L/L0)^(-2L0/n) = .20714 | +----------------------------------------+ | Efron | McFadden | Ben./Lerman | | .19635 | .15418 | .59859 | | Cramer | Veall/Zim. | Rsqrd_ML | | .19706 | .30311 | .19242 | +----------------------------------------+ | Information Akaike I.C. Schwarz I.C. | | Criteria 6715.63512 6715.64442 | +----------------------------------------+ +---------------------------------------------------------+ |Predictions for Binary Choice Model. Predicted value is | |1 when probability is greater than .500000, 0 otherwise.| |Note, column or row total percentages may not sum to | |100% because of rounding. Percentages are of full sample.| +------+---------------------------------+----------------+ |Actual| Predicted Value | | |Value | 0 1 | Total Actual | +------+----------------+----------------+----------------+ | 0 | 1938 ( 33.8%)| 890 ( 15.5%)| 2828 ( 49.4%)| | 1 | 926 ( 16.2%)| 1974 ( 34.5%)| 2900 ( 50.6%)| +------+----------------+----------------+----------------+ |Total | 2864 ( 50.0%)| 2864 ( 50.0%)| 5728 (100.0%)| +------+----------------+----------------+----------------+
![Page 201: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/201.jpg)
Chapter 7: Modelling Policy Reaction
183
Appendix – 7B Binary Logit Model (Q1SPSD) for taking a car choice with stated preference and socio-demographic data --> LOGIT ;lhs=q1 ;rhs=one,fuel,fixed,size,entytime,parkfee,parkspac,lane,car_lic,workpurp,... $ Normal exit from iterations. Exit status=0. +---------------------------------------------+ | Multinomial Logit Model | | Maximum Likelihood Estimates | | Model estimated: Mar 08, 2006 at 02:57:09PM.| | Dependent variable Q1 | | Weighting variable None | | Number of observations 5728 | | Iterations completed 6 | | Log likelihood function -3241.487 | | Number of parameters 11 | | Info. Criterion: AIC = 1.13564 | | Finite Sample: AIC = 1.13565 | | Info. Criterion: BIC = 1.14842 | | Info. Criterion:HQIC = 1.14009 | | Restricted log likelihood -3969.895 | | Chi squared 1456.815 | | Degrees of freedom 10 | | Prob[ChiSqd > value] = .0000000 | | Hosmer-Lemeshow chi-squared = 12.42675 | | P-value= .13315 with deg.fr. = 8 | +---------------------------------------------+ +---------+-------------+---------------+--------+---------+---------+ |Variable |Coefficient |Standard Error |b/St.Er.|P[|Z|>z] |Mean of X| +---------+-------------+---------------+--------+---------+---------+ Characteristics in numerator of Prob[Y = 1] Constant 1.75784227 .17336152 10.140 .0000 FUEL -.67569311 .07438906 -9.083 .0000 1.37500000 FIXED -.38475502 .03622523 -10.621 .0000 .75000000 SIZE -.39532308 .06154631 -6.423 .0000 .50000000 ENTYTIME -.20190196 .01550156 -13.025 .0000 2.00000000 PARKFEE -.43906150 .01613191 -27.217 .0000 1.75000000 PARKSPAC -.29737900 .06100459 -4.875 .0000 .50000000 LANE -.21422146 .06124263 -3.498 .0005 .50000000 CAR_LIC .72596102 .10319751 7.035 .0000 .99394786 WORKPURP .71067523 .06828687 10.407 .0000 .28770950 CARSIZE .37702134 .06090448 6.190 .0000 .53910615 +--------------------------------------------------------------------+ | Information Statistics for Discrete Choice Model. | | M=Model MC=Constants Only M0=No Model | | Criterion F (log L) -3241.48697 -3969.89452 -3970.34705 | | LR Statistic vs. MC 1456.81510 .00000 .00000 | | Degrees of Freedom 10.00000 .00000 .00000 | | Prob. Value for LR .00000 .00000 .00000 | | Entropy for probs. 3241.48697 3969.89452 3970.34705 | | Normalized Entropy .81642 .99989 1.00000 | | Entropy Ratio Stat. 1457.72016 .90505 .00000 | | Bayes Info Criterion 6569.50516 8026.32027 8027.22532 | | BIC - BIC(no model) 1457.72016 .90505 .00000 | | Pseudo R-squared .18348 .00000 .00000 | | Pct. Correct Prec. 70.51327 .00000 50.00000 | +--------------------------------------------------------------------+
![Page 202: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/202.jpg)
Chapter 7: Modelling Policy Reaction
184
+----------------------------------------+ | Fit Measures for Binomial Choice Model | | Logit model for variable Q1 | +----------------------------------------+ | Proportions P0= .493715 P1= .506285 | | N = 5728 N0= 2828 N1= 2900 | | LogL = -3241.48697 LogL0 = -3969.8945 | | Estrella = 1-(L/L0)^(-2L0/n) = .24496 | +----------------------------------------+ | Efron | McFadden | Ben./Lerman | | .23007 | .18348 | .61552 | | Cramer | Veall/Zim. | Rsqrd_ML | | .23091 | .34904 | .22457 | +----------------------------------------+ | Information Akaike I.C. Schwarz I.C. | | Criteria 6482.97779 6482.99056 | +----------------------------------------+ +---------------------------------------------------------+ |Predictions for Binary Choice Model. Predicted value is | |1 when probability is greater than .500000, 0 otherwise.| |Note, column or row total percentages may not sum to | |100% because of rounding. Percentages are of full sample.| +------+---------------------------------+----------------+ |Actual| Predicted Value | | |Value | 0 1 | Total Actual | +------+----------------+----------------+----------------+ | 0 | 2038 ( 35.6%)| 790 ( 13.8%)| 2828 ( 49.4%)| | 1 | 899 ( 15.7%)| 2001 ( 34.9%)| 2900 ( 50.6%)| +------+----------------+----------------+----------------+ |Total | 2937 ( 51.3%)| 2791 ( 48.7%)| 5728 (100.0%)| +------+----------------+----------------+----------------+
![Page 203: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/203.jpg)
Chapter 7: Modelling Policy Reaction
185
Appendix – 7C Panel Data Model (Q1SPP) for taking a car choice with stated preference data --> LOGIT ;lhs=q1 ;rhs=fuel,fixed,size,entytime,parkfee,parkspac,lane ;fixed effects ;pds=16 $ +---------------------------------------------+ | Logit Regression Start Values for Q1 | | Maximum Likelihood Estimates | | Model estimated: Mar 08, 2006 at 03:01:12PM.| | Dependent variable Q1 | | Weighting variable None | | Number of observations 5728 | | Iterations completed 10 | | Log likelihood function -3357.816 | | Number of parameters 8 | | Info. Criterion: AIC = 1.17522 | | Finite Sample: AIC = 1.17522 | | Info. Criterion: BIC = 1.18451 | | Info. Criterion:HQIC = 1.17845 | +---------------------------------------------+ +---------+-------------+---------------+--------+---------+---------+ |Variable |Coefficient |Standard Error |b/St.Er.|P[|Z|>z] |Mean of X| +---------+-------------+---------------+--------+---------+---------+ FUEL -.65056735 .07282527 -8.933 .0000 1.37500000 FIXED -.36911304 .03539368 -10.429 .0000 .75000000 SIZE -.38160019 .06026813 -6.332 .0000 .50000000 ENTYTIME -.19385051 .01516029 -12.787 .0000 2.00000000 PARKFEE -.41974356 .01562544 -26.863 .0000 1.75000000 PARKSPAC -.28348123 .05972747 -4.746 .0000 .50000000 LANE -.20478177 .05999277 -3.413 .0006 .50000000 Constant 2.76857682 .14064857 19.684 .0000 Nonlinear Estimation of Model Parameters Method=Newton; Maximum iterations=100 Convergence criteria: max|dB| .1000D-08, dF/F= .1000D-08, g<H>g= .1000D-08 Normal exit from iterations. Exit status=0. +---------------------------------------------+ | FIXED EFFECTS Logit Model | | Maximum Likelihood Estimates | | Model estimated: Mar 08, 2006 at 03:01:12PM.| | Dependent variable Q1 | | Weighting variable None | | Number of observations 5728 | | Iterations completed 7 | | Log likelihood function -1332.007 | | Number of parameters 287 | | Info. Criterion: AIC = .56530 | | Finite Sample: AIC = .57060 | | Info. Criterion: BIC = .89865 | | Info. Criterion:HQIC = .68133 | | Sample is 16 pds and 358 individuals. | | Bypassed 78 groups with inestimable a(i). | | LOGIT (Logistic) probability model | +---------------------------------------------+
![Page 204: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/204.jpg)
Chapter 7: Modelling Policy Reaction
186
+---------+-------------+---------------+--------+---------+---------+ |Variable |Coefficient |Standard Error |b/St.Er.|P[|Z|>z] |Mean of X| +---------+-------------+---------------+--------+---------+---------+ Index function for probability FUEL -1.91066564 .14299214 -13.362 .0000 1.37500000 FIXED -.86617453 .06337699 -13.667 .0000 .75000000 SIZE -1.07445475 .11141946 -9.643 .0000 .50000000 ENTYTIME -.53848426 .03045430 -17.682 .0000 2.00000000 PARKFEE -1.17337155 .04150714 -28.269 .0000 1.75000000 PARKSPAC -.54630255 .10437333 -5.234 .0000 .50000000 LANE -.28409980 .10586189 -2.684 .0073 .50000000
![Page 205: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/205.jpg)
Chapter 7: Modelling Policy Reaction
187
Appendix – 7D Latent Class Model (Q1LC) for taking a car choice with stated preference and trip purpose data --> LOGIT ;lhs=q1 ;rhs=one,fuel,fixed,size,entytime,parkfee,parkspac,lane,car_lic,carsize,w ;lcm ;pts=2 ;pds=16 ;fixed effects ;maxit=100 $ Normal exit from iterations. Exit status=0. +---------------------------------------------+ | Latent Class / Panel Logit Model | | Maximum Likelihood Estimates | | Model estimated: Mar 08, 2006 at 03:05:35PM.| | Dependent variable Q1 | | Weighting variable None | | Number of observations 5728 | | Iterations completed 32 | | Log likelihood function -2303.398 | | Number of parameters 23 | | Info. Criterion: AIC = .81229 | | Finite Sample: AIC = .81232 | | Info. Criterion: BIC = .83900 | | Info. Criterion:HQIC = .82159 | | Restricted log likelihood -3241.487 | | Chi squared 1876.178 | | Degrees of freedom 13 | | Prob[ChiSqd > value] = .0000000 | | Sample is 16 pds and 358 individuals. | | LOGIT (Logistic) probability model | | Model fit with 2 latent classes. | +---------------------------------------------+ +---------+-------------+---------------+--------+---------+---------+ |Variable |Coefficient |Standard Error |b/St.Er.|P[|Z|>z] |Mean of X| +---------+-------------+---------------+--------+---------+---------+ Model parameters for latent class 1 Constant 1.91004029 .27563026 6.930 .0000 FUEL -1.08477898 .13007597 -8.340 .0000 1.37500000 FIXED -.51273046 .06884833 -7.447 .0000 .75000000 SIZE -.68254282 .11081446 -6.159 .0000 .50000000 ENTYTIME -.38262654 .02761827 -13.854 .0000 2.00000000 PARKFEE -.70333564 .03991163 -17.622 .0000 1.75000000 PARKSPAC -.43555722 .10081468 -4.320 .0000 .50000000 LANE -.09454354 .10245665 -.923 .3561 .50000000 CAR_LIC .73837922 .16879266 4.374 .0000 .99394786 CARSIZE .27920491 .11171373 2.499 .0124 .53910615 WORKPURP .72255552 .11984544 6.029 .0000 .28770950 Model parameters for latent class 2 Constant 5.25887999 .72557824 7.248 .0000 FUEL -1.20853678 .18818633 -6.422 .0000 1.37500000 FIXED -.72486256 .12170503 -5.956 .0000 .75000000 SIZE -.57752262 .16948748 -3.407 .0007 .50000000 ENTYTIME -.28310161 .04422862 -6.401 .0000 2.00000000 PARKFEE -.85821722 .04637056 -18.508 .0000 1.75000000 PARKSPAC -.86171831 .16151156 -5.335 .0000 .50000000
![Page 206: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/206.jpg)
Chapter 7: Modelling Policy Reaction
188
LANE -.79901715 .16778956 -4.762 .0000 .50000000 CAR_LIC 1.62696536 .36217601 4.492 .0000 .99394786 CARSIZE 1.23971301 .17293758 7.169 .0000 .53910615 WORKPURP 1.35995199 .17810130 7.636 .0000 .28770950 Estimated prior probabilities for class membership Class1Pr .56293364 .02797334 20.124 .0000 Class2Pr .43706636 .02797334 15.624 .0000
![Page 207: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/207.jpg)
Chapter 7: Modelling Policy Reaction
189
Appendix – 7E Binary logit model for work group (Q1SPSDW) for taking a car choice with stated preference and socio-demographic data --> Sample; all$ --> reject; workpurp=0$ --> LOGIT ;lhs=q1 ;rhs=one,fuel,fixed,size,entytime,parkfee,parkspac,lane,car_lic,carsize $ Normal exit from iterations. Exit status=0. +---------------------------------------------+ | Multinomial Logit Model | | Maximum Likelihood Estimates | | Model estimated: Mar 08, 2006 at 03:17:35PM.| | Dependent variable Q1 | | Weighting variable None | | Number of observations 1648 | | Iterations completed 5 | | Log likelihood function -927.1581 | | Number of parameters 10 | | Info. Criterion: AIC = 1.13733 | | Finite Sample: AIC = 1.13741 | | Info. Criterion: BIC = 1.17014 | | Info. Criterion:HQIC = 1.14949 | | Restricted log likelihood -1096.200 | | Chi squared 338.0841 | | Degrees of freedom 9 | | Prob[ChiSqd > value] = .0000000 | | Hosmer-Lemeshow chi-squared = 2.82893 | | P-value= .94463 with deg.fr. = 8 | +---------------------------------------------+ +---------+------------+----------------+--------+---------+---------+ |Variable | Coefficient| Standard Error |b/St.Er.|P[|Z|>z] |Mean of X| +---------+------------+----------------+--------+---------+---------+ Characteristics in numerator of Prob[Y = 1] Constant 1.34424397 .33861238 3.970 .0001 FUEL -.48623486 .13788252 -3.526 .0004 1.37500000 FIXED -.28306081 .06791429 -4.168 .0000 .75000000 SIZE -.41525462 .11520832 -3.604 .0003 .50000000 ENTYTIME -.16805016 .02881126 -5.833 .0000 2.00000000 PARKFEE -.39217934 .02825296 -13.881 .0000 1.75000000 PARKSPAC -.19641088 .11392486 -1.724 .0847 .50000000 LANE -.12806099 .11406099 -1.123 .2615 .50000000 CAR_LIC .97044876 .19654957 4.937 .0000 1.04822006 CARSIZE .81566892 .11608697 7.026 .0000 .62135922 +----------------------------------------+ | Fit Measures for Binomial Choice Model | | Logit model for variable Q1 | +----------------------------------------+ | Proportions P0= .382282 P1= .617718 | | N = 1648 N0= 630 N1= 1018 | | LogL = -927.15813 LogL0 = -1096.2002 | | Estrella = 1-(L/L0)^(-2L0/n) = .19973 | +----------------------------------------+ | Efron | McFadden | Ben./Lerman | | .19022 | .15421 | .61810 | | Cramer | Veall/Zim. | Rsqrd_ML | | .19138 | .29818 | .18547 |
![Page 208: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/208.jpg)
Chapter 7: Modelling Policy Reaction
190
+----------------------------------------+ | Information Akaike I.C. Schwarz I.C. | | Criteria 1854.32841 1854.36122 | +----------------------------------------+ +---------------------------------------------------------+ |Predictions for Binary Choice Model. Predicted value is | |1 when probability is greater than .500000, 0 otherwise.| |Note, column or row total percentages may not sum to | |100% because of rounding. Percentages are of full sample.| +------+---------------------------------+----------------+ |Actual| Predicted Value | | |Value | 0 1 | Total Actual | +------+----------------+----------------+----------------+ | 0 | 336 ( 20.4%)| 294 ( 17.8%)| 630 ( 38.2%)| | 1 | 190 ( 11.5%)| 828 ( 50.2%)| 1018 ( 61.8%)| +------+----------------+----------------+----------------+ |Total | 526 ( 31.9%)| 1122 ( 68.1%)| 1648 (100.0%)| +------+----------------+----------------+----------------+ Binary logit model for non-work group (Q1SPSDNW) for taking a car choice with stated preference and socio-demographic data --> Sample; all$ --> reject; workpurp=1$ --> LOGIT ;lhs=q1 ;rhs=one,fuel,fixed,size,entytime,parkfee,parkspac,lane,car_lic,carsize $ Normal exit from iterations. Exit status=0. +---------------------------------------------+ | Multinomial Logit Model | | Maximum Likelihood Estimates | | Model estimated: Mar 08, 2006 at 03:18:10PM.| | Dependent variable Q1 | | Weighting variable None | | Number of observations 4080 | | Iterations completed 6 | | Log likelihood function -2296.257 | | Number of parameters 10 | | Info. Criterion: AIC = 1.13052 | | Finite Sample: AIC = 1.13053 | | Info. Criterion: BIC = 1.14599 | | Info. Criterion:HQIC = 1.13600 | | Restricted log likelihood -2815.791 | | Chi squared 1039.068 | | Degrees of freedom 9 | | Prob[ChiSqd > value] = .0000000 | | Hosmer-Lemeshow chi-squared = 10.08246 | | P-value= .25929 with deg.fr. = 8 | +---------------------------------------------+
![Page 209: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/209.jpg)
Chapter 7: Modelling Policy Reaction
191
+---------+------------+----------------+--------+---------+---------+ |Variable | Coefficient| Standard Error |b/St.Er.|P[|Z|>z] |Mean of X| +---------+------------+----------------+--------+---------+---------+ Characteristics in numerator of Prob[Y = 1] Constant 2.14639555 .20460977 10.490 .0000 FUEL -.74703835 .08924403 -8.371 .0000 1.37500000 FIXED -.42019967 .04337119 -9.688 .0000 .75000000 SIZE -.37892330 .07373364 -5.139 .0000 .50000000 ENTYTIME -.21352361 .01856628 -11.501 .0000 2.00000000 PARKFEE -.46370507 .01995643 -23.236 .0000 1.75000000 PARKSPAC -.32462060 .07265634 -4.468 .0000 .50000000 LANE -.23134087 .07314671 -3.163 .0016 .50000000 CAR_LIC .62502113 .12169996 5.136 .0000 .97202614 CARSIZE .20460623 .07182124 2.849 .0044 .50588235 +----------------------------------------+ | Fit Measures for Binomial Choice Model | | Logit model for variable Q1 | +----------------------------------------+ | Proportions P0= .538725 P1= .461275 | | N = 4080 N0= 2198 N1= 1882 | | LogL = -2296.25679 LogL0 = -2815.7910 | | Estrella = 1-(L/L0)^(-2L0/n) = .24537 | +----------------------------------------+ | Efron | McFadden | Ben./Lerman | | .23152 | .18451 | .61843 | | Cramer | Veall/Zim. | Rsqrd_ML | | .23226 | .35004 | .22483 | +----------------------------------------+ | Information Akaike I.C. Schwarz I.C. | | Criteria 4592.51848 4592.53396 | +----------------------------------------+ +---------------------------------------------------------+ |Predictions for Binary Choice Model. Predicted value is | |1 when probability is greater than .500000, 0 otherwise.| |Note, column or row total percentages may not sum to | |100% because of rounding. Percentages are of full sample.| +------+---------------------------------+----------------+ |Actual| Predicted Value | | |Value | 0 1 | Total Actual | +------+----------------+----------------+----------------+ | 0 | 1697 ( 41.6%)| 501 ( 12.3%)| 2198 ( 53.9%)| | 1 | 699 ( 17.1%)| 1183 ( 29.0%)| 1882 ( 46.1%)| +------+----------------+----------------+----------------+ |Total | 2396 ( 58.7%)| 1684 ( 41.3%)| 4080 (100.0%)| +------+----------------+----------------+----------------+
![Page 210: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/210.jpg)
Chapter 7: Modelling Policy Reaction
192
Appendix – 7F Binary Logit Model (Q2SP) for time of taking a car choice with only stated preference data --> LOGIT ;lhs=q2 ;rhs=one,entytime,lane $ Normal exit from iterations. Exit status=0. +---------------------------------------------+ | Multinomial Logit Model | | Maximum Likelihood Estimates | | Model estimated: Mar 08, 2006 at 03:30:58PM.| | Dependent variable Q2 | | Weighting variable None | | Number of observations 2925 | | Iterations completed 5 | | Log likelihood function -1846.748 | | Number of parameters 3 | | Info. Criterion: AIC = 1.26479 | | Finite Sample: AIC = 1.26479 | | Info. Criterion: BIC = 1.27092 | | Info. Criterion:HQIC = 1.26699 | | Restricted log likelihood -2021.975 | | Chi squared 350.4530 | | Degrees of freedom 2 | | Prob[ChiSqd > value] = .0000000 | | Hosmer-Lemeshow chi-squared = 3.80715 | | P-value= .87409 with deg.fr. = 8 | +---------------------------------------------+ +---------+-------------+----------------+--------+--------+--------+ |Variable | Coefficient Standard Error |b/St.Er.|P[|Z|>z]|Mean of X| +---------+-------------+----------------+--------+--------+--------+ Characteristics in numerator of Prob[Y = 1] Constant .51857335 .06025884 8.606 .0000 ENTYTIME -.36021110 .02046063 -17.605 .0000 1.68752137 LANE -.12531839 .07953254 -1.576 .1151 .47589744 +--------------------------------------------------------------------+ | Information Statistics for Discrete Choice Model. | | M=Model MC=Constants Only M0=No Model | | Criterion F (log L) -1846.74848 -2021.97499 -2027.45550 | | LR Statistic vs. MC 350.45302 .00000 .00000 | | Degrees of Freedom 2.00000 .00000 .00000 | | Prob. Value for LR .00000 .00000 .00000 | | Entropy for probs. 1846.74848 2021.97499 2027.45550 | | Normalized Entropy .91087 .99730 1.00000 | | Entropy Ratio Stat. 361.41406 10.96104 .00000 | | Bayes Info Criterion 3709.45905 4059.91207 4070.87311 | | BIC - BIC(no model) 361.41406 10.96104 .00000 | | Pseudo R-squared .08666 .00000 .00000 | | Pct. Correct Prec. 66.29060 .00000 50.00000 | | Means: y=0 y=1 y=2 y=3 y=4 y=5 y=6 y>=7 | | Outcome .5306 .4694 .0000 .0000 .0000 .0000 .0000 .0000 | | Pred.Pr .5306 .4694 .0000 .0000 .0000 .0000 .0000 .0000 | | Notes: Entropy computed as Sum(i)Sum(j)Pfit(i,j)*logPfit(i,j). | | Normalized entropy is computed against M0. | | Entropy ratio statistic is computed against M0. | | BIC = 2*criterion - log(N)*degrees of freedom. | | If the model has only constants or if it has no constants, | | the statistics reported here are not useable. | +--------------------------------------------------------------------+
![Page 211: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/211.jpg)
Chapter 7: Modelling Policy Reaction
193
+----------------------------------------+ | Fit Measures for Binomial Choice Model | | Logit model for variable Q2 | +----------------------------------------+ | Proportions P0= .530598 P1= .469402 | | N = 2925 N0= 1552 N1= 1373 | | LogL = -1846.74848 LogL0 = -2021.9750 | | Estrella = 1-(L/L0)^(-2L0/n) = .11779 | +----------------------------------------+ | Efron | McFadden | Ben./Lerman | | .11647 | .08666 | .55989 | | Cramer | Veall/Zim. | Rsqrd_ML | | .11647 | .18438 | .11291 | +----------------------------------------+ | Information Akaike I.C. Schwarz I.C. | | Criteria 3693.49900 3693.50514 | +----------------------------------------+ +---------------------------------------------------------+ |Predictions for Binary Choice Model. Predicted value is | |1 when probability is greater than .500000, 0 otherwise.| |Note, column or row total percentages may not sum to | |100% because of rounding. Percentages are of full sample.| +------+---------------------------------+----------------+ |Actual| Predicted Value | | |Value | 0 1 | Total Actual | +------+----------------+----------------+----------------+ | 0 | 900 ( 30.8%)| 652 ( 22.3%)| 1552 ( 53.1%)| | 1 | 334 ( 11.4%)| 1039 ( 35.5%)| 1373 ( 46.9%)| +------+----------------+----------------+----------------+ |Total | 1234 ( 42.2%)| 1691 ( 57.8%)| 2925 (100.0%)| +------+----------------+----------------+----------------+
![Page 212: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/212.jpg)
Chapter 7: Modelling Policy Reaction
194
Appendix – 7G Binary Logit Model (Q2SPSD) for time of taking a car choice with stated preference and socio-demographic data --> LOGIT ;lhs=q2 ;rhs=one,entytime,lane,workpurp$ Normal exit from iterations. Exit status=0. +---------------------------------------------+ | Multinomial Logit Model | | Maximum Likelihood Estimates | | Model estimated: Mar 08, 2006 at 03:32:29PM.| | Dependent variable Q2 | | Weighting variable None | | Number of observations 2925 | | Iterations completed 5 | | Log likelihood function -1844.531 | | Number of parameters 4 | | Info. Criterion: AIC = 1.26395 | | Finite Sample: AIC = 1.26396 | | Info. Criterion: BIC = 1.27213 | | Info. Criterion:HQIC = 1.26690 | | Restricted log likelihood -2021.975 | | Chi squared 354.8885 | | Degrees of freedom 3 | | Prob[ChiSqd > value] = .0000000 | | Hosmer-Lemeshow chi-squared = 102.76792 | | P-value= .00000 with deg.fr. = 8 | +---------------------------------------------+ +--------+-------------+----------------+--------+--------+----------+ |Variable| Coefficient | Standard Error |b/St.Er.|P[|Z|>z]| Mean of X| +--------+-------------+----------------+--------+--------+----------+ Characteristics in numerator of Prob[Y = 1] Constant .52544251 .06040349 8.699 .0000 ENTYTIME -.36180443 .02048678 -17.660 .0000 1.68752137 LANE -.12329480 .07959895 -1.549 .1214 .47589744 WORKPURP .00122706 .00061706 1.989 .0468 -4.43384615 +--------------------------------------------------------------------+ | Information Statistics for Discrete Choice Model. | | M=Model MC=Constants Only M0=No Model | | Criterion F (log L) -1844.53074 -2021.97499 -2027.45550 | | LR Statistic vs. MC 354.88849 .00000 .00000 | | Degrees of Freedom 3.00000 .00000 .00000 | | Prob. Value for LR .00000 .00000 .00000 | | Entropy for probs. 1844.53074 2021.97499 2027.45550 | | Normalized Entropy .90978 .99730 1.00000 | | Entropy Ratio Stat. 365.84952 10.96104 .00000 | | Bayes Info Criterion 3713.00463 4067.89312 4078.85416 | | BIC - BIC(no model) 365.84952 10.96104 .00000 | | Pseudo R-squared .08776 .00000 .00000 | | Pct. Correct Prec. 66.39316 .00000 50.00000 | | Means: y=0 y=1 y=2 y=3 y=4 y=5 y=6 y>=7 | | Outcome .5306 .4694 .0000 .0000 .0000 .0000 .0000 .0000 | | Pred.Pr .5306 .4694 .0000 .0000 .0000 .0000 .0000 .0000 | | Notes: Entropy computed as Sum(i)Sum(j)Pfit(i,j)*logPfit(i,j). | | Normalized entropy is computed against M0. | | Entropy ratio statistic is computed against M0. | | BIC = 2*criterion - log(N)*degrees of freedom. | | If the model has only constants or if it has no constants, | | the statistics reported here are not useable. | +--------------------------------------------------------------------+
![Page 213: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/213.jpg)
Chapter 7: Modelling Policy Reaction
195
+----------------------------------------+ | Fit Measures for Binomial Choice Model | | Logit model for variable Q2 | +----------------------------------------+ | Proportions P0= .530598 P1= .469402 | | N = 2925 N0= 1552 N1= 1373 | | LogL = -1844.53074 LogL0 = -2021.9750 | | Estrella = 1-(L/L0)^(-2L0/n) = .11925 | +----------------------------------------+ | Efron | McFadden | Ben./Lerman | | .11778 | .08776 | .56057 | | Cramer | Veall/Zim. | Rsqrd_ML | | .11784 | .18646 | .11426 | +----------------------------------------+ | Information Akaike I.C. Schwarz I.C. | | Criteria 3689.06422 3689.07240 | +----------------------------------------+ +---------------------------------------------------------+ |Predictions for Binary Choice Model. Predicted value is | |1 when probability is greater than .500000, 0 otherwise.| |Note, column or row total percentages may not sum to | |100% because of rounding. Percentages are of full sample.| +------+---------------------------------+----------------+ |Actual| Predicted Value | | |Value | 0 1 | Total Actual | +------+----------------+----------------+----------------+ | 0 | 907 ( 31.0%)| 645 ( 22.1%)| 1552 ( 53.1%)| | 1 | 338 ( 11.6%)| 1035 ( 35.4%)| 1373 ( 46.9%)| +------+----------------+----------------+----------------+ |Total | 1245 ( 42.6%)| 1680 ( 57.4%)| 2925 (100.0%)| +------+----------------+----------------+----------------+
![Page 214: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/214.jpg)
Chapter 8: Modelling the impact of policies on air quality
196
CHAPTER EIGHT Modelling the impact of policy measures on air quality in Perth
In order to calculate probable responses to policy measures, this chapter first takes the
stated preference (SP) results of Chapter 7 and integrates them into the revealed
preference (RP) results reported in Chapter 5. The objective is to assess the future air
pollution situation in Perth city if the measures are implemented and then to determine
which are the most effective relative to the costs imposed on motorists. To predict
travel behaviour, RP and SP information are combined in an efficient measure; in this
case the SP model parameters are used in the RP model to simulate results for the
purpose of prediction. Because the reliability of the required RP coefficient is low
however, the final analysis is done with SP coefficients alone.
Section 8.2 presents a set of potential policies and changes for Perth city and Section 8.3
reports their calculated impacts on car travel behaviour using the SP-RP approach and
then the estimated impact of potential policies using only SP models. In Section 8.4 the
alternative policies are assessed for impact on air quality and in Section 8.5 the effects
of the improved air quality on health outcomes. A ratio between health benefit and
financial sacrifice by motorists, a benefit-sacrifice ratio, is calculated in Section 8.6 to
compare the results of the various measures.
8.1 INTRODUCTION
The objective of testing car driver reactions to potential measures, as reported in
Chapters 6 and 7, is to assess the extent to which it is possible to influence travellers’
behaviour so that air quality can be improved. Richardson and Bae (1998) identified the
following options faced by travellers under a pricing policy:
i) Reduce trip making (for example, trip chaining, telecommuting, or simply
travelling less)
ii) No change in travel behaviour (after paying increased charges);
iii) Increasing travel (because trip times are reduced);
![Page 215: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/215.jpg)
Chapter 8: Modelling the impact of policies on air quality
197
iv) Unchanged travel behaviour combined with attempts to reduce total
automobile costs (for example, keeping vehicle longer, or replacing it with a
cheaper or fuel-efficient vehicle);
v) Changing travel behaviour with the same level of trip making (for example,
changing trip time, route, or mode, such as carpools, trains); and
vi) Changes in location (for example, residence, workplace, shopping
destination).
These options will vary with geographical and political situations and the economic
condition of the travellers. The present study assumes that the first and fifth options of
Richardson and Bae (1998), reduced trip making or changed mode or time, will be the
primary response by travellers to Perth city. A number of other issues, especially
equity, are related to pricing policy; the cost of the policy would not be viewed equally
by the economically fortunate and unfortunate members of the community. This study
is not designed to investigate equity impacts but the topic is considered briefly in
Chapter 9.
The Air Quality Control Policy (AQCP) is a combination of hypothetical pricing and
control policy measures that could be applied to car travellers to Perth city. Chapters 6
and 7 dealt with expected car traveller reactions to the policy. It was found that car trips
to the city would be reduced under various policy scenarios with the rate of reduction
varying among the scenarios. This chapter discusses the implications of the policy in
terms of air quality improvement and the consequent improvement in the health of the
population of Perth.
8.2 MODEL IMPLEMENTATION
8.2.1 Estimation of policy impacts
The sixteen policy scenarios developed for the stated preference survey in Chapter 6,
were based on seven policy attributes. An orthogonal design ensured non-correlation
among the attributes. This part of the study assesses the impact of each policy in
isolation from the others. Allowing for potential fuel price increases, which are not
under local policy influence, four cases are investigated with $1 being the charge
imposed in each case. The charges and a potential fuel price increase are summarised in
Table 8.1.
![Page 216: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/216.jpg)
Chapter 8: Modelling the impact of policies on air quality
198
Table 8.1: Potential policies and changes assessed
Fuel price
($/litre)
(1)
Fixed charge
($/entry)
(2)
Car size charge ($/large
car) (3)
Entry time charge ($ at
morning peak)
(4)
Parking fee
($/hr)
(5)
Policy or Change
(6) 1.02 1.0 0 0 1.3 Fixed charge policy
1.02 0 1.0 0 1.3 Car size charge policy
1.02 0 0 1.0 1.3 Entry time restriction policy
1.02 0 0 0 2.3 Parking charge policy
2.00 0 0 0 1.3 Fuel price increase
Other than the fuel price increase, which is tested at a potential $2.00 per litre, the four
policy measures are based on average fuel price ($1.02) paid at the time of the SP
survey. In order to estimate the separate effects of fixed charge, car size charge, and
entry time charge a $1 charge is set in each case; and parking charge is increased by $1
per hour from the average fee.
Two control measures, parking space and lane restriction, are not included here in the
policy formulation because of their non-monetary nature even though they were
included in the SP scenarios. They are considered in Chapter 9.
The average parking fee considered by the respondents in the survey for the paid-
parking space in the city was $1.30 per hour. Changes in fuel price and parking fee
would be changes to existing attributes. The expected impact of the various policy
measures on air quality is assessed in Sections 8.3, 8.4 and 8.5.
8.3 MODELLED IMPACT ON TRAFFIC
The plan to use a survey of actual behaviour and conduct a separate stated choice
survey, in which there could be no RP component, has been fully implemented and
reported in Chapter 5 (RP) and Chapters 6 and 7 (SP). Thus the two results can be
integrated but the parking coefficients of the RP model (-0.295) and the two SP models
(-0.392 for work and -0.464 for non-work) do not differ significantly. A simple z-test
found that they are not significantly different at the 95% confidence level. Furthermore
the estimated SP model coefficients are very reliable, especially the parking coefficients
which have t-values of 13.88 and 23.24, whereas the reliability of the parking
![Page 217: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/217.jpg)
Chapter 8: Modelling the impact of policies on air quality
199
coefficient in the RP model is very low (t = 0.93), meaning that there are about 18
chances in 100 that the parking fee coefficient in the RP model is zero.
Although researchers have shown limited confidence in the direct application and
external validity of SP models, a number of studies (Kocur and Louviere 1983,
Horowitz and Louviere 1993, Swait et al. 1994, Carson et al. 1994) have reported SP
model estimates which alone have been consistent with reality. Those results do not
have any direct implications for this study but there is elasticity evidence that it may be
reasonable to draw inferences from the SP results of the Car Response Survey 2005 to
actual outcomes. As noted in Chapter 7, the elasticities of demand for fuel by people
driving to the city, derived from the SP models, of -0.09 to -0.19 are within the range of
previously estimated urban short term fuel price elasticities. Also the parking charge
elasticities of -0.24 and -0.44 for the work and non-work groups from the SP models are
within the range of previous estimates. Parking elasticities are considered further in
Section 8.4.
For these reasons, the SP coefficients alone are used in a second assessment of
responses (Section 8.3.2). However the combined procedure is applied first.
8.3.1 Combined SP and RP
The SP models in Chapter 7 are used to estimate the proportion of travellers intending
to take a car to the city under the four policy measures and the hypothetical fuel price
change (Table 8.1). Prediction is done by simulating the RP model developed in
Chapter 5 using coefficients from both the RP and SP models. The mechanics of doing
this is to apply all charge related (fixed charge, size charge, and entry time charge)
coefficients to form equivalent parking fee components and then add them to form one
equivalent fee, which is used in simulating the RP model (NL model).
In the RP models the hypothetical charges were not included as choice attributes
because there were no such charges in Perth city. Only travel time, trip cost and parking
fee attributes were used in the utility function for the car driver mode. In reality car
users consider fuel price as the cost of running a car and parking fee and other
suggested charges as the cost of taking a car to the city. Travellers can reasonably be
assumed to treat all suggested charges as being equivalent to the cost of taking a car to
the city, which is equivalent to a parking fee in the present situation. The effect of
increasing fuel price and parking fee on choosing the car mode can be estimated by
![Page 218: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/218.jpg)
Chapter 8: Modelling the impact of policies on air quality
200
running a simulation of the RP model. This means using the original model’s
parameters to predict the number of travellers after a change in PARKHOUR (hourly
parking fee) attributes on only the car driver (Car A) mode. Detailed specifications of
the models are provided in Appendices 8A, 8B and 8C. The NL model developed in
Chapter 5 is shown in appendix 8A, repeated from Appendix 5F, and is used as the base
model for simulation. Appendix 8B presents the simulated model with fuel price
change and Appendix 8C with a parking charge change.
Average fuel price paid by the traveller during the survey was $1.02 per litre and
average hourly parking fee was $1.30 per hour in the city. These two values are
considered as the base level of the analysis. The study estimates the proportion of car
users under the increased fuel price and parking fee from the base case. The fixed
charge, car size charge, entry time charge, and parking fee are converted to equivalent
parking fee by equation (8.1). The coefficients of various charges shown in Table 7.12
of Chapter 7 are shown again in Table 8.2 for work and non-work group models.
Table 8.2: Model coefficients of various charges (extracted from Table 7.12)
Work group Non-work group
Charges Q1SPSDW model
coefficient
Coefficients proportional
to parking fee
Q1SPSDNW model
coefficient
Coefficients proportional
to parking fee Fixed charge -0.283 0.72 -0.420 0.91
Car size charge -0.415 1.06 -0.379 0.82
Entry time charge -0.168 0.43 -0.214 0.46
Parking fee -0.392 1.00 -0.464 1.00
( ) ( )parkingentrytimecarsizefixedparkingentrytimecarsizefixede CCCCCCCCP +++++++= 46.082.091.072.043.006.172.028.0
........................................ (8.1)
Where, Pe = Equivalent hourly parking fee ($ per hour)
Cfixed = Fixed charge per entry into Perth city ($ per entry)
Ccarsize = Car size charge for a large car per entry ($ per large car per entry)
Centrytime = Entry time charge per entry into the city between 7am and 10am ($ per entry at morning peak)
Cparking = Hourly parking fee ($ per hour)
![Page 219: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/219.jpg)
Chapter 8: Modelling the impact of policies on air quality
201
The proportional coefficients are used to formulate equation (8.1) which converts all
charges to parking fee equivalent. The results of this calculation are shown in Table
8.3.
Table 8.3: Conversion of policy measures to parking fee equivalents
Fixed charge
($/entry)
Car size charge ($/large
car)
Entry time charge ($
at morning peak)
Parking fee
($/hr)
Converted to parking fee
equivalent $ by equation (8.1)
Policy Measure
1.0 0 0 1.3 2.16 Fixed charge
0 1.0 0 1.3 2.19 Car size charge
0 0 1.0 1.3 1.75 Entry time charge
0 0 0 2.3 2.30 Parking charge
Equation (8.1) says that 28% of respondents were from the work group and 72% from
the non-work group. The coefficients of the charges are the model (Q1SPSDW and
Q1SPSDNW) parameter equivalents of a parking fee. The study would have estimated
the policy impact for the work and non-work groups which were clearly identified in
Chapter 7. However, as mentioned in Chapter 5, separate NL models for the two groups
could not be developed from the RP data because of small sample size. Parking
equivalent costs are estimated for four policy measures using equation (8.1). These
costs and suggested increase in fuel prices for four measures are used to simulate the RP
model and estimate the number of respondents choosing the car mode to go to Perth
city. These increases in trip cost and parking fee would reduce the utility of car use.
The utility function for car driver is expressed in equation (8.2) (similar to the function
shown in Section 5.5.1).
UcarD = αcarD + αtt +βtc * (Ctripcost+ Cfuel_price_increase) + βp* Pe ................ (8.2)
Where, αcarD is alternative specific constant for car driver mode. αtt is travel time coefficient considered as a constant because in the simulation
this value does not change. βtc is the coefficient of trip cost (-0.398). βp is the coefficient of parking fee (-0.295).
Ctripcost is trip cost ($ per trip). Cfuel_price_increase is increase in fuel price ($ per litre). Pe is equivalent hourly parking fee ($ per hour).
![Page 220: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/220.jpg)
Chapter 8: Modelling the impact of policies on air quality
202
Equation (8.2) is used in RP model simulations where positive values of Cfuel_price_increase
and Pe make the utility with car mode less attractive; as a result a portion of car trips
would switch to other modes (shown in Appendices 8B and 8C). As discussed in
Chapter 5, the estimated trip cost coefficient (βtc) is fairly reliable with t-value 1.9,
whereas the parking fee coefficient (βp) is relatively poor with t-value 0.93. The effect
of applying Equation (8.2) is to scale the responses to charges, thus making a moderate
reduction in the projected impacts of the hypothetical policy measures.
Table 8.4 shows the impact of suggested policies on car use for the entire sample
(LIMDEP output for fuel price and parking fee increase are provided in Appendices 8B
and 8C as examples). Although LIMDEP output (Appendix-8B) shows that the
percentage change in car driving would be -7.5%, the percentage taking a car to the city
shown in Table 8.4 is calculated as the percentage of car drivers relative to the base
case, e.g. 176 as a percentage of 204 (column 10, last row).
Table 8.4: Estimated impacts on car use to the city Policy or Change
(1)
Fuel price ($)
(2)
Fixed charge
($)
(3)
Car size charge
($)
(4)
Entry time
charge ($) (5)
Parking fee ($)
(6)
Parking fee
equivalent ($/hr)
(7)
Equivalent increase in
parking fee ($/hr)
(8)
Increase in fuel price ($) (9)
Taking a car (% of
base case) (10)
Base case 1.02 0 0 0 1.3 1.30 0 0 100
Fixed charge 1.02 1.0 0 0 1.3 2.16 0.86 0.00 91
Car size charge 1.02 0 1.0 0 1.3 2.19 0.89 0.00 91
Entry time charge 1.02 0 0 1.0 1.3 1.75 0.45 0.00 96
Parking charge 1.02 0 0 0 2.3 2.30 1.00 0.00 90
Fuel price 2.00 0 0 0 1.3 1.30 0 0.98 86
Table 8.4 indicates that one dollar imposed as a fixed charge would have the same
impact on motorists as a car size charge, with a 9% reduction (10th column) in car use
from the base case. A $1 per hour increase in parking fee to $2.30 per hour would
reduce car use by 10% and a $2.00 per litre fuel price would reduce car use to the city
by 14%. A later section discusses the sensitivity of car use to the parking fee. Fuel
price changes are omitted from subsequent discussion because these are not controlled
by any State agency.
![Page 221: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/221.jpg)
Chapter 8: Modelling the impact of policies on air quality
203
8.3.2 Application of the SP model alone
As discussed, the estimated parking coefficient in the RP model (-0.295) and the two SP
models (-0.392 for work and -0.464 for non-work) are not significantly different and the
confidence levels of the SP model parking coefficients are high. Therefore this section
uses the unmodified SP results as an alternative way to assess the impact of policy
measures on air pollution.
An advantage of this procedure is that both the work and non-work SP models can be
applied to assess the separate responses. An equivalent parking fee is not required to
apply the SP models on their own; individual charges of $1 each for the fixed charge,
car size charge and entry time charge, and $1 increase in parking fee can be directly
used to estimate the impacts. Table 8.5 shows the impact of car use under four
alternative policies using the SP models. The results are estimated by using the work
and non-work SP model coefficients with $1 increase in each variable at a time. The
impact for the entire sample is estimated by adding the work and non-work groups
proportionately.
Table 8.5: Policy responses on car use using SP models
Taking a car (% of base)
Policy Measures work non-work Combined
(28% work and 72% non-work)
Fixed charge ($1 per entry) 91 83 85
Car size charge ($1 per large car per entry) 87 85 85
Entry time charge ($1 per entry at morning peak) 95 91 92
Parking charge ($1 increase per hour) 88 81 83
The applied SP models show more response in car use than the combined SP-RP
approach. It is also evident in Table 8.5 that the non-work group is more responsive to
the charges than the work group. Both groups would react strongly to the $1 per hour
increase in parking charge but that takes account of average parking times. It was found
in the SP survey that average hours of parking by the work and non-work groups are 6
and 3 hours respectively. As the proportions of the two groups are 28% and 72%, the
calculated average parking time is 3.84 hours.
![Page 222: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/222.jpg)
Chapter 8: Modelling the impact of policies on air quality
204
The combined responses are applied in the further analysis of air pollution. The
proportions of travellers taking a car to the city under the four policy measures are
similar to the proportions estimated using the SP-RP combined approach in Section
8.3.1. However, the proportions estimated with only the SP model will be used for the
further analysis in view of this model’s greater reliability.
8.4 ESTIMATED TRAFFIC IMPACT ON AIR QUALITY
A causal relationship has been established in Chapter 3 between air pollution and traffic
level in Perth city. Hourly levels of carbon monoxide (CO) and nitrogen oxides (NOx)
can be accurately estimated by the models (CM2CO and CM2NOx) developed. Hourly
levels of CO and NOx fluctuate with the variations of wind speed, wind direction,
pollution levels in the previous period, and traffic volume. The pollution level can be
reduced by reducing the traffic volume. The suggested policies, discussed above, would
reduce the traffic volume in Perth city and lead to a reduction in the levels of CO and
NOx. The CM2CO model is used to estimate hourly CO level in the city on an average
weekday. CO levels for different measures are represented graphically in Figure 8.1. It
appears that the parking charge policy would be the most effective in reducing CO level
but that is due to the average parking time in Perth city being 3.84 hours.
CO level
0.00
0.20
0.40
0.60
0.80
1.00
1.20
1.40
100
200
300
400
500
600
700
800
900
1000
1100
1200
1300
1400
1500
1600
1700
1800
1900
2000
2100
2200
2300
2400
hour
ppm
Fixed chargeCar size chargeEntry time chargeParking chargeBase Case
Figure 8.1: Hourly CO level under alternative policy measures: a new or added
$1.00 charges in each case
![Page 223: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/223.jpg)
Chapter 8: Modelling the impact of policies on air quality
205
The CM2NOx model (see Chapter 3) is also used to estimate the impact of the suggested
policies on hourly NOx level in Perth city. Just as for CO reduction, all policy scenarios
would reduce the number of cars and therefore lower the average hourly NOx level
throughout a day, shown in Figure 8.2.
NOx level
0.00
2.00
4.00
6.00
8.00
10.00
12.00
14.00
16.00
100
200
300
400
500
600
700
800
900
1000
1100
1200
1300
1400
1500
1600
1700
1800
1900
2000
2100
2200
2300
2400
hour
pphm
Fixed chargeCar size chargeEntry time chargeParking chargeBase Case
Another way of presenting the impact on air quality of different policies is the
percentage reduction of daily average pollution level in Perth city, which is shown in
Figure 8.3. Because the $1 per hour increase is applied for 3.84 hours, the parking
charge policy reduces CO more than 14% and NOx 12% from daily average level. The
effects of the $1 fixed charge and car size charge correspond to the proportions of
respondents prepared to take their car to the city shown in Table 8.5.
Figure 8.2: Hourly NOx level under alternative policy measures: a new or added $1.00 charges in each case
![Page 224: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/224.jpg)
Chapter 8: Modelling the impact of policies on air quality
206
Daily Average Pollution Reduction
0.0%
2.0%
4.0%
6.0%
8.0%
10.0%
12.0%
14.0%
16.0%
Fixed charge(($1/entry)
Car size charge($1/large car/entry)
Entry time charge($1/entry at morning
peak)
Parking charge ($1increase per hour)
% o
f red
uctio
nCONox
Sensitivity to the parking charge policy is presented in Figure 8.4 which shows the
calculated impact on car use to the city of varying the parking fee from $1.00 to $10.00.
An hourly parking fee beyond $10.00 is presumed to be unrealistic in Perth at present.
The reduction in the percentage of people taking the car to the city from the base case
follows a slightly curvilinear form. Demand responses are not expected to be linear and
the shape of the curve in Figure 8.4 provides a realistic estimate of travel behaviour.
The base case parking fee is $1.30 per hour.
0%
10%
20%
30%
40%
50%
60%
70%
80%
90%
100%
110%
1.00
2.00
3.00
4.00
5.00
6.00
7.00
8.00
9.00
10.00
Parking fee ($/hour)
% o
f res
pond
ents
taki
ng c
ar
Figure 8.4: Impact of parking fee on car use in the city
Figure 8.3: Average daily CO and NOx reduction under alternative policy measures
![Page 225: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/225.jpg)
Chapter 8: Modelling the impact of policies on air quality
207
The parking charge elasticity provides a test of the model estimates by comparing
previous elasticity estimates. The SP-RP combined approach produces a parking charge
elasticity of -0.15 using equation (8.3) (previously presented in Chapter 4), whereas the
SP models for the work and non-work groups produce -0.24 and -0.44 respectively.
( )( )PP
VVLnLnLnLn
e21
21
−
−= …………………………………….. (8.3)
Where, e is own price elasticity
V1 is initial traffic
V2 is reduced traffic
P1 is initial price/cost
P2 is final price/cost
The parking charge elasticities of -0.24 and -0.44 estimated using the SP models can be
compared with the average of -0.30 from previous studies presented in Table 4.9
(Chapter 4) and is well within the range (-0.07 at Portland CBD to -0.68 at Los Angeles
CBD) of previous estimates. Less confidence can be placed in the elasticity of -0.15
based on the combined SP-RP estimation because the RP model coefficients are less
reliable.
After the estimation of the degree to which various policies would reduce pollution
levels in Perth city, the last step is to transform the policy impacts into actual benefits.
The major beneficial impacts are on health and these are the basis for the final policy
assessment.
8.5 HEALTH IMPACT OF AIR QUALITY IMPROVEMENT
8.5.1 Mortality and morbidity from air pollution
The effect of air pollution on health has been of concern for hundreds of years,
especially in countries where coal was widely used. For example it was reported that in
1257 Queen Eleanor was unable to remain in Nottingham because of the smoke
(Holland 1972). A number of studies have been conducted in recent years in Australia
and overseas with the objective of costing the health and environment impacts of air
pollution (Amoako et al. 2003). Recently epidemiological studies have tried to
establish the relationships between air pollution and the mortality and/or morbidity rate.
The contribution of air pollution to deaths caused by respiratory and cardiovascular
![Page 226: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/226.jpg)
Chapter 8: Modelling the impact of policies on air quality
208
diseases is particularly high. Epidemiological evidence suggests that different
pollutants (such as CO, NOx, PM10, SO2, Lead) have different influences on mortality as
well as morbidity. Many recent studies have tried to estimate the impact on mortality
due to particulates (Amoako et al. 2003, Kunzli et al. 2000, Gouveia and Fletcher 2000,
Finkelstein et al. 2003); at the same time other studies have tried to find a link between
mortality rate and NOx or CO (Chen et al. 2004, Scoggins et al. 2004, Ballester et al.
2001).
Among these studies, Amoako et al. (2003) and the Melbourne Mortality Study (2000)
have considered the Australian situation. The finding of these two studies is that air
pollution, essentially from motor vehicles, is associated with increases in mortality in all
capital cities in Australia. Amoako et al. (2003) quantified the health and economic
impacts of air pollution levels in capital cities in Australia, and the Melbourne Mortality
Study (2000) tried to estimate the relative risks (RR) of deaths due to increases in
various pollutants in Melbourne. As was mentioned in Chapter 2 the relative risk of
death is defined as the probability of death due to an event relative to the absence of that
event. The Melbourne study found a strong association of mortality with ozone and
nitrogen dioxide. Two other studies (Finkelstein et al. 2003, Gouveia and Fletcher
2000) tried to find an association between mortality, air pollution, and income or socio-
economic status. Both studies reported a positive link between lower socio-economic
status and increased relative risk of mortality. One study found an association between
residential proximity to traffic and mortality (Finkelstein et al. 2004). The study argued
that people living closer to a highway or major road have a higher probability of non-
accidental deaths. A study in China (Chen et al. 2004) found increased risk of mortality
and hospital admission for COPD (chronic obstructive pulmonary disease) with
increased SO2 and TSP (total suspended particles). A few other studies in Australia
have estimated relative risks of mortality and hospital admissions due to air pollution in
Sydney, Brisbane, and Melbourne (Morgan et al. 1998a, Simpson et al. 1997,
Petroeschevsky et al. 2001, Morgan et al. 1998b).
Different epidemiological studies report the effect of air pollution in different forms.
Some report RR (relative risk) of mortality due to an increase in 10 μg/m3 of any
pollutant; others report percentage increase in mortality due to an increase in hourly (or
daily) concentration of any pollutant from the10th to 90th centile. Another variation in
these studies is in the method used to estimate the relationship between mortality and air
![Page 227: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/227.jpg)
Chapter 8: Modelling the impact of policies on air quality
209
pollution. Some used time-series analysis to build the relationship, others used cohort
analysis to develop either a pollutant model or combined pollutants effect model.
Whatever format is used in the studies the bottom-line is that the increase in pollution
will increase the mortality rate in any urban area.
The present study has adopted the approach of estimating relative risk (RR) of mortality
due to 1 ppm increase in CO and 1 ppb increase in NOx. The study averages the relative
risks of mortality from eight estimates for 1 ppb increase in NOx and two estimates for
1ppm increase in CO (Table 8.6)
Table 8.6: Relative Risks of death from individual studies
Study Relative Risk (RR) due to 1ppb increase
in NOx
Relative Risk (RR) due to 1ppm
increase in CO
Melbourne Mortality Study 2000 1.00100 1.03790
Scoggins et al. 2004 (Auckland) 1.00290
Simpson et al. 2005 (Australia) 1.00120
Hoek et al. 2002 (The Netherlands) 1.01700
Bremner et al. 1999 (London) 1.00300 1.01125
Gouveia and Fletcher 2000 (Sao Paulo) 1.00013
Chen et al. 2004 (China) 1.00290
Ballester et al. 2001 (Valencia, Spain) 1.00125
Average Relative Risk 1.00367 1.02460
Table 8.6 shows the relative risks from different studies and the averages of them. The
average RR of 1.00367 for NOx means that for 1 part per billion (ppb) increase in NOx
the probability of death is 0.37% higher and the RR of 1.0246 for CO means that for 1
part per million (ppm) increase in CO the probability of death is 2.46% higher. These
are global mortality averages. In addition, separate rates for respiratory and
cardiovascular diseases have been applied, using average RRs of death due to 1 ppb
increase in NOx and 1 ppm increase in CO. The average RRs for respiratory death are
1.004 and 1.0566 for NOx and CO respectively. The RRs for cardiovascular death are
1.00311 and 1.02568 for NOx and CO respectively. Details are shown in Table 8.7.
![Page 228: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/228.jpg)
Chapter 8: Modelling the impact of policies on air quality
210
Table 8.7: Relative Risks for respiratory and cardiovascular deaths from individual studies
Respiratory disease Cardiovascular disease Death from Due to 1 ppb
increase in NOx Due to 1 ppm increase in CO
Due to 1 ppb increase in NOx
Due to 1 ppm increase in CO
Relative Risk (RR) from different studies
1.0031a, 1.0025b, 1.0064c
1.0882a, 1.025c 1.00138a, 1.00154b, 1.0064c
1.03385a, 1.0175c
Average RR 1.004 1.0566 1.00311 10.2568 a Melbourne Mortality Study 2000 b Wong et al. 2002 (Hong Kong) c Bremner et al. 1999 (London) These figures are used to estimate the health impact of the suggested policy measures
for Perth city, as discussed at the beginning of this chapter.
8.5.2 Health impact of policy implementation
This study is limited to life saved by reducing pollution in the limited area of central
Perth. Only about 10,469 (ABS June 2004) residents live in Perth city whereas the
daytime population is about 98,353 (ABS 2001). These people come to the city from
the suburbs and are usually exposed to the polluted air when they arrive in the city or
walk around for shopping or other purposes. The study estimates the number of lives
that could have been saved annually under the eight hypothetical policies. The specific
cases of respiratory and cardiovascular diseases are also considered.
The total number of deaths in Western Australia in 2004 was 10,402 excluding
accidents, poisonings, and violence; among them 893 were due to respiratory disease
and 3,682 were due to cardiovascular disease. Other causes of deaths include malignant
neoplasms, diabetes mellitus, mental and behavioural disorder, diseases of the digestive
system, congenital malformations, etc. It is known that 72% of the total Western
Australian population live in the metropolitan area and 5.3% form the daytime
population in Perth city. If the number of deaths in Perth city is assumed to be
proportional to the population then number of deaths occurring in Perth city is scaled
down to 562 for all deaths, 48 for respiratory deaths, and 199 for cardiovascular deaths.
There would be a small reduction in these deaths if the suggested policies were
implemented. Figure 8.5 shows a comparative picture of lives that could have been
![Page 229: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/229.jpg)
Chapter 8: Modelling the impact of policies on air quality
211
saved under alternative policies in the year 2004, considering only non-accidental
deaths.
0.00
0.40
0.80
1.20
1.60
Fixed charge(($1/entry)
Car size charge($1/large car/entry)
Entry time charge($1/entry at morning
peak)
Parking charge ($1increase per hour)
num
ber
all death savedrespiratory death savedcardiovascular death saved
The parking charge policy could have saved more than 1.2 lives in 2004. The
suggested policies could not only save lives but also save people from pollution induced
disability. Amoako et al. (2003) report that another study (Mathers et al. 1999)
estimated approximately 9% of total life expectancy at birth for both males and females
is lost due to disability in Australia. The study also indicated that 1.2% of life
expectancy is lost due to respiratory illness and 8.9% is lost due to cardiovascular
illness.
According to the BTRE (2003b) the value of a statistical life (VOSL) in Australia is
A$1.9 million in year 2000 values. Therefore the annual benefit from lives saved can
be expressed in monetary terms as in Table 8.8.
Table 8.8: Annual value of statistical life saved from different policies or charges (in ‘000 A$)
Fixed charge
($/entry)
Car size charge ($/large car/entry)
Entry time charge ($ at
morning peak)
Parking fee
($/hr)
All deaths 2,177 2,178 1,558 2,373
Respiratory deaths 405 405 290 441
Cardiovascular deaths 788 789 564 859
Figure 8.5: Lives saved under different policy measures in 2004
![Page 230: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/230.jpg)
Chapter 8: Modelling the impact of policies on air quality
212
The fixed charge and car size charge produced the same benefit as expected. The
values of statistical life saved from various policies provide the monetary value of each
policy measure; however benefits should also be assessed in relation to the costs
incurred.
8.6 BENEFIT-SACRIFICE RATIO
The study has estimated the health benefit for various potential policies in terms of
value of life, which is a part of total benefit that could be achieved by implementing the
policies. The suggested policies have the potential to reduce congestion in the city,
improve the traffic flow, and increase average speed along with reduced air pollution.
Although the congestion benefits would be substantial, this study has concentrated only
on the health benefits.
The annual health benefits from various policies have been presented in monetary terms
but to make them strictly comparable the charges (i.e. financial sacrifice) must be taken
into account. A benefit-sacrifice ratio is calculated on the basis of the financial sacrifice
that would be imposed on motorists by each policy. The sacrifice has been taken to
include the direct cost to the motorist who continues to take a car to the city and one
half of the direct cost for any who are priced out of their car (applying the ‘rule-of-half’
method). If a conventional benefit-cost ratio were applied, it would be extremely large
because the true social costs would be small. The charges are merely a transfer and not
a social cost.
The ‘rule-of-half’ takes account of the fact that some motorists are already on the verge
of giving up using a car to go to the city while, at the other extreme, there are those who
would only be induced to give up using the car by the full amount of the charge. It is a
reasonable approximation to assume that the intermediate cases can be interpolated
linearly so that the average cost perceived by those who give up using their cars is the
average of the two extremes or half of the full charge on that number of motorists. This
method was formalised by Neuburger (1971) and Blackshaw (1975) and is applied
widely in benefit-cost evaluation (e.g. Sugden and Williams 1978). The ‘rule’ applies in
this case to those who are priced out of their car.
The direct cost incurred by the motorists, in this case incremental cost (IC), would be
$1 per trip for fixed charge, car size charge or entry time charge and $1 per hour
increase in parking fee (from the average). Implementation and other associated
![Page 231: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/231.jpg)
Chapter 8: Modelling the impact of policies on air quality
213
resource costs would only be a small part of the amount paid and the rest would be a
transfer payment or a redistribution of funds from a socio-economic viewpoint.
It was reported in Chapter 6 that 54.1% of the respondents used a large car and 40.9%
entered the city during the morning peak. As the health benefits are expressed annually,
the costs are also calculated annually. The benefit-sacrifice ratio is calculated in the
following steps:
Step 1: Incremental cost per trip per day (IC), taking account of the differential
costs for large cars and morning peak arrivals
Step 2: Total incremental costs per day (TIC) = IC * number of continuing trips.
Step 3: Total annual costs (TAC) = TIC * 260 (assuming 260 weekdays in a
year).
Step 4: Total financial sacrifices (TFS) = TAC for continuing car trips + ½ of
TAC for discontinued car trips (applying the rule-of-half calculation of
perceived cost to those who give up taking a car to the city).
Step 5: Benefit-Sacrifice ratio = Value of lives saved (VLS) factored down to
260 from 365 days / Total financial sacrifice (TFS).
Table 8.9 shows the incremental costs and health benefits for four policy measures. The
first row shows the proportions of respondents who would continue to take their car to
the city and the second row shows the proportions who would give up (extracted from
the 4th column of Table 8.5). The third row shows the value of life saved in million
dollars (extracted from Table 8.8) and this is factored down to 260 weekdays in the
fourth row. The uniform $1 incremental charge in the fifth row is converted to cost per
trip in the sixth to take account of the 3.84 hours of average parking time. Then in the
seventh row the total incremental cost per day is calculated for those who are taking a
car to the city, using the number with large cars or arriving in the morning peak for the
related charges. The ‘rule-of-half’ calculation of perceived cost for those priced out of
their cars is presented in row eight. The sum of the motorists’ sacrifices is shown in
row nine and the benefit-sacrifice ratio in row ten.
![Page 232: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/232.jpg)
Chapter 8: Modelling the impact of policies on air quality
214
Table 8.9: Benefit-Sacrifice Ratio calculation for various policies
Fixed charge
($1/entry)
Car size charge ($1/large car/entry)
Entry time charge
($1/entry at morning peak)
Parking charge
($1 increase per hour)
(1) % of respondents continuing to take a car to the city (from Table 8.4) 85 85 92 83
(2) % of respondents priced out of their cars 15 15 08 17
BENEFITS
(3) Value of lives saved (VLS) (M$) (from Table 8.7) 2.177 2.178 1.558 2.373
(4) Value of lives saved (VLS) factored to 260 days (M$) 1.551 1.551 1.110 1.690
SACRIFICES
(5) Charge imposed ($) 1.00 1.00 1.00 1.00
(6) Incremental cost per trip per day ($) (from Table 8.4) 1.00 1.00 1.00 3.84a
(7) Total cost per day for those who continue taking a car to the city ($) 314 170b 139c 1,176
(8) Perceived cost per day for those priced out of their cars (rule-of-half) ($) 55 55 30 241
(9) Total sacrifice (M$) 0.089 0.051 0.040 0.337
(10) Benefit-Sacrifice Ratio 17.5 30.2 27.8 5.0a average hours of parking was 3.84 b proportion of large car use was 54.1% c proportion of travellers enter the city in the morning peak was 40.9%
The ratio for the parking charge policy is low compared to the other three policies
because of the high total incremental cost per day. The parking charge policy measure
of $1 increase per hour becomes $3.84 per day when applied to average parking time.
![Page 233: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/233.jpg)
Chapter 8: Modelling the impact of policies on air quality
215
0.0
5.0
10.0
15.0
20.0
25.0
30.0
35.0
Fixed charge(($1/entry)
Car size charge($1/large car/entry)
Entry time charge($1/entry at morning
peak)
Parking charge ($1increase per hour)
Ben
efit
Sac
rific
e R
atio
0.000
0.050
0.100
0.150
0.200
0.250
0.300
0.350
0.400
cost
(M$)
Benefit Sacrifice Ratio Financial sacrifice
A graphical comparison of the cost effectiveness of the suggested policies is shown in
Figure 8.6. Although it was found that the parking charge policy is the most effective
in reducing air pollution and saving lives, it would impose high costs on motorists so
that its cost effectiveness is low. It is shown in Figure 8.6 that the car size charge
would be the most cost effective of the suggested policies. Although it may not save
many lives, the cost associated with this policy is low compared with other policies.
The morning peak entry time charge is almost as cost effective and the charge could be
much greater than $1. In fact the choice scenarios from which the coefficients were
estimated sought the response to a $4 entry time charge.
8.7 CONCLUSION
The results of the discrete choice modelling have been applied to estimate the impacts
of the charges on car trips to the city. The reduced proportion of car use ensures
reduced air pollution in the city. The new level of pollution is estimated by applying the
pollution model developed in Chapter 3. Then the impacts on health from reduced air
pollution were estimated. A maximum of 1.25 deaths could have been saved in Perth
city in 2004 under the fairly severe parking charge policy of increasing the fee from
$1.30 to $2.30 per hour.
If cost effectiveness, where the cost is to motorists, is the criterion then the picture
would be different. Of the four different policy measures presented in this chapter to
estimate the impact on air quality in Perth city, the study results indicate that the car
Figure 8.6: Benefit-Sacrifice Ratios and financial sacrifices for different measures
![Page 234: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/234.jpg)
Chapter 8: Modelling the impact of policies on air quality
216
size charge would the most effective policy with the highest ratio of benefits to the
financial sacrifices imposed on motorists. The morning peak entry time charge would
be almost as effective.
![Page 235: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/235.jpg)
Chapter 8: Modelling the impact of policies on air quality
217
Appendix – 8A
Base Case Model (repeat from Appendix 5F) This model is used to simulate with TRIPCOST and PARKHOUR change. The simulated models specifications are shown in Appendices 8B and 8C. --> NLOGIT; lhs=CHOICE,CSET,MODE; CHOICES=carA,carB,bus,train; Tree=mode[Private(carA,carB),Public(bus,train)]; IVSET:(PRIVATE)=[1]; MODEL: U(carA)=A_carA+time*TRAVELTI+cost*TRIPCOST+park*PARKHOUR/ U(carB)=A_carB+time*TRAVELTI+cost*TRIPCOST+age*AGE+sex*SEX/ U(bus)=A_bus +time*TRAVELTI+cost*TRIPCOST/ U(train)= time*TRAVELTI+cost*TRIPCOST; crosstab; $ Normal exit from iterations. Exit status=0. +---------------------------------------------+ | FIML Nested Multinomial Logit Model | | Maximum Likelihood Estimates | | Model estimated: Dec 21, 2005 at 11:43:23AM.| | Dependent variable CHOICE | | Weighting variable None | | Number of observations 1211 | | Iterations completed 19 | | Log likelihood function -339.8810 | | Number of parameters 9 | | Info. Criterion: AIC = .57619 | | Finite Sample: AIC = .57631 | | Info. Criterion: BIC = .61408 | | Info. Criterion:HQIC = .59046 | | Restricted log likelihood -519.8604 | | Chi squared 359.9587 | | Degrees of freedom 9 | | Prob[ChiSqd > value] = .0000000 | | R2=1-LogL/LogL* Log-L fncn R-sqrd RsqAdj | | No coefficients -519.8604 .34621 .33909 | | Constants only. Must be computed directly. | | Use NLOGIT ;...; RHS=ONE $ | | At start values -429.9295 .20945 .20085 | | Response data are given as ind. choice. | +---------------------------------------------+ +---------------------------------------------+ | Notes No coefficients=> P(i,j)=1/J(i). | | Constants only => P(i,j) uses ASCs | | only. N(j)/N if fixed choice set. | | N(j) = total sample frequency for j | | N = total sample frequency. | | These 2 models are simple MNL models. | | R-sqrd = 1 - LogL(model)/logL(other) | | RsqAdj=1-[nJ/(nJ-nparm)]*(1-R-sqrd) | | nJ = sum over i, choice set sizes | +---------------------------------------------+ +---------------------------------------------+ | FIML Nested Multinomial Logit Model | | The model has 2 levels. | | Nested Logit form:IV parms = tauj|i,l,si|l | | and fl. No normalizations imposed a priori. | | p(alt=k|b=j,l=i,t=l)=exp[bX_k|jil]/Sum | | p(b=j|l=i,t=l)=exp[aY_j|il+tauj|ilIVj|il)]/ | | Sum. p(l=i|t=l)=exp[cZ_i|l+si|lIVi|l)]/Sum | | p(t=l)=exp[exp[qW_l+flIVl]/Sum... | | Number of obs.= 375, skipped 0 bad obs. | +---------------------------------------------+
![Page 236: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/236.jpg)
Chapter 8: Modelling the impact of policies on air quality
218
+---------+--------------+----------------+--------+---------+ |Variable | Coefficient | Standard Error |b/St.Er.|P[|Z|>z] | +---------+--------------+----------------+--------+---------+ Attributes in the Utility Functions (beta) A_CARA .44488124 .51069273 .871 .3837 TIME -.01352926 .01018200 -1.329 .1839 COST -.39840195 .20936806 -1.903 .0571 PARK -.29537137 .31799156 -.929 .3530 A_CARB .35774450 .46919161 .762 .4458 AGE -.03078216 .00950570 -3.238 .0012 SEX -.80485260 .29403670 -2.737 .0062 A_BUS -1.49335336 .31308826 -4.770 .0000 IV parameters, tau(j|i,l),sigma(i|l),phi(l) PRIVATE 1.00000000 ......(Fixed Parameter)....... PUBLIC .78047141 .14405139 5.418 .0000
![Page 237: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/237.jpg)
Chapter 8: Modelling the impact of policies on air quality
219
Appendix – 8B Fuel Price Change Simulated Model --> NLOGIT; lhs=CHOICE,CSET,MODE; CHOICES=carA,carB,bus,train; Tree=mode[Private(carA,carB),Public(bus,train)]; IVSET:(PRIVATE)=[1]; MODEL: U(carA)=A_carA+time*TRAVELTI+cost*TRIPCOST+park*PARKHOUR/ U(carB)=A_carB+time*TRAVELTI+cost*TRIPCOST+age*AGE+sex*SEX/ U(bus)=A_bus +time*TRAVELTI+cost*TRIPCOST/ U(train)= time*TRAVELTI+cost*TRIPCOST; crosstab; simulation=carA,carB,bus,train; scenario: tripcost(carA)=[+]0.98/ parkhour(carA)=[+]0; $ +------------------------------------------------------+ |Simulations of Probability Model | |Model: FIML: Nested Multinomial Logit Model | |Simulated choice set may be a subset of the choices. | |Number of individuals is the probability times the | |number of observations in the simulated sample. | |Column totals may be affected by rounding error. | |The model used was simulated with 375 observations.| +------------------------------------------------------+ ---------------------------------------------------------------------- Specification of scenario 1 is: Attribute Alternatives affected Change type Value --------- --------------------------- ------------------- --------- TRIPCOST CARA Add value to base .980 PARKHOUR CARA Add value to base .000 ---------------------------------------------------------------------- The simulator located 375 observations for this scenario. Simulated Probabilities (shares) for this scenario: +----------+--------------+--------------+------------------+ |Choice | Base | Scenario | Scenario - Base | | |%Share Number |%Share Number |ChgShare ChgNumber| +----------+--------------+--------------+------------------+ |CARA | 54.472 204 | 46.970 176 | -7.502% -28 | |CARB | 22.224 83 | 26.039 98 | 3.815% 15 | |BUS | 9.827 37 | 11.507 43 | 1.680% 6 | |TRAIN | 13.476 51 | 15.483 58 | 2.007% 7 | |Total |100.000 375 |100.000 375 | .000% 0 | +----------+--------------+--------------+------------------+
![Page 238: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/238.jpg)
Chapter 8: Modelling the impact of policies on air quality
220
Appendix – 8C Parking Charge Simulated Model --> NLOGIT; lhs=CHOICE,CSET,MODE; CHOICES=carA,carB,bus,train; Tree=mode[Private(carA,carB),Public(bus,train)]; IVSET:(PRIVATE)=[1]; MODEL: U(carA)=A_carA+time*TRAVELTI+cost*TRIPCOST+park*PARKHOUR/ U(carB)=A_carB+time*TRAVELTI+cost*TRIPCOST+age*AGE+sex*SEX/ U(bus)=A_bus +time*TRAVELTI+cost*TRIPCOST/ U(train)= time*TRAVELTI+cost*TRIPCOST; crosstab; simulation=carA,carB,bus,train; scenario: tripcost(carA)=[+]0.2/ parkhour(carA)=[+]1.00; $ +------------------------------------------------------+ |Simulations of Probability Model | |Model: FIML: Nested Multinomial Logit Model | |Simulated choice set may be a subset of the choices. | |Number of individuals is the probability times the | |number of observations in the simulated sample. | |Column totals may be affected by rounding error. | |The model used was simulated with 375 observations.| +------------------------------------------------------+ --------------------------------------------------------------------- Specification of scenario 1 is: Attribute Alternatives affected Change type Value --------- --------------------------- ------------------- --------- TRIPCOST CARA Add value to base .200 PARKHOUR CARA Add value to base 1.000 --------------------------------------------------------------------- The simulator located 375 observations for this scenario. Simulated Probabilities (shares) for this scenario: +----------+--------------+--------------+------------------+ |Choice | Base | Scenario | Scenario - Base | | |%Share Number |%Share Number |ChgShare ChgNumber| +----------+--------------+--------------+------------------+ |CARA | 54.472 204 | 47.272 177 | -7.200% -27 | |CARB | 22.224 83 | 25.884 97 | 3.660% 14 | |BUS | 9.827 37 | 11.437 43 | 1.610% 6 | |TRAIN | 13.476 51 | 15.407 58 | 1.930% 7 | |Total |100.000 375 |100.000 375 | .000% 0 | +----------+--------------+--------------+------------------+
![Page 239: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/239.jpg)
Chapter 9: Conclusions
221
CHAPTER NINE
Conclusions
After a brief review, the study concludes by summarising the assessment and impacts of
policy measures to ameliorate environmental pollution by cars in Perth city. Section 9.1
reports key findings and 9.2 presents implications of the study.
It was noted at the beginning of this thesis that for a government to undertake
unpalatable measures in order to combat air pollution it needs to be reasonably assured
that a specific impost on motorists will produce a fairly certain result. This study set out
to establish that such certainty can be achieved by accurately measuring the CO and
NOx contribution per vehicle and then determining one or more appropriate charges
based on estimates of behavioural responses.
The four major questions that have been addressed are:
• What is the nature of the variation in air pollution in Perth and what are the
causal factors that influence this variation?
• How would urban people respond to policies specifically designed to
reduce air pollution?
• Which policies would be most effective in reducing air pollution in the
urban area?
• What would be the health benefits of the reduced pollution?
Perth might be thought the last city in Australia to be concerned about air pollution
because it has a year round sea breeze which blows away the pollutants emitted from
urban sources. However the proportion of commuters to Perth city who use cars is
higher than in any other large city in Australia and the exhaust gases tend to be trapped
by the city buildings in the downtown area. Also there are some adverse wind effects.
Wind direction in Perth has a great influence on the concentration of gases. The major
gaseous pollutant in the downtown area is CO which is emitted by motor vehicles and is
observed at relatively high concentration in Perth city. The pollutants categorised as
NOx originate from motor vehicle and industry exhausts. The geographical location of
![Page 240: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/240.jpg)
Chapter 9: Conclusions
222
Perth city and the unique wind pattern cause most of the northern suburbs, starting from
Perth city, to be polluted. The afternoon sea breeze brings back to the city and northern
suburbs the polluted morning air which has been blown out to sea, as well as major
industry exhausts from the southern suburbs.
9.1 RESEARCH FINDINGS
An important general finding is that pollutants accumulate in the city throughout the day
so that maximum concentrations are in the afternoon. The sources of this accumulation
are emissions from morning peak and off-peak motor vehicles and the polluted air
blown back from the sea. Although Perth city does not have as many high-rise
buildings as other major cities in Australia, it still experiences street canyon effects. All
these characteristics together mean that Perth city is exposed to substantial air pollution
and the situation will deteriorate with increased motor vehicle use.
The first step in this study was to estimate physical models of air pollution and then to
link these to travel behaviour. The essence of the policies is to penalise the car
travellers who create most of the pollution in the city in order to improve air quality.
The initial application of the physical modelling results was to measure the impact of
suggested policies by using previously estimated elasticities with the new pollution
coefficients. Each of the four suggested policies was estimated to reduce pollution
levels in Perth city, as shown in Figure 9.1.
![Page 241: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/241.jpg)
Chapter 9: Conclusions
223
Annual Reductions
012345678
Fixed Charge VariableCharges
ParkingMeasures
LaneRestriction
(tonn
es)
NOx CO
a fixed charge represents $1 per entry into the city, b from Table 4.11, variable charges represent a composite of $0.45/km in the morning
peak, $0.40/km between peaks, and $0.35/km for the rest of the day. c parking measures represent parking fee of $4.0/hour in the morning peak and
$3.0/hour during off-peak. d lane restriction represents the left lane of any 4-laned road in the city would be closed
to cars.
Among these four policies the lane restriction measure would have the greatest impact
on air quality improvement. This part of the study was based partly on secondary
information about responses, in elasticity form, which may or may not reflect the actual
behaviour of Perth travellers. Therefore discrete choice methods were used to
investigate actual transport mode selection by people who travel to Perth city. The
pollution models are summarised briefly and then the discrete choice models.
9.1.1 The pollution models
The physical relationships between climate, vehicles and pollution have been
mathematically modelled for CO and NOx levels in Perth city. Table 9.1 shows that in
both cases the wind variables together contribute more to the explanation than the
traffic, as does the cross product of previous wind speed and pollutant level. However
the traffic contribution is substantial and the estimated traffic coefficients are highly
reliable (t-ratios of 29.5 and 26.8). Thus wind dominates the outcome but traffic makes
a large contribution and the impact of each vehicle on CO and NOx has been accurately
estimated.
Figure 9.1: Initial estimates of annual reduction of air pollution in Perth city under four suggested policies (from Chapter 4)
ab c d
![Page 242: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/242.jpg)
Chapter 9: Conclusions
224
Table 9.1: Relative contributions of variables explaining CO and NOx levels
Standardised Beta Coefficient
CO NOx
Wind speed -0.109 -0.034
Previous period’s wind speed 0.406 0.199
Previous period’s north-east wind speed -0.200 -0.135
Previous period’s south-east wind speed -0.317 -0.206
Previous period’s south-west wind speed 0.059 0.104
Cross product of previous period’s wind speed and pollutant level -0.979 -0.853
Traffic 0.508 0.490
As shown by the signs of the standardised coefficients in Table 9.1, the study found that
the south-west wind has a positive impact and south-east and north-east winds have
negative impacts on levels of CO and NOx in Perth city. Because of the geographical
position of the William Street canyon, where the pollution monitoring receptor is
located, the south-east wind has a greater negative impact on air pollution than the
north-east wind.
9.1.2 The behavioural models
The main results of the revealed preference (RP) and stated preference (SP) model
estimations are shown in Table 9.2. The RP and SP coefficients are not directly
comparable because the RP dealt with choice of travel mode whereas the SP was limited
to ‘would you take the car’. The orthogonal experimental design in the SP case
virtually guarantees reliable estimates – as reflected by the t-ratios in brackets –
whereas the RP estimates suffer the vagaries of actual choices. Also the RP model is
based on the PARTS (Perth and Regional Travel Survey) data and it was necessary to
impute the set of choices faced by each person.
The SP survey was specifically designed to assess whether there are different degrees of
reaction to the four alternative types of charge: per entry, on a large car, on entry in the
morning peak, or an increased parking charge. The results indicate that responsiveness
does vary by type of charge (Table 9.2).
![Page 243: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/243.jpg)
Chapter 9: Conclusions
225
Table 9.2: Coefficients of the RP model for trips by all modes and the binary SP models for car only: trips to Perth city (t-ratios in brackets)
RP: Trips to Perth City by Car or Bus or Train
SP: Car to Work in Perth City
SP: Car to Perth City for Non-work
Travel time -0.0135 (1.3) Trip cost -0.398 (1.9) Fuel price -0.486 (3.5) -0.747 (8.4) Fixed entry charge -0.283 (4.2) -0.420 (9.7) Charge on large car -0.415 (3.6) -0.379 (5.1) Peak entry charge -0.168 (5.8) -0.214 (11.5) Parking fee -0.295 (0.9) -0.392 (13.9) -0.464 (23.2) Less parking space -0.196 (1.7) -0.325 (4.5) Lane restriction -0.128 (1.1) -0.231 (3.2) Cars per licence 0.970 (4.9) 0.625 (5.1) Uses large car 0.816 (7.0) 0.205 (2.8) Age -0.031 (3.2) Male person -0.804 (2.7) Car drivera 0.444 (0.9) Car passengera 0.357 (0.8) Bus passengera -1.493 (4.8) a Alternative specific constants are with respect to train, which is the reference mode
The coefficients and other findings from the RP mode choice modelling show that:
i) Private and public transport mode users behave differently.
ii) Other than trip cost and travel time attributes, hourly parking fee was one of
the most influential variables on the car as a driver mode, while age and
gender influence the behaviour of car as a passenger travellers.
iii) Mode switching was most sensitive with respect to bus fare and was least
sensitive to car trip cost, as shown by the cross-elasticities.
iv) Value of travel time savings (VTTS) was $2.04 her hour for all travellers.
The stated preference (SP) survey data showed that about 70% of the respondents went
to the city for purposes other than work and more than half went infrequently. About
45% of all respondents arrived in the city before 10am. Ninety percent were willing to
use public transport if taking a car became inconvenient.
![Page 244: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/244.jpg)
Chapter 9: Conclusions
226
The estimated model coefficients, marginal effects, and odds ratios all established that
the non-work group would be more responsive to the potential charges than the work
group. The majority of the non-work group come to the city for the purpose of personal
business and recreation followed by shopping.
As discussed in Chapter 8, the study plan was to integrate the SP coefficients into the
RP model in order to exploit the strengths of both. This plan was carried through but
the very low reliability of the crucial RP parameter for parking (Table 9.2) led to the
choice of the SP coefficients alone as the basis of the calculations of benefit from the
alternative air quality improvement measures.
9.2 IMPLICATIONS AND INFERENCES
The final step in this study was to measure the impact of the suggested car restriction
policies in saving lives. Although these policies would also reduce congestion, the
benefit assessment is limited to life saved by reducing pollution in Perth city. There are
less than 11,000 residents but the daytime population of the city is about 100,000.
People coming in from the suburbs are exposed to the polluted air when they walk
around for shopping or other purposes.
9.2.1 Financial assessment
In assessing the merit of alternative measures the benefits have been related to the
charges that would be imposed on motorists who currently drive a car to the city. In
economic terms, these are almost entirely transfer payments and only a very small
proportion would be to recover the resource costs of administration and maintenance.
The charges would be a sacrifice made by motorists for the social good so that it is
appropriate to formulate a ratio of benefits to the motorists’ sacrifice. The benefits are
calculated on the basis of the value of saving a life, taken to be $1.9 million (in dollars
of year 2000). The relative risk of mortality for specific increases in CO and NOx levels
has been averaged over a number of recent studies.
The benefit-sacrifice ratios for the four policy measures are shown in Figure 9.2. A car
size charge of $1 for large car per entry would confer the greatest benefits in relation to
the magnitude of the actual and perceived costs but a $1 charge imposed on all cars
entering the city in the morning peak would be nearly as effective. Only the parking
charge increase in $1 per hour would be appreciably less cost effective.
![Page 245: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/245.jpg)
Chapter 9: Conclusions
227
0.0
5.0
10.0
15.0
20.0
25.0
30.0
35.0
Fixed charge(($1/entry)
Car size charge($1/largecar/entry)
Entry timecharge ($1/entry
at morningpeak)
Parking charge($1 increase per
hour)
bene
fit-s
acrif
ice
ratio
The physical limitation measures, reduced parking space or closing the kerbside lane to
cars would also be effective but these measures have not been costed. The odds ratios
of Chapter 7 (Table 7.2) indicate that they would be somewhat less effective than a
fixed charge of $1 and the marginal effects calculations (Table 7.13) indicate
comparable responsiveness by motorists to the entry time charge. As with most of the
other charges, the non-work group would be considerably more responsive. Both the
odds ratios and the marginal effects show that the non-work group would react more
strongly than the work group to either of these physical measures.
9.2.2 Other implications and inferences
All of the results have shown that the policies would have a greater effect on people
whose trips to the city are for purposes other than work. A relatively large proportion of
them would be diverted or deterred from making a trip to the city. To a large extent this
means that shoppers and others would shift their activities elsewhere.
There is a contrast between the suggested measures and Ramsey pricing which
discriminates against people with the least elastic demand; pricing to reduce pollution
would primarily target those with more elastic demand, the non-work predominantly
off-peak motorists. Any of the suggested charges would also reduce congestion in the
peaks but the response by the work group who are the main peak travellers would be
much less than the response of the non-work off-peak travellers. However the latter
Figure 9.2: Benefit-sacrifice ratios for four potential policy measures
![Page 246: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/246.jpg)
Chapter 9: Conclusions
228
group contribute to pollution throughout the day and their response would provide much
of the justification for imposing a charge.
In this study, the value of money has been viewed from a different viewpoint than has
been taken by many transport studies of the value of life. Generally transport studies
have considered a ‘selfish’ value of life by quantifying the willingness to pay to reduce
the probability of one’s own death. However this study deals with the value of lives
trapped in the equivalent of a passive smoking situation. Many countries are trying to
eliminate passive smoking by banning smoking in public places. This study is taking
the same line by suggesting effective measures to control air pollution from transport in
order to benefit the unfortunates who breathe the air.
![Page 247: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/247.jpg)
References
229
REFERENCES
Abdel-Aty, M. A. 2001, “Using ordered probit modelling to study the effect of ATIS of transit ridership”, Transportation Research Part C, Vol. 9, pp. 265-277.
Abramson, C., Buchmueller T. and Currim I. 1998, “Models of health plan choice”, European Journal of Operational Research, Vol. 111, pp. 228-247.
ABS 2004, Motor Vehicle Census, March 2004, Australian Bureau of Statistics, 9309.3, Canberra.
Adamovicz, W., Swait J., Boxall P., Louviere J. and Williams M. 1997, “Perceptions versus objective measures of environmental quality in combined revealed and stated preference models of environmental valuation”, Journal of Environmental Economics and Management, Vol. 32, pp. 65-84.
AGO 2005, “Australian methodology for the estimation of greenhouse gas emission and sink 2003”, Australian Greenhouse Office, Canberra.
Akcelik, R. and Besley M. 2003, “Operating cost, fuel consumption, and emission models in aaSIDRA and aaMOTION”, 25th Conference of Australian Institutes of Transport Research (CAITR 2003), Adelaide.
Alwin, D. F. (ed.) 1978, Survey design and analysis: Current issues, Sage Publication, London.
Amoako, J., Ockwell A. and Lodh M. 2003, “The economic consequences of the health effects of transport emissions in Australian capital cities”, 26th Australian Transport Research Forum, New Zealand.
Arentze, T. Hofman F. and Timmermans H. 2004, “Predicting multi-faceted activity-travel adjustment strategies in response to possible congestion pricing scenarios using an Internet-based stated adaptation experiment”, Transport Policy, Vol. 11, pp. 31-41.
Australian Government 2003, Fuel Consumption Guide, ISBN 0 642549 354.
Ayidiya, S. A. and McClendon M. J. 1990, “Response effects in mail surveys”, Public Opinion Quarterly, Vol. 54, pp. 229-247.
Ballester, F., Tenias J. M. and Perez-Hoyos S. 2001, “Air pollution and emergency hospital admissions for cardiovascular diseases in Valencia, Spain”, Journal of Epidemiol Community Health, Vol. 55, pp. 57-65.
Bartholomew, D. J. 1987, Latent variable models and factor analysis, Oxford University Press, New York, USA.
Ben-Akiva, M. and Morikawa T. 1990, “Estimation of switching models from revealed preferences and stated intentions”, Transportation Research Part –A, Vol. 24A, No. 6, pp. 485-495.
![Page 248: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/248.jpg)
References
230
Ben-Akiva, M. and Morikawa T. 2002, “Comparing ridership attraction of rail and bus”, Transport Policy, Vol. 9, pp. 107-116.
Ben-Akiva, M. and Lerman S. R. 1985, Discrete Choice Analysis: theory and application to travel demand, The MIT Press, London, UK.
Ben-Akiva, M. Morikawa T., and Shiroishi F. 1991, “Analysis of the reliability of preference ranking data”, Journal of Business Research, Vol. 23, pp. 253-268.
Berkowicz, R., Hertel O., Larsen S., Sorensen N. and Nielsen M. 1997, “Modelling traffic pollution in streets”, National Environmental Research Institute, Denmark.
Berkowicz, R. 1998, “Street scale models” in Urban air pollution – European aspect, eds. Fenger J., Hertel O. and Palmgren F., Kluwer Academic Publishers, Netherlands, pp. 223-251.
Berkowicz, R. 2000, “OSPM – A parameterised street pollution model”, Environmental Monitoring and Assessment, Vol. 65, pp. 323-331.
Blackshaw, P. W. 1975, “The treatment of cross-modal effects in transport evaluations”, Transport Economics and Operational Analysis, Vol. 1, pp. 34-44.
Boubel, R., Fox D., Turner D. and Stern A. 1994, Fundamentals of air pollution, 3rd edition, Academic Press, USA.
Boxall, P. C., Englin J. and Adamowicz W. L. 2003, “Valuing aboriginal artifacts: a combined revealed-stated preference approach”, Journal of Environmental Economics and Management, Vol. 45, pp. 213-230.
Bray, D. and Tisato P. 1997, “Broadening the debate on road pricing”, 21st Australian Transport Research Forum, Adelaide.
Bremner, S., Anderson H., Atkinson R., McMichael A., Strachan D., Bland J. and Bower J. 1999, “Short term associations between outdoor air pollution and mortality in London 1992-4”, Occupational and Environmental Medicine, Vol. 56, No. 4, pp. 237-244.
Brockwell, P. and Davis R. 1996, An introduction to time series and forecasting, Springer-Verlag, New York.
BTCE 1996a, Transport and Greenhouse: Costs and Options for Reducing Emissions, Bureau of Transport and Communications Economics, Report 94, Canberra.
BTCE 1996b, Traffic congestion and road user charges in Australian capital cities, Bureau of Transport and Communications Economics, Report No. 92, Canberra.
BTE 1993, Industry Commission survey of car travel elasticities, Urban Transport, Draft Report, Vol. 2, AGPS, Canberra.
BTRE 2003a, “Urban pollutant emissions from motor vehicles: Australian trends to 2020”, Report for Environment Australia, BTRE, Canberra.
BTRE 2003b, “Rail accidents costs is Australia”, Bureau of Transport and Regional Economics, Report 108, Canberra.
![Page 249: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/249.jpg)
References
231
Button, K. 1993, Transport Economics, second edition, Edward Elgar, UK.
Calthrop, E. 2002, “Evaluating on-street parking policy”, Working paper series, Center for Economic Studies, Katholieke Universiteit Leuven.
Caldas, M. A. F. and Black I. 1997, “Formulating a methodology for modelling revealed preference discrete choice data – the selectively replicated logit estimation”, Transportation Research part B, Vol. 31, No. 6, pp. 463-472.
Camagni, R., Capello R. and Nijkamp P. 1998, “Towards sustainable city policy: an economy-environment technology nexus”, Ecological Economics, Vol. 24, pp. 103-118.
Carnovale F., Tilly K., Stuart A., Carvalho C., Summers M. and Eriksen P. 1996, “Metropolitan air quality study air emissions inventory”, final report, prepared by EPA Victoria for Environment Protection Authority of New South Wales, Sydney.
Carson, R., Louvier J., Arabie P., Bunch D., Hensher D., Johnson R. Kuhfeld W., Steinberg D., Swait J., Timmermans H. and Wiley J. 1994, “Experimental analysis of choice”, Marketing Letters, Vol. 5, No. 4, pp. 351-368.
Chaaban, F. B., Nuwayhid, I. and Djoundourian, S. 2001, “A study of social and economic implications of mobile sources on air quality in Lebanon”, Transportation Research Part D, Vol. 6, pp. 347-355.
Chen, B., Hong C. and Kan H. 2004, “Exposures and health outcomes from outdoor air pollution in China”, Toxicology, Vol. 198, pp. 291-300.
Cherchi, E. and Ortuzar J. D. D. 2002, “Mixed RP/SP models incorporating interaction effects”, Transportation, Vol. 29, pp. 371-395.
Chipman, J. 1960, “The foundations of utility”, Econometrica, Vol. 28, pp.193–224.
City of Perth 2004, 2004-2005 Parking Fee Schedule, City of Perth, Western Australia.
Colls, J. 1997, Air pollution: an introduction, E & FN Spon Publisher, London.
Colvile, R. N., Hutchinson, E. J., Mindell, J. S., and Warren, R. F. 2001, “The transport sector as a source of air pollution”, Atmospheric Environment, Vol. 35, pp. 1537-1565.
Dabberdt, W., Ludwig F. and Johnson W. 1973, “Validation and applications of an urban diffusion model for vehicular pollutants”, Atmospheric Environment, Vol. 7, pp. 603-618.
De Borger, B. and Wouters S. 1998, “Transport externalities and optimal pricing and supply decisions in urban transportation: a simulation analysis for Belgium”, Regional Science and Urban Economics, Vol.28, No.2, pp.163-197.
Debreu, G. 1960, “Review of R.D. Luce individual choice behaviour”, American Economic Review, Vol. 50, pp. 186–188.
![Page 250: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/250.jpg)
References
232
Deng, X. 2006, “Economic costs of motor vehicle emissions in China: A case study”, Transportation Research Part D, (in press).
Dia, H., Panwai S., Boongrapue N., Ton T. and Smith N. 2005, “Implementation of power-based fuel consumption and environmental emission models in traffic simulation”, 27th Conference of Australian Institutes of Transport Research (CAITR 2005), Brisbane.
Dillman, D. A. 1978, Mail and telephone surveys: the total design method, A Wiley-Interscience Publication, Canada.
Dillman, D. A. 2000, Mail and Internet Surveys: The tailored design method, 2nd edn, John Wiley & Sons Publication, Canada.
Eerens, H., Sliggers C. and Hout K. 1993, “The CAR model: the Dutch method to determine city street air quality”, Atmospheric Environment, Vol. 27B, pp. 389-399.
EPA 2001, “MOBILE6 On-road motor vehicle emission model”, US Environmental Protection Agency.
EPA NSW 1995, “Metropolitan Air Quality Study – air emissions inventory”, Draft Report, Environment Protection Authority NSW.
EPA Victoria 1999, “Measurements of motor vehicle pollutants and fleet average emission factors in Melbourne”, Environment Protection Authority, Victoria.
EPA Victoria 2003, “Australian motor vehicle emission factors system – version 1.0 (AusVeh 1.0) Manual”, Environment Protection Authority, Victoria.
Finkelstein, M. M., Jerrett M., Deluca P., Finkelstein N., Verma D. K., Chapman K. and Sears M. R. 2003, “Relation between income, air pollution and mortality: a cohort study”, Journal of Canadian Medical Association, Vol. 169, pp. 397-402.
Finkelstein, M. M., Jerrett M. and Sears M. R. 2004, “Traffic air pollution and mortality rate advancement periods”, American Journal of Epidemiology, Vol. 160, pp. 173-177.
Flaherty, B. P. 2002, “Assessing reliability of categorical substance use measures with latent class analysis”, Drug and alcohol dependence, Vol. 68, pp. S7-S20.
Fulton, L. M., Noland R. B., Meszler D. J. and Thomas J. V. 2000, “A statistical analysis of induced travel effects in the U. S. mid-Atlantic region”, Journal of Transportation and Statistics, Vol. 3, No. 1, pp. 1-14.
Goodwin P.B. 1992, “A review of new demand elasticities with special reference to short and long run effects of price changes”, Journal of Transport Economics and Policy, vol.26, no.2, pp.155-186.
Gouveia, N. and Fletcher T. 2000, “Time series analysis of air pollution and mortality: effects by cause, age and socioeconomic status”, Journal of Epidemiology and Community Health, Vol. 54, pp. 750-755.
Greene, W. H. 2002, NLOGIT reference guide, Electronic Software, Inc. USA.
![Page 251: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/251.jpg)
References
233
Greene, W. H. 2005, “Reconsidering heterogeneity in panel data estimators of the stochastic frontier model”, Journal of Econometrics, Vol. 126, pp. 269-303.
Greene, W. H. and Hensher D.A. 2002, A latent class model for discrete choice analysis: contrasts with mixed logit, Working paper, Institute of Transport Studies, Sydney.
Gudmundsson, H. and Hojer M. 1996, “Sustainable development principles and their implications for transport”, Ecological Economics, Vol. 19, pp. 269-282.
Harvey, A. C. 1980, “On comparing regression models is levels and first differences”, International Economic Review, Vol. 21, No. 3, pp. 707-720.
Hensen, M. and Huang Y. 1997, “Road supply and traffic in California urban areas”, Transportation Research Part – A, Vol. 31, No. 3, pp. 205-218.
Hensher, D. and Bradley M. 1993, “Using stated response choice data to enrich revealed preference discrete choice models”, Marketing Letters, Vol. 4, No. 2, pp. 139-151.
Hensher, D., Louviere J. and Swait J. 1999, “Combining sources of preference data”, Journal of Econometrics, Vol. 89, pp. 197-221.
Hensher, D. and King J. 2001, “Parking demand and responsiveness to supply, pricing and location in the Sydney central business district”, Transportation Research Part – A, Vol. 35, pp. 177-196.
Hensher, D., Rose J. and Greene W. 2005, “Applied Choice Analysis – A primer”, Cambridge University Press, UK.
Hensher, D. and Young 1990, Fuel Demand Forecasts and Long-Term Price Elasticities of Demand, Bureau of Transport and Communications Economics, Canberra.
Hess, D. B. 2001, “The effect of free parking on commuter mode choice: evidence from travel diary data”, Working paper series, UCLA, School of Public Policy and Social Research, No. 34, April 2001.
Hess, S., Bierlaire M. and Polak J. W. 2005, “Estimation of value of travel-time savings using mixed logit models”, Transportation Research Part A, Vol. 39, pp. 221-236.
Hoek, G., Brunekreef B., Goldbohm S., Fischer P. and Brandt P. 2002, “Association between mortality and indicators of traffic-related air pollution in the Netherlands: a cohort study”, The Lancet, Vol. 360, pp. 1203-1209.
Holland, W. W. (ed.) 1972, “Air pollution and respiratory disease”, Technomic Publication, USA.
Horowitz, J. and Louviere J. 1993, “Testing predicted choice against observations in probabilistic discrete choice models”, Marketing Science, Vol. 12. No. 3, pp. 270-279.
![Page 252: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/252.jpg)
References
234
Hosmer, D. W. and Lemeshow S. 2000, Applied Logistic Regression, 2nd edn, John Wiley & Sons Inc., New York, USA.
Huang, J., Haab T. C. and Whitehead J. C. 1997, “Willingness to pay for quality improvements: should revealed and stated preference data be combined?”, Journal of Environmental Economics and Management, Vol. 34, pp. 240-255.
Hunter, L. Watson I. and Johnson G. 1991, “Modelling air flow regimes in urban canyon”, Energy and Buildings, Vol. 15-16, pp. 315-324.
Hunter, l., Johnson G. and Watson I. 1992, “An investigation of three-dimensional characteristics of flow regimes within the urban canyon”, Atmospheric Environment, Vol. 26B, No. 4, pp. 425-432.
ICF Consulting Group 1997, Opportunities to Improve Air Quality Though Transportation Pricing, Office of Mobile Sources, EPA.
Industry Commission 1993, Urban Transport, Draft Report, Vol. 2, AGPS, Canberra.
Johnson, W., Ludwig F., Dabberdt W. and Allen R. 1973, “An urban diffusion simulation model for carbon monoxide”, Journal of the Air Pollution Control Association, Vol. 23, pp. 490-498.
Johannesson, M. 1996, “The willingness to pay for health changes, the human-capital approach and the external costs”, Health Policy, Vol. 36, pp. 231-244.
Johansson, O. and Schipper L. 1997, “Measuring the long run fuel demand of cars”, Journal of Transport Economics and Policy, Vol. 31, No. 3, pp. 277-292.
Jones, P. and Lucas K. 2000, “Integrating transport into ‘joined-up’ policy appraisal”, Transport Policy, Vol. 7, pp. 185-193.
Joumard, R. and Serie E 1999, Modelling of cold start emissions for passenger cars, INRETS Report LTE 9931, France, December 1999.
Kallos, G. 1998, “Regional/Mesoscale models”, in Urban Air Pollution – European Aspects, eds. Fenger J., Hertel O. and Palmgren F., Kluwer Academic Publishers, Netherlands.
Kamakura, W., Wedel M. and Agrawal J. 1994, “Concomitant variable latent class models for conjoint analysis”, International Journal of Research in Marketing, Vol. 11, pp. 451-464.
Ketzel, M., Wahlin P., Berkowicz R. and Palmgren F. 2003, “Particle and trace gas emission factors under urban driving conditions in Copenhagen based on street and roof-level observation”, Atmospheric Environment, Vol. 37, pp. 2735-2749.
Kocur, G. and Louviere J. 1983, “The magnitude of individual level variations in demand coefficients: A Xenia, Ohio, Case Example”, Transportation Research, Vol. 17, pp. 363-374.
Koppelman, F. S. and Wen C. H. 1998, “Alternative nested logit models: structure, properties and estimation”, Transportation Research Part B, Vol. 32, No. 5, pp. 289-298.
![Page 253: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/253.jpg)
References
235
Kunzli, N., Kaiser R., Medina S. 2000, “Public-health impact of outdoor and traffic-related air pollution: a European assessment”, The Lancet, Vol. 356, pp. 795-801.
Lettice, J. 2004, “London’s charge zone: blueprint for road pricing ‘success’?”, The Register, 17th February.
Leung, D. Y. C. and Williams D. J. 2000, “Modelling of motor vehicle fuel consumption and emissions using a power-based model”, Environmental Monitoring and Assessment, Vol. 65, pp. 21-29.
Lide, D. (ed.) 2005, CRC Handbook of Chemistry and Physics, CRC Press, USA.
Louviere, J. J., Hensher D. A. and Swait J. D. 2000, Stated Choice Methods: Analysis and Application, Cambridge University Press, UK.
Luk, J. and Hepburn S. 1993, New Review of Australian Travel Demand Elasticities, ARRB Report ARR 249, Australian Road Research Board, Vermont South.
Luk, J. 1999, “Electronic road pricing in Singapore”, Road and Transport Research, Vol. 8, No. 4, pp. 28-30.
Makridakis, S., Wheelwright S. and Hyndman R. 1998, Forecasting: methods and applications, 3rd edition, John Wiley & Sons, Inc., USA.
Matas, A. and Raymond J. L. 2003, “Demand elasticity on tolled motorways”, Journal of Transportation and Statistics, Vol. 6, No. 2/3, pp. 91-108.
Mathers, C., Vos T. and Stevenson C. 1999, “The burden of disease and injury in Australia”, Australian Institute of Health and Welfare, Canberra.
Mayeres, I. 2000, “The efficiency effects of transport policies in the presence of externalities and distortionary taxes”, Journal of Transport Economics and Policy, Vol. 34, Part. 2, pp. 233-260.
McGaughey, G., Desai N., Allen D., Seila R., Lonneman W., Fraser M., Harley R., Pollack A., Ivy J. and Price J. 2004, “Analysis of motor vehicle emissions in a Houston tunnel during the Texas Air Quality Study 2000”, Atmospheric Environment, Vol. 38, pp. 3363-3372.
McNulty, S. 2000, “Singapore pays price of enjoying streets free from traffic gridlock”, Financial Times, 4 August, p. 04.
Melbourne Mortality Study 2000, “Effects of ambient air pollution on daily mortality in Melbourne 1991-1996”, Environment Protection Authority Victoria, Melbourne.
Mensink, C., Lefebre F., Janssen L. and Cornelis J. 2006, “A comparison of three street canyon models with measurement at an urban station in Antwerp, Belgium”, Environmental Modelling & Software, Vol. 21, pp. 514-519.
Monitoring Plan for Western Australia, 2001, “National Environment Protection Measure for Ambient Air Quality”, State Government of WA.
![Page 254: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/254.jpg)
References
236
Morgan, G., Corbett S., Wlodarczyk J. and Lewis P. 1998a, “Air pollution and daily mortality in Sydney, Australia, 1989 through 1993”, American Journal of Public Health, Vol. 88, No. 5, pp. 759-764.
Morgan, G., Corbett S., and Wlodarczyk J. 1998b, “Air pollution and hospital admission in Sydney, Australia, 1990 through 1994”, American Journal of Public Health, Vol. 88, No. 12, pp. 1761-1766.
Morikawa, T. 1994, “Correcting state dependence and serial correlation in the RP/SP combined estimation method”, Transportation, Vol. 21, pp. 153-165.
Moustaki, I. and Papageorgiou I. 2005, “Latent class models for mixed variables with applications in Archaeometry”, Computational Statistics and Data Analysis, Vol. 48, pp. 659-675.
Neuburger, H. 1971, “User benefit in the evaluation of transport and land use plans”, Journal of Transport Economics and Policy, Vol. 5, No. 1, pp. 52-75.
Newman, P. and Kenworthy J. 1996, “The land use-transport connection”, Land Use Policy, Vol. 13, pp. 1-22.
Newman, P. and Kenworthy J. 1999, Sustainability and Cities – Overcoming automobile dependence, Island Press, Washingto D.C., USA.
Nijkamp, P., Rodenburg C. and Wagtendonk A. 2002, “Success factors for sustainable urban brownfield development – A comparative case study approach to polluted sites”, Ecological Economics, Vol. 40, pp. 235-252.
Nijkamp, P. and Shefer D. 1998, Urban transport externalities and Pigouvian taxes: a network approach, in Button, K. J. and Verhoef, E. T. (Eds.) Road pricing, traffic congestion and the environment: issues of efficiency and social feasibility, Edward Elgar, UK, pp. 171-189.
Noland, R. B. 2001, “Relationships between highway capacity and induced vehicle travel”, Transportation Research Part – A, Vol. 35, pp. 47-72.
Noland, R. B. and Cowart W. A. 2000, “Analysis of metropolitan highway capacity and the growth in vehicle miles of travel”, Transportation, Vol. 27, pp. 363-390.
Oke, T. 1988, “Street design and urban canopy layer climate”, Energy and Building, Vol. 11, pp. 103-113.
Ortuzar, J. D. D., Cifuentes L. A. and Williams H. C. W. L. 2000, “Application of willingness-to-pay methods to value transport externalities in less developed countries”, Environment and Planning A, Vol. 32, pp. 2007-2018.
Ortuzar, J. D. D. and Iacobelli A. 1998, “Mixed modelling of interurban trips by coach and train”, Transportation Research Part A, Vol. 32, No. 5, pp. 345-357.
Oum, T. H., Waters W. G. II. and Yong J. S. 1990, “A survey of recent estimates of price elasticities of demand for transport”, Policy Planning and Research, Working paper, World Bank.
![Page 255: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/255.jpg)
References
237
Palmgren, F., Berkowicz R., Ziv A. and Hertel O. 1999, “Actual car fleet emissions estimated from urban air quality measurements and street pollution models”, The Science of the Total Environment, Vol. 235, pp. 101-109.
Papakyriazis, A. and Papakyriazis P. 1998, “Optimal environmental policy under imperfect information”, Kybernetes, Vol. 27, pp. 137-154.
Perth Air Quality Management Plan 2000, Department of Environment, Western Australia.
Perth Metropolitan Transport Strategy 1995-2029, Department of Transport, Western Australia.
Perth Photochemical Smog Study 1996, Western Power Corporation and Department of Environmental Protection, Perth.
Petroeschevsky, A., Simpson R. W., Thalib L. and Rutherford S. 2001, “Association between outdoor air pollution and hospital admission in Brisbane, Australia”, Archives of Environmental Health, Vol. 56, No. 1, pp. 37-52.
Pigou, A. 1920, The Economic Welfare, First edition Macmillan.
Pokharel, S., Bishop G. and Stedman D. 2002, “An on-road motor vehicle emissions inventory for Denver: an efficient alternative to modelling”, Atmospheric Environment, Vol. 36, pp. 5177-5184.
Powers, D. A. and Xie Y. 2000, Statistical methods for categorical data analysis, Academic Press, USA.
Richardson, H. W. and Bae C. H. C. 1998, “The equity impacts of road congestion pricing” in Road pricing, traffic congestion and the environment, eds K. J. Button and E. T. Verhoef, Edward Elagr Publishing Ltd., USA, pp. 247-262.
Robinson, N., Pierson W., Gertler A. and Sagebiel J. 1996, “Comparison of MOBILE4.1 and MOBILE5 predictions with measurements of vehicle emission factors in Fort McHenry and Tuscarora mountain tunnels”, Atmospheric Environment, Vol. 30, pp. 2257-2267.
Saelensminde, K. 1999, “Stated choice valuation of urban traffic air pollution and noise”, Transportation Research Part D, Vol. 4, pp. 13-27.
Sapkota, V. 1999, “Efficient congestion tolls in the presence of unpriced congestion: A case with non-identical road users”, 23rd Australian Transport Research Forum, Perth, Western Australia.
Schwarz, N. and Hippler H. 1995, “Subsequent questions may influence answers to preceding questions in mail surveys”, Public Opinion Quarterly, Vol. 59, pp. 93-97.
Scoggins, A., Kjellstrom T., Fisher G., Connor J. and Gimson N. 2004, “Spatial analysis of annual air pollution exposure and mortality”, Science of the Total Environment, Vol. 321, pp. 71-85.
![Page 256: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/256.jpg)
References
238
Shiftan, Y. and Suhrbier J. 2002, “The analysis of travel and emission impacts of travel demand management strategies using activity-based models”, Transportation, Vol. 29, pp. 145-168.
Siddique, S. 2004, “Estimating the relationship between traffic and air pollution”, Road and Transport Research, Vol. 13, No. 1, pp. 76-84.
Simpson, R., Williams G., Petroeschevsky A., Morgan G., Denison L., Hinwood A., Neville G. and Neller A. 2005, “The short-term effects of air pollution on daily mortality in four Australian cities”, Australian and New Zealand Journal of Public Health, Vol. 29, No. 3, pp. 205-212.
Simpson, R. W., Williams G., Petroeschevsky A., Morgan G. and Rutherford S. 1997, “Association between outdoor air pollution and daily mortality in Brisbane, Australia”, Archives of Environmental Health, Vol. 52, No. 6, pp. 442-454.
State Government of WA 1995, Perth Metropolitan Transport Strategy 1995-2029.
Stopher, P. R. 2004, “Reducing road congestion: a reality check”, Transport Policy, Vol. 11, pp. 117-131.
Sugden, R. and Williams A. 1978, The Principles of Practical Cost-Benefit Analysis, Oxford University Press, New York.
Swait, J. 1994, “A structural equation model of latent segmentation and product choice for cross-sectional revealed preference choice data”, Journal of Retailing and Consumer Services, Vol. 1, No. 2, pp. 77-89.
Swait, J., Louviere J. and Williams M. 1994, “A sequential approach to exploiting the combined strengths of SP and RP data: application to freight shipper choice”, Transportation, Vol. 21, No. 2, pp. 135-152.
Taplin, J. H. E. 1982, “Inferring Ordinary Elasticities from Choice Elasticities”, Journal of Transport Economics and Policy, Vol. 16, No. 1, pp. 55-63.
Taplin, J. H. E. 2004, “Demand for hybrid cars: elasticity approaches and a fuzzy logic contribution”, 26th Conference of Australian Institute of Transport Research, Melbourne.
Taplin, J. H. E., Hensher D. A. and Smith B. 1999, "Preserving the symmetry of estimated commuter travel elasticities", Transportation research Part B, Vol. 33, pp. 215-232.
Taylor, M. A. P. and Taplin J. H. E. 1998, “Travel demand, energy and pollution impacts of alternative congestion pricing regimes”, International Conference on Transport into the Next Millennium, Nanyang Technological University, Singapore, September, 1998.
The Committee of the Royal College 1970, Air Pollution and Health, The Royal College of Physicians of London, London.
The World Bank 2001, Environment Matters at the World Bank, The World Bank, Washington D.C., USA.
![Page 257: Development of Policies to Ameliorate the …...Development of Policies to Ameliorate the Environmental Impact of Cars in Perth City, Using the Results of a Stated Preference Survey](https://reader031.fdocuments.in/reader031/viewer/2022011823/5ed5ec4238044f6a1120c803/html5/thumbnails/257.jpg)
References
239
Train, K. E. 2003, Discrete Choice Methods with Simulation, Cambridge University Press, UK.
Tretvik, T. 2003, “Norway’s toll rings: Full scale implementations of urban pricing”, IMPRINT-EUROPE seminar, Budapest University of Technology and Economics, October 2003.
US Department of Transportations 2003, Transportation Statistics: Annual Report, Bureau of Transportation Statistics, October.
Vardoulakis, S., Fisher B., Gonzalez-Flesca N. and Pericleous K. 2002, “Model sensitivity and uncertainty analysis using roadside air quality measurements”, Atmospheric Environment, Vol. 36, pp. 2121-2134.
Vardoulakis, S., Fisher B., Pericleous K. and Gonzalez-Flesca N. 2003, “Modelling air quality in street canyons: a review”, Atmospheric Environment, Vol. 37, pp. 155-182.
Weatherley, N. and Timmis R. 2001, “The atmosphere in England and Wales: an environmental management review”, Atmospheric Environment, Vol. 35, pp. 5567-5580.
Wilson, R. W. 1992, “Estimating the travel and parking demand effects of employer-paid parking”, Regional Science and Urban Economics, Vol.22, No. 1, pp. 133-145.
Willson, R.W. and Shoup D.C. 1990, “Parking subsidies and travel choices: Assessing the evidence”, Transportation, vol.17, no.2, pp.141-157.
Wong, T., Tam W., Yu T. and Wong A. 2002, “Association between daily mortalities from respiratory and cardiovascular diseases and air pollution in Hong Kong, China”, Occupational and Environmental Medicine, Vol. 59, No. 1, pp. 30-35.
Yang, H., Meng Q. and Lee D. H. 2004, “Trail-an-error implementation of marginal cost pricing on networks in the absence of demand functions”, Transportation Research Part B, Vol. 38, pp. 477-493.