Carltonville 20150403
-
Upload
carletonvilleherald -
Category
Documents
-
view
345 -
download
0
description
Transcript of Carltonville 20150403
Weekliks meer as 23 400 lesers
3 April 2015
Prys: R4.70
Gateway Volkswagen36 Paul Kruger StreetCarletonvilleTel 018 788 6731www.gatewayvw.co.za
Contact us for the best deal on any VW
Father shoots twohouse robbers 3
77
Violent protestersViolent protesters block off road
13
Roadcarnage
continues
33 Gangstersdisruptmusicevent 55
Pitbulls’ownerfoundguilty 55
Financial problems at Merafong
2 Carletonville Herald 3 April 2015
Senior bestuurder:Thys FoordRedakteur:
Hennie StanderNuusredakteur:Adele Louw
HeraldHerald
No. 2037Gedruk deur Paarl Coldset(Edms) Bpk,
83 Heidelbergslaan, City Deep.
Sirkulasiesyfers word deur die SirkulasieOudit Buro (ABC) gewaarmerk.
Moenie enige ander syfers glo nie.Jan tot Mart 2013: 6 085
Verslaggewers:Cerise du PlooyVincent MofokengAdvertensie:Ronel PotgieterAdministrasie:
Liz Berry
Rekeningnavrae:Denise Oliphant
Tel. (018) 293-0750Faks: (018) 293-0759
E-pos: [email protected] 450, Carletonville, 2500
Tel: (018) 788-6693Fax: (018) 787-5655
OmbudsmanVolgens die redaksionele beleid van die Carletonville Herald verwelkom ons voorstelle en kommentaar oor die koerantse inhoud en stel ons beduidende foute so gou as moontlik reg. Stuur asb. kommentaar en inligting oor die regstellingvan foute aan die ombudsman van Media24 se Gemeenskapspers, George Claassen, by george.claassen@media24.
com, of bel hom by 021 851 3232 of 083 543 2471.Indien ons nie voldoen aan die vereistes van ons eie en die Suid-Afrikaanse Perskode nie, kan u ook die SA
Persombudsman kontak by 011 484 3612/8, faks 011 484 3619 of e-pos aan [email protected].
According to the editorial policy of the Carletonville Herald, we invite you to comment on mistakes in the newspaperand shall correct significant errors as soon as possible. Please send information on mistakes to the ombudsman ofMedia24’s Community Press, George Claassen, at [email protected], or call him at 021 851 3232 of 083
543 2471.If we do not fulfil the requirements of our own or the South African Press Code, you can also contact the SA Press
Ombudsman at 011 484 3612/8, faks 011 484 3619 or email to [email protected].
Delivery:
It has been agreed between the Advertiser and Media 24 that the Advertiser is solely responsible for the correctness off all details concerning its advertisement placed herein, including compliance with all relevant legislation. Therefore, Media24 does not accept any liability for any damage resulting from any advertisement placed herein.
Die adverteerder en Media24 het ooreengekom dat die adverteerder volle verantwoordelik aanvaar vir die nakoming van relevante wetgewing in die plasing van korrekte inligting ten opsigte van sy advertensie hierin geplaas. Derhalwe, aanvaarMedia 24 geen aanspreeklikheid vir enige skade opgeloop voortspruitend uit die plasing van enige advertensie hierin nie.
Service centre:Tel. 086 188 8989
E-pos: [email protected] hours: 08:00 - 16:30
Delivery services:Curvin Johnson (Area mananger)
071 606 [email protected]
The leaders in accredited SHEQ training. All our courses are Nationally / Internationallyaccredited. (Full Time / Distance Learning)Certificates & Diplomas: (Mining & Industrial)
• COMSOC® level 1, 2 & 3 courses • Safety (SHEQ) Officers level 1,2 & 3 courses• Risk Management • Legal responsibility (MHSA & OHSA) • ICAM Courses • OSHAS 18001
Environmental Management Course (ISO 14001, NEMA, MPRDA)
NEWNEBOSH International General Certificate-Full Time
National Certificate: Occupational Health, Safety & Environment-120 CreditsUPCOmING EvENTS
• Safety Officers 2 Full Time Course: 13th - 24th April 2015• NEBOSH IGC Full Time Course: 18th may - 3rd June 2015
Contact our client services department for enquiries / Course Schedule:018 786 4300 / 018 786 2812 (8h00 – 16h00)072 104 8731 / 072 768 5165 (8h00 – 16h00)
Or visit us at www.skillfull29.co.za / www.minesafetytraining.co.za
interhoër atletiekbyeenkoms was dieenigste drie atlete van die Carletonvil-le-omgewing wat in die Wes-Transvaalatletiekbyeenkoms ingesluit is. Diedrie atlete was Jacques Burger vanCalles, wat die huidige Suid-Afrikaan-se rekordhouer in die 1 500m seunso/15 is, Zirkia Ludick en haar suster,Marié, albei van Wonnies.
geen voldoende versorging vir diemishandelde kinders wat uit hulouerhuise verwyder word nie. Kin-derhuise en plekke van veiligheidwas oorvol en waglyste reeds baielank.
Die voormalige Wesrand Streeks-diensteraad het vroeër die jaar ont-bind en het na die ontbinding as dieWestelike Diensteraad (WDR) bekendgestaan. Die WDR het ook die vier lan-delike gebiede van Magaliesburg, Gats-rand, Krokodilrivier en Vaalrivier in-gesluit, saam met Carletonville, Westo-naria, Krugersdorp en Randfonteiningesluit. Fochville was van 1 Januariedieselfde jaar by die Wesvaal Streeks-diensteraad van Noordwes ingeskakel.
Die 1995 Victor en Victrix Ludorumen die junior Victrix Ludorum van die
Die Herald het weer oor verskeie nuus-gebeure in sy uitgawe van 20 jaar gele-de berig.
Inwoners van Carletonville en Foch-ville het die vorige week ‘n sug van ver-ligting geslaak toe reën die snikheteverlig het en hulle naarstigtelik nasambrele moes gryp. Die welkome re-en het lafenis gebring en sommige boe-re in die omgewing het moed geskep virredelike oeste.Verskeie boere in dieomgewing het egter aan die Herald gesêdie groeiperiode was verby, wat bete-ken dat die reën nie werklik ‘n verskilaan weiding of vroeë aanplanting soumaak nie.
The reconstruction and develop-ment of Khutsong should be done insuch a way that Carletonville does notdestroy itself in the process. This was
the message given to the business sec-tor by Mr Tokyo Sexwale, the premierof Gauteng, during a Sunday luncheonheld in the Carletonville Civic Centre.He said that it was imperative for Car-letonville to broaden the base of its eco-nomy and not to overlook even thesmallest trader or hawker, as they allformed a vital part in the process ofsuccessfully revitalizing and recon-structing a vibrant community.
Kinderverwaarlosing en mishande-ling in die gebied het die afgelope viermaande kwaai toegeneem. Die maat-skaplike kantoor van die Suid-Afri-kaanse Vrouefederasie het gesê dat dietendens geweldige probleme in diepraktyk tot gevolg het. ‘n Woordvoer-der van die organisasie, me. MarleneBornman, het gesê daar is dikwels
Goeie reën bring groot verligting
Kagiso Segone
A member of the SouthAfrican Police Service,Angela Isabel Adams,passed away on the 29March.
Isabel was the seniorprovision administrati-on clerk in the supplychain deparment. Shestarted her career withthe SAPS on 28 June,2002.
She was known as afriendly, open personwith a sense of humourand the ability to inter-act with all people on all levels. Collea-
gues say she played a big role in the ser-vice, and was easy to workwith. But she also firmlystood her ground when shebelieved in something.
Isabel treasured her fa-mily and spoke about themoften.
She will be rememberedby her colleagues, family aswell as friends and she willbe dearly missed by all whoknew her.
Her memorial service willtake place at the MethodistChurch in Carletonville on02 April and she will be bu-ried at Toekomsrus in
Randfontein on 4 April.
Policemember passes away
Angela Isabel Adams
Adele Louw
‘n Spesiale projek by die Kinderhof inOberholzer se landdroskantoor poogom die lot van kinders wat op een ofander rede deur dié hof beweeg, te ver-lig.
Volgens die klerk van die Kinderhofin Oberholzer, me. Alta Bezuidenhout,het sy vier jaar gelede ‘n projek beginom haar kantoor, wat reg langs die Kin-derhof is en waardeur alle kindersmoet gaan wat deur die hof beweeg,meer ‘kindervriendelik’ te maak.
“Dit is maar altyd getraumatiseerdekindertjies wat in hierdie hof kom, enenigiets help om dit vir hulle maklikerte maak,” het Bezuidenhout Maandagaan die Herald vertel. As deel van dieprojek is daar onder meer vrolike
blomme op haar kantoor se mure ge-verf, terwyl besoekers op kleurrykekussings kan sit. Sagte speelgoed isook oral te sien.
Nóg ‘n projek wat Bezuidenhout aan-gepak het, is om ware bymekaar temaak sodat elke kind wat deur die hofbeweeg, ‘n klein geskenkie kan kry.
“Daar beweeg so 30 tot 50 kinders el-ke maand deur die hof, waarvan diemeeste in pleegsorg geplaas word. Indie meeste gevalle is dit na hul ouersdood is en daar niemand meer is watna hulle kan omsien nie. Die mense watbereid is om kinders in pleegsorg teneem kan ongelukkig nie altyd in al dieekstras van skole voorsien nie. Ek pro-beer daarom om sover moontlik vir diekinders skoolbenodighede as gesken-kies te gee.
“Ek het pennesakkies, penne, uitve-ers, optelmasjientjies, inkleurpotlode,highlighters en allerhande skoolbeno-dighede as skenkings gekry. Lekkernyeof koeldrankies of eetgoed is ook altydwelkom. Indien iemand nie weet watom aan te skaf nie, is hulle ook welkomom ‘n kontant bydrae te maak waarnaek die goedere sal aankoop en dan ver-slag sal doen oor wat aangekoop is.“Ditis baie keer die enigste ‘eie’ besitting
wat hierdie kindertjies by my ontvang.Die vreugde op die kinders se gesigteis onbeskryflik,” vertel Bezuidenhout.Sy nooi ook mense wat meer oor dieprojek wil weet uit om by haar kantoorin te loer sodat sy hulle kan wys wat symet die skenkings doen.
Mense wat graag tot die projek wil by-dra, kan Bezuidenhout by (018)7882341/2/3/4 of 083 282 6021 ska-kel.
Projek help omgetraumatiseerde kinders se lot te verlig
Me. AltaBezuidenhout metvan diespeelgoedin haarkantoorwat kinders helpom van dietraumavan diehofproseste laat vergeet.
3 April 2015 Carletonville Herald 3
ne and the other was airlifted to Barag-wanath Hospital but died in transit.Nine other patients sustained light tomoderate injuries.
Meanwhile, five vehicles were laterinvolved in another accident. Therewere no fatalities, but one person wastransported to hospital. On Saturday
28 March therewas a serious ac-cident near Kloofmines, when adriver lost cont-rol and rolled hisvehicle.Two people
were trans-ported tohospital.
Two peo-ple were kil-led nearGlenharvie’sNo.4 Shaftwhen a vehi-cle landed upunder atruck.
Kagiso Segone
Two people were killed when a Toyo-ta Quantum minibus collided witha silver VW Jetta on the R501 ataround 18:00 on 27 March. The ac-cident happened near the river bed.
One of the victimsdied on the sce-
The second suspect, who was arrested in thehouse, was seriously wounded and is apparentlystill in hospital.
It was later discovered that they haddisconnec-ted the streetlights prior to the break-in. Threeother houses in the area were allegedly also rob-bed. The victims are severely traumatised andthe two children have been receiving professionalhelp.
The complainant’s weapon has been reposses-sed and checked to see if it was used for other cri-mes.
The victim described the robbers as “fearlessand dangerous”. He warns that robbers are al-most always armed and can enter the premises ina split second. He also says they use the elementof surprise toattackwhen the victimsaremost vul-nerable,when they are relaxedandwith their fami-lies.
He believes that people should own firearmsto protect themselves from criminals who rob, ra-pe or kill their victims.
Kagiso Segone
Intruders were shot during a house robbery inBaardStreet, Ext. 9 at around 20:40 on 24March.
The incident occurred shortly after familyfriends had left the party and the security gate hadbeen locked.
The mother of the birthday girl went to the kit-chen, where she noticed that the window blindswere moving slowly. Realising that someone wastrying to climb through the window, she screamedand ran towards the bedroom, grabbing the remo-te to alert security. One of the two suspects thatgained entry to the house chased after her with hisfirearm. Her husband had meanwhile taken outhis own firearm, pointed it in the direction of thethreat and warned the intruder to back off. Whenhe kept coming, the complainant shot him in thestomach and ran after his accomplice. He firedanother three shots, wounding both men in theirlegs. One fled through a windowwith a stolen lap-top but dropped his 9mm firearm at the scene.
DuvetCoverSets
Tel: 018 788 6697 • Fax: 018 787 2768 • Cnr Diamond & Emerald St.Carletonville • Email: [email protected] •Website: www.edura.co.za
Sale !!! Sale !!! Sale !!!Open SaturDay 4 april!!!
Visit www.edura.co.za for the 4 Page Sale Pamphlet
Double –r89.99 eaQueen –r99.99 ea
FittedSheetsS & ¾ -r39.99 eaDouble &Queen –r49.99 ea
2.3 x 2.18Readyto HangJacquardLace -r34.99
per Curtain
150cmPolar Fleecer14.99 pm
Get1 Roll Free
Scalloped Voilewith Every Roll ofJacquard Fabric
Purchased
Kagiso Segone
On Thursday morning, 26 March, Carletonvillepolice arrested a suspect for being in possessionof a hijacked vehicle. They were responding toa tip-off from amember of the public about sus-picious vehicles that had been parked at Carle-tonville Pick n Pay shopping centre for two days.Theoccupant of oneof the vehicles, a greenToyo-ta Tazzwith a Free State number plate, was stan-ding in front of the Pick n Pay entrance. He waswearing a blue denim and purple shirt. On arri-val atPicknPay, the twoconstables thathadbeenassigned to the case searched the suspect andfound the keys of a Toyota Hilux Bakkie in hispossession.When he failed to give any valid reason for be-
ing in possession of the keys, the police drove
around the parking with him, trying to identify the ve-hicle by testing the alarmand immobiliser.Eventuallythey saw the hazards of a vehicle go on and off, andit was discovered that the vehicle had been hijackedin Cleveland around Johannesburg. By parking itat the Pick n Pay parking lot, the hijackers were chec-king whether the vehicle had been fitted with a trac-king device. They were allegedly planning to escapeto Mozam-bique. Itwas laterconfirmedlater thatthe othervehiclehad notbeen sto-len.
Police recover hijacked vehicle
The parking lot where the hijacked vehicle was found
Father shoots robbers
Road carnage continues
Two peole died near Kloof no.4 shaftTwo people were injured in this accident near Glenharvie
This vehicle rolled on the R501.This accident happened near the Waters’ Edge on Khutsong Road
Baard Street in Carletonville Extension 9, where the incidenttook place.
4 Carletonville Herald 3 April 2015
jou mening/your opinion 45517 SMS’e kos R1,50SMSDie Herald behou die reg om sekere SMS’e nie te plaas nie.
Dis niks om ‘n man happy te hou. Ditlyk my dis al wat jy het om te doen. Dielewe draai nie net daarom. Waar is joubeginsels vir die huwelik?
Could the DA place themselves in theposition to address the farm/land re-distribution issue? There has been noofficial word from them on this and thetraditionals would like clarificationfrom them pertaining to it.
People must stop blaming the pastand rather look at what’s happening inSA at present and what the future isgoing to be like! Why worry about statu-es when people are jobless, sleepinghungry and without proper housing?
Ai, Carletonville sal bitter leeg weessonder julle! Baie dankie aan mensewat ‘n verskil in ander se lewens maakDT bande, Wimpie personeel, BubbleAnn, John Mather, personeel en Avbob,woorde ontbreek. Puik diens dankie.Msy.
Ag weet jy, jy moet groot word... onsFochies het niks met die “magtige”Monnas te doen... miskien moet jy byiemand gaan leer oor leerlinggetalle enom appels met appels te vergelyk. Ge-lukkige Fochie ouer.
As ‘n by jou steek, drink dadelik ‘nbietjie asyn, kan ook ‘n mengsel vanasyn en koeksoda opsit.
Moet nooit die geskenk aanvaar watlos skindertonge uitdeel nie, só bly diegeskenk swaar op hul tonge lê; moeniedat dit jou energie tap nie!
Ek wil weet of party mense in Fochvil-le weet wat die woord STOP beteken enhoekom dit daar is. As jy in iemand vas-ry omdat jy nie gestop het nie, is dit ‘nongeluk. Nee, dom en astrand. Hoe-kom doen die verkeersmense niksdaaraan nie, want hulle doen dit self.Word wakker, jy is nie alleen op die padnie, en die pad behoort nie aan jou nie.Sulke mense word padvarke genoem.
Ek wil net vir die volgende mensebaie dankie sê vir al hul hulp en by-stand tydens my operasies: Cathy enEben van Staden, Sannie en PieterBriel, my dogter Shani en seun Barry.Sonder julle sou ek nie so gou herstelhet nie. Baie dankie. Lorraine Bosse.
Mense pasop daar is ‘n groot skelmin Carletonville wat mense vreeslik in-doen. Maak kamstig jou goed reg endan is dit nooit weer dieselfde nie. Siesvir jou, jy gaan eendag moet rekenskapgee!
What a disgrace madam mayor! Ahuge salary for you while others battleto survive. The public should wake up.It’s your rates and taxes paying munici-pal employees the huge wages. There isno accountability from their side. Lera-
to.
Die vrou wat die lekkerste en heerlik-ste gebottelde en tuisgemaakte konfyteen als maak gebak ook staan by die ven-dusie. Dankie Elna jou goed is absoluutheerlik. Hou so aan. Dankie. R.D.
Engela van de Merwe ek is baie trotsop jou salon Ajoite, want die salon isbaie skoon en hulle help mense baie enMandy doen mooi hare sy en Sinah onssal altyd terugkom. Tannie Landy.
Ek kan nogal verstaan hoekom dieinwoners van Khutsong se Ext 5 sokwaad is. Maar wat gebeur het op 24Maart om al die ingange na Welver-diend te versper, ai dit laat my dink aan‘n gyselaarssituasie. Niemand kon virvier ure in of uit die dorp beweeg nie.Ek glo iemand moet hulle net leer omal hulle probleme op die regte plek tegaan aanspreek, naamlik ons plaaslikemunisipaliteit. Gaan brand julle bandeen sing daar. Aan al die inwoners vanWelverdiend, dit is tyd om wakker teskrik. Die gevaar is op jou stoep.
Graag wil ons oom Dave en sy spanvan TD tuindienste en nutsman be-dank vir die diens wat hulle gelewerhet. Sal aanbeveel vir enige iemand.
Wie gee die vullistrok die reg om aandie verkeerde kant van die straat te ryas hulle dromme skoonmaak? Seker
die munisipaliteit, dalk is dit tyd datons saamstaan en eis dat hulle afge-dank word en die poste gee vir verant-woordelike, hardwerkende mense watnie dink hulle besit die raad.
Hoera vir De Beer se kinders wat ietsprobeer doen vir hul eie veiligheid omby die skool te kom. Doen so voort!Miskien kan julle daardie stuk padmaar opkap.
Die grondpad sal dalk beter wees asom op so stuk “teerpad” te ry. (Maarnou ja - dit gaan goed in die sogenaam-de “nuwe” Suid-Afrika.)
Hiermee wil ons vir die personeel vanCPI asook die SAP bedank vir hulleflinke optrede na ons gewapende roof.Dis goed om te weet daar is mense watnog omgee. Willie & Helmie.
Ek was vandag by Fochville se be-graafplaas gewees om blomme op myvrou se graf te sit, toe loop daar om-trent 10 tot 15 beeste in die begraaf-plaas rond.
Oral is beeste voetspore op diegrond, so elke dag se ding. As grafstenebreek, wie moet betaal?
Thanks to the Carletonville Policeand our Lord Jesus for attending to thedemonic losers and all of those withthem on 27 and 28 March. May our waitnot be long for their eternal punish-ment. Hurry please Jesus.
Kagiso Segone
Everyone wants to be rememberedafter they cease to exist.
It is everyone’s duty to make surethat they are a blessing or a gift toothers while they are still alive. Ma-king a mark does not necessarily me-an that you must be a “celebrity” ora very famous somebody because itis not about how well known you are.
Rather, it is a matter of how youuse your time on this earth to impactother people’s lives, and the valueyou have amongst those around you.
Sometimes, people seem to missthe very essence of life. We drift sofar away with our own problems orambitions that we forget that we arehere to just live, above everything el-se. We have somehow disconnectedfrom the simple things of nature andwe place our attention on things that
do not lead us to happiness. In my ana-lysis, most people do notlive to benefit a majority, itis all about their personalambitions.
There are fewer indivi-duals who want to be “he-roes” of the country be-cause modern-day life ischannelled into a specificroutine of “survival”. Lifeis more about survivingthan actually living to thefullest, doing the thingsyou love and making a dif-ference in your own way.
In my own observationsI think that reality hasbeen replaced with toomuch fantasy, peoplechoose to ignore the realissues that are tearing humanity downand more emphasis is being placed on
entertainment. People would ratherspend their time ha-ving fun than volun-teer to help others ordo something positive.
If you want to makeyour mark in thisworld, you have to so-mehow place other pe-ople above yourself.You need to sacrificeyour time, energy andthoughts on someoneelse besides you. It ta-kes someone with a ve-ry big and special he-art to devote themsel-ves in that manner andsometimes, that iswhere the fountains ofjoy are found - in self-
less acts where you have been willingto compromise yourself.
Maybe life is not that bad. In myanalysis, it is not bad at all. It is peo-ple who make it complicated. Our li-ves are so complex that we forgetwhat the whole thing is about. We arealways in a state of worry, and stresscan make even the person with thekindest heart, cruel.
We could make it easier with kind-ness and humility. These are the bestway of making a mark because, whenyou are nice to others, you heal themspiritually and give them some formof hope to go forward.
Everyone can make a mark in so-meone else’s life. The question is,what kind of mark do you want toleave? Whether it is a scar or a smile,depends on you alone.
Start where you are, with a sim-ple, “Hi, and how are you today?
Don’t hold back. Play your partand make your mark.
Let’s talk about it -Make yourmark in theworld
There will be a live music event atLahliwe Pub in Khutsong from 14:00to 16:00 on 05 April.
The Unlearn Agency, a companywith its finger on the pulse of live mu-sic events in South Africa, is excitedto be embarking on a partnershipwith Concerts SA in the schools mu-sic circuit by bringing live music toKhutsong.
The aim of this initiative is to de-velop new audiences and appreciati-on for live music in areas outsidecentral Johannesburg and to show-case young, fresh, South African ta-lent on new platforms throughoutGauteng.
The agency will feature the talen-ted Masello Motana performing herpiece, Ntyilo Ntyilo – a vocal museumthat archives the township experien-ce through music. The music that isconceptualised, narrated and per-
formed by the melodic historian andcultural activist, transfers her intenti-on to entertain, teach, learn, grow andtravel through music which she lives byvery strongly.
Joining her on vocals is Mholi Mngo-ma, performing alongside fellow bandmembers, Kegorogile Makgatle ondrums, Senzo Nxumalo on bass, Toko-loho Mokoena guitar and on keys, Si-busiso Dlamini.
The agency invites all music loverson a journey through Africa and her ti-melessness, a spirit being captured ina moment of fragmented reality, likebreaking through the glass of time intothe present.
The entrance will be free for the com-munity to experience the power of livemusic. Keep the address: 2302 Tsholo-felo Street in Ext.4
Livemusic event
The poster for Sunday’s event.
Adele Louw
A local organisation is planning to makethis Easter a bit brighter for those whoare ill.
The non-profit organisation fromKhutsong, the Tshirangwana Communi-ty Health Project, plans to give specialEaster lunches to senior citizens andother vulnerable people from 3 to 5April. The organisation, which only be-gan operating in full last year, has alrea-dy assisted more than 170 pensionersand ill people by, among other things, gi-ving them meals and accompanying oreven organising transport for themwhen they have to visit clinics and othergovernment services.
People who wish to know more, orwould like to assist with food donations,for example, should call 061 164 1255or 072 632 5212.
Special Easterevent for thesick
3 April 2015 Carletonville Herald 5
DIENSTE TYD PREDIKERSDonderdagaand 19:00 Pastoor J. GriesselVrydagoggend 10:00 Pastoor W. StolsVrydagaand 18:30 Pastoor H. du PreezSaterdagaand 18:30 Sang & MusiekaandSondagoggend 10:00 Mev. M. StolsSondagaand 18:30 Pastoor W. Stols
Heerlike etes is beskikbaar by dieKosstalletjies en lekker kuier plek onder die Tent.
Waar: H/v Onyxrylaan enMaricostraat,Carletonville.
GPS Ko.ordinate: S26 21.690’E027 22.919’
of Adres: Maricostraat 4, Carletonville.
Navrae: Pastoor W StolsCell: 082 566 0581
Tel: 018 786 1352 / 018 786 1362
Almal is baie Welkom!
Bied aan:
Paaskonferensie2 April 2015 tot 5 April 2015
Bied aan:
Paaskonferensie2 April 2015 tot 5 April 2015
FIT & GO Carletonvillecelebrating Easterduring the monthof April, by giving
away anEastEr HampEr
to one luckycustomer!!!!!
Enter in our lucky drawby purchasing a set of2 or 4 Continental /
General Tyres and collectyour Cash Back Reward upto the value of *r500.
Hurry wHilEstocks last.
* TERMS ANDCONDITIONS APPLY
the Fit&Go staffHurry... you can be the lucky winner
Kagiso Segone
A group of gangsters disrupted an eventat the newBatswaneng community parkat around 01:30 on 28 March.
The Crucial Blunt event was hostedby Dee Jay Zester, a new age DJ fromKhutsong, andwas the first annual eventto be held at the venue.A crowd ofmore than 3 000 young pe-
ople turned up to have fun, making itone of the biggest events in Carletonvil-le’s recent history.When the hip hop session started at
16:00, the organisers expected everyt-hing to go according to plan, and it did,
until the power supply was interruptedand a group of bandana-masked gang-sters rushed into the park and startedattacking people.
The gang, apparently known as theDelta’s, had everyone rushing for safety.Several vehicles were smashed, an ex-pensivesoundsystemwasdamagedandpeople were injured.
Dee Jay Zester apologises to his fansthat have shown remarkable supportfor him.“I regret the disappointment, the lossesand the injuries that some sustained.However, I plan to host the event at a dif-ferent venue in September,” he said.
Gangsters disruptmusic event
hing to go according to plan, and it did,
The community park where the incident occurred.
ferent venue in September,” he said.
DJ Zester at work.
Kagiso Segone
Justice was finally served during thepast week when the owner of two pitbull terriers that had attacked asmall girl and her family was foundguilty and sentenced.
The case was originally openedon 1 December 2013 after a womanand child were attacked by two pitbull terriers. The case was finalisedon 27 March.
The incident left the woman, Gra-ce Jantjies and her three-year-olddaughter, Ophemetse, badly woun-ded.
The owner of the dogs was identi-fied as 54-year-old Nico Koen, whowas charged with the contraventionof Act 42 of 1003.
He was found guilty of negligencefor failing to lock up the dogs. Theaccused initially denied that thedogsbelonged to him.Inhis testimony,Koen saidhewas
hosting a party at his housewhen theincident occurred.
He was found guilty and senten-ced to 12 months imprisonment ora R6 000 fine.
As far as could be determined,Koen paid the fine shortly after beingsentenced.The final ruling also opens doors
for the victims to lay civil claimsagainst the accused. The magistratesaid the accused showedno remorsefor the incident and victims.
“We are happy to have won thecase, but we feel that the accusedmust pay for the child,” Jantjiessaid.The family is currently looking for
a lawyer to help them open a civil ca-se against the accused.
Pit bulls’ owner found guilty
The injured child and hermother at hospital.
se against the accused.
Little Ophemetse after the incident.
6 Carletonville Herald 3 April 2015
Dit is weer tyd vir Paasnaweek, wat ongelukkig al sin-oniem met hoë verkeersvloei en voertuigongelukke ge-word het.Die afgelope naweek is verskeiemense in ons omgewing
reeds in ongelukke dood. Van die ongelukke kon waar-skynlik voorkom gewees het indien al die bestuurders bydie wet en verkeersreëls gehou het.Baie mense dink nie daaraan dat een verkeerde stap
mense se lewens in ‘n oogwinkonherroeplikkan verandernie. ‘nOomblik sewegkykna ‘n selfoon, net nog ‘ndrankietydens ‘n partytjie of langs die viswater, daardie paar randwat gespaar is deur nie ‘n verslete band te vervang nie ofdaardie ekstra spoedwaarmee iemandnet bietjie vinnigerby hul bestemming wou uitkom kan letterlik die verskiltussen lewe of dood beteken.Wees eerder die ietwat stadiger bestuurder wat veilig by
sy langnaweek-bestemming aankom as die een wat soos‘n maniak jaag, net sodat sy foto die week na Paasnaweekin ‘nkoerant verskynnahy in ‘nongelukdood is of ‘n onge-luk veroorsaakhetwat andermensehul lewens gekoshet.Indien ons almal net die bietjie ekstra moeite doen om
ons eie en ander bestuurders se veiligheid te verseker, salons almal die Paasnaweek veilig kan deurbring en ookveilignaonshuise terugkeer.DieHeraldwensalons lesers‘n veilige en geseënde Paasnaweek toe.
Ry veilig diéPaasnaweek
na ‘n storie van‘n oud-brand-weerman wat sykinders geskiethet.Dié nuusge-
beurtenis, sal ge-troue Herald-le-sersweet, het na-tuurlik 20 jaargelede plaasge-vind. ‘n Opsom-ming daarvanhet onlangs in die “20 Jaar gele-de”-artikel, wat weekliks op bladsy2 van ons koerant gepubliseer word,verskyn. Die dagblad-mense het opeen of anderwyse daarvan te hore ge-kom en was só hard aan die soek nadie familie wat by die treurspel be-trokke was, dat hulle tot die Heraldse kantoor gebel het. Hulle wou blyk-baar by Wysneus se kollegas weet ofhulle ook van die familiemoord ge-hoor het. Wysneus verneem hullewas só ‘n bietjie bek-af toe hulle ge-hoor het dat hulle toe al die tyd diekat aan die stert beetgehad het.
Ds. André Kok, NG Kerk leraar
Lees 1 Petrus 3:13-18Danksy die koms van Jesus Chris-
tus, die Middelaar tussen God en dieverlore mens, kan en moet gelowigesnaby God in ‘n harmonieuse verhou-ding met Hom lewe.God het die mens geskape om Hom
te soek en in sy nabyheid te bly. Hy isin werklikheid nie ver van enigeen vanons af nie, want deur Hom lewe ons,beweeg ons en bestaan ons (Hand17:27,28).Die doel van die lyding van Christus
is dat sondaarmense byGodmoet uit-kom en saam met Hom moet lewe.Christus het vir sondaars gesterf omhulle by God te laat tuiskom (Die Nu-we Lewende Vertaling, 1 Pet 3:18).Wanneer Jesus die Regverdige ge-
noem word, beteken dit dat Hy dieEen is wat aan al God se eise voldoenhet. Die sondaar daarteenoor staanskuldig voor God omdat hy in alle op-sigte die wet van God oortree en dus“onregverdig” is.Deur sy offerdood het Jesus alles
wat ons kan verhinder om in die teen-woordigheid van God te lewe, uit dieweg geruim.Sonde is soos ‘n muur tussen ons
en God. Dié muur moet afgebreekword, anders sal God ons gebede nieverhoor en ons nie help nie (Jes59:1,2). Die Nuwe Lewende Vertalingsê treffend dat Jesus ons sondes weg-gedra het na die kruis toe en ons daar-van vrygemaak het (1 Pet 2:24).Die Ou Testamentiese priesters het
dag vir dag in die tempel diens verrigen elke keer weer dieselfde offers ge-
bring wat tog nooit die sondes konwegneem nie, maar Jesus het dieeenmalige en finale offer vir al onssondes gebring (Heb 10:11,12).Ons kan naby God lewe en sy wil
gehoorsaam (1 Pet 2:24) omdat Je-sus ons verhouding met God her-stel het. Omdat ons in en deur Je-susdie ewige enonveranderlike lief-de van God beleef en uitleef, salmense God in ons lewe sien (DieBoodskap, 1 Joh 4:1,12).Almal wat deur Jesus na God toe
gebring is, moet ‘n lewenswandelnajaag wat sal toon dat daar ‘n heili-ge eerbied in hulle harte vir dieHereis (1 Pet 3:15).As jy die teenwoordigheid van
God deur sy Woord en Gees ervaar,leef daar ‘n blye verwagting in jouhart datGoddeurdie opgestaneHe-
re sy seën op jou sal laat rus (1 Pet 1:3).Oor daardie wonderlike hoop moet jymet beskeidenheid en met eerbied virGod praat (1 Pet 3:15,16).Gebed: Dankie, o Vader, omdat ek
deur die bloed van Christus vrye toe-gang tot U het en my lewe aan U kan wy!
DeurGod lewe, beweeg en bestaan ons
Die probleem van rommelstrooi is ‘nkopseer wat, lyk vir Wysneus, noglank met ons gaan wees.‘n Kollega vertel sy het sowat twee
weke gelede in Coronationstraat indie rigting van Dolomitestraat gerytoe sy skielik ‘n netjiese sedanmotormet die registrasienommerCL6OBJGP aan die kant van die padsien staan. Tot haar groot verbasinghet twee kinders, wat lyk of hulle solaerskoolgrootte was, uit die motorgeklim en emmers gemors in die grasaan die kant van die pad begin uit-gooi.Wysneus se kollega was só stomge-
slaan dat sy eers meters verder haarmotor tot stilstand gebring het enhaar selfoon uitgehaal het om diemorsjorse te probeer afneem. Node-loos om te sê het die kinders en hulpa, wat sover die kollega kon sien,weer uitgeklim het om nog vullis uitte gooi, vinnig in hul kar geklim enbegin wegtrek toe hulle sien dat ie-mand hulle afneem.Wel, Wysneus se mond het oopge-
hang toe hy die verhaal hoor. Die deel
van die hele storie wat Wysneus diebangstemaak, is dat die pa sy jong kin-ders gebruik om die meeste van dievuilwerk te doen. Dit sal dus ook nie‘n verrassing wees as hierdie kindersgrootword metdie idee dat ditmaar reg is omgemors langs diepad uit te gooi endit ook laterweer so aan hulkinders oordranie.Die ander ding
wat Wysneus op-geval het, is datdie pa en kin-ders blykbaarbesig was omhuishoudelikerommel, ja, diésoort wat mensin jou grootgroen wielietjie-asblik moet gooi, langsdie pad uit te gooi . Dit was dus nie eensiets soos tuinvullis waarvoor hulle spe-siaal moeite sou moes doen deur by-
voorbeeld na die munisipale vullister-rein te ry nie.Na hy van dié verhaal gehoor het, het
Wysneus begin opmerk dat baie van dievullis in oop erwe huishoudelike vullis
is, wat baie mak-lik inmunisipalevullisblikke ge-gooi kon word.Onse munisipa-liteit sal duidelik‘n groot planmoet maak omnie net die rom-melstrooiers tevang nie, maarsommer ookhulle en hul ge-sinne in iets soosgoeie ou omge-wingsleer tou-wys te maak.Intussen het
Wysneus die af-gelope week ‘n staaltjie gehoor wat homlaat glimlag het. Hy hoor joernaliste van‘n groot dagblad het verlede DonderdagCarletonville se strate platgery op soek
Kinders van kleintyd geleer ommorsjorse tewees
vullis in oop erwe huishoudelike vullis
Die bestuurder aan die regterkant het vinnigweggetrek nadat hy gesien het Wysneus sekollega neem hom af.
Die Carletonville Rotariërklub het onlangs 'nrekenaar aan die Babbel en Krabbel kleuterskool in Welverdiend oorhandig. Die rekenaar is deur 'n besigheid geskenk en deur 'nplaaslike rekenaarkenner opgegradeer. Volgens die klub sal die rekenaar aangewendword om die kinders van vroeg af te leer hoeom met 'n rekenaar werk. Daar is ook onderandere speletjies opgelaaiwat die kleingoedse ooghand koördinasie sal bevorder. Opdie foto is Marieta Venter (president van dieCarletonville Rotariërklub) Raelene duPiesanie (tesourier van die Carletonville Rotariërklub) JeanPierre van der Poel (het die rekenaar opgradeer), in die rolstoel is Dezi du Toit (verteenwoordiger van skenker van dierekenaar) en voor hurk Stephanie Bezuidenhout (hoof van die kleuterskool).
Dié stralende bruidspaar, Denise en GehardNortjé is die afgelopeweek deur ons lesers as die wenbruidspaar vir November gekies. Hulle dringnou deur na die finalekompetisie om die Herald se Bruidspaar vandie Jaar te wees. Lesers sal volgendeweek vir die mooistepaartjiewat in Desember getrou het, kanstem.
3 April 2015 Carletonville Herald 7
R249 900 R195 900 R295 500 R149 900
R149 900 R269 900 R85 900 R139 900
R135 900 R280 995 R219 900 R109 900
2010 VW GOLF 6 2.0TSi GTi DSG
2011 NISSAN NP3002.5 TDi 4X4
2010 FORD RANGERWILDTRACK 3.0 TDCi4X4
2012 NISSAN LIVINA1.6 ACCENTA X-GEAR
2012 HYUNDAIACCENTA 1.6 GLS
2009 FORD RANGER3.0 TDCi 4X4 D/CAB
2006 HYUNDAITIBURON 2.0 GLS
2007 KIA SORRENTO2.5 CRDi 4X4
2005 BMW 330i E90 2014 Foton ISF LWB( Like New )
2011 TOYOTA HILUXXTRA CAB 3.0 D4D 4X4
Tiaan Du Plessis(Pre-owned Sales Executive)Cell: 079 436 9464E-mail: [email protected]/O Annan & Reinecke Streets • Tel: 018 786 2001/3378 • Fax: 018 786 1925
Carletonville
2006 HYUNDAI TUCSON2.0 CRDi AUTOMATIC* Terms & Conditions Apply!
@AutoiC
Carletonville Autoinvestments
Adele Louw
Stones went flying as Extension 5 resi-dents, who are unhappy with munici-pal service, once again blocked the ro-ad between Oberholzer and Welver-diend on Tuesday.One of the angry residents said they
closed the road at about 08:00 on Tu-esday morning to show their unhappi-ness with the service they are receivingfrom the Merafong City Local Munici-pality.“Some people have been staying in
Ext. 5 for two to three years but stilldon’t have electricity. We have also notreceived dustbins at all,” one of the pe-ople taking part in the march told theHerald.“Many of the people who stay here
have the money to pay for electricity.We have also heard that there is a go-vernment subsidy for those who aretoo poor to pay for basic electricity,”the protester went on.He said the roads in the area are also
in a bad state, especially when it rains,and there are no sports facilities oropen grounds where children can playsports.Residents also complain that, while
contractors in the area do employ lo-cal people, residents of the areas inwhich the work is physically done, donot benefit from these employment
opportunities.When the Herald’s journalist arri-
ved at the scene in Welverdiend atabout 10:15, a large group of protes-ters had blockade the road that leadsto Oberholzer. There were no policeor traffic officers to warn motorists atthat time, and vehicles travelling overthe railway tracks on their way to Wel-
verdiend were also stoned.“It can’t carry on like this.The residents ofWelverdiend are be-
ing held hostage in our own homes be-cause the protesters block off the roadto, and out of, town,” said one Welver-diend resident who had had an en-counter with the protesters, later themorning. According to a protester to
whom the newspaper spoke, their aimwas to keep the road closed until so-meone from the municipality came tolisten to them and attend to their grie-vances. As far as could be determined,the road was already open again byWednesday morning. The municipali-ty had not answered questions aboutthe matter by printing time.
Violent protesters blockoff roadagainViolent protesters blockoff roadagain
Some of the protesters blocking the road at Welverdiend on Tuesday morning.
Adele Louw
‘n Ouma van Fochville het verlede weekgroot geskrik toediemunisipaliteit haarhuis se krag afsny in plaas van dié van‘n oortreder wat duisende rand skuld.Volgens mev. Retha Geel, wat in
Wulfsohnstraat 18 in Fochville woon,het sy op 24 Maart bykans die skok vanhaar lewe gekry toe haar huishulp haaromstreeks 14:40 gebel en gesê het datdaar ‘nman by haar huis is wat die elek-trisiteitstoevoer na die huis wil afsny.Diemanhet aangedui dat hy ‘n kontrak-teur is wat vir die Merafong City Plaasli-ke Munisipaliteit werk en dat hy diekrag moet afsny omdat Geel nie haarmunisipale rekening betaal het nie.Die man het ook ‘n dokument aan die
huishulpoorhandigwaaropdieGeel-ge-sin se adres as dié een waar die krag af-gesny moet word, aangedui word. Dienaam van die huis se eienaar word egteras ‘n mnr. Naude aangedui.Op die dokument, wat in rooi en
pienk gedruk is, is ook aangedui datNaude se munisipale rekening R37886.39 agterstallig is.“Ek het aan die man probeer verdui-
delik dat dit nie my rekening is wat ag-terstallig is nie, maar hy het gesê dat hyniks kan doen nie omdat hy net die mu-nisipaliteit se opdragte uitvoer,” sêGeel.
Na haar krag afgesny is, het Geel ooksonder sukses probeer omdie saak sougou as moontlik met die munisipaliteitte probeer uitstryk. Sy het kleinkinderswat by haar bly en symoes nog die aandvir hulle kos maak. Hulle het ook noglig nodig gehad om by te leer.Geel het dadelik die munisipaliteit se
finansiële afdeling gebel het om te pro-beer verduidelik dat ‘n fout ontstaanhet. Sy het probeer verduidelik dat sydie munisipaliteit geen geld skuld nieaangesien sy reeds vroeër die maandhaar hele uitstaande rekening, asook ‘npaar rand ekstra, betaal het. Niemandwou egter blykbaar vir Geel glo nie aan-gesien dit haar adres was wat op die do-kument gedruk was wat aangedui hetwatter huis se krag afgesny moes word.“Jy kan niks doen om die probleem
reg te stel nie, want hulle wil net nie luis-ter nie,” het Geel vertel.Dit was eers toe ‘n kollega,me. Annett
Venter, wat ook ‘n DA-raadslid is, diemunisipaliteit bel, dat die saak uitsor-teer is.Venter het met ‘n werknemer ge-
naamdRefilwe gepraat en daar is vasge-stel dat hoewel die adres op die doku-ment dié van die Geel-gesin is, die erf-nommer op dieselfde dokument dié vanNaude,wat eintlik in ‘nheel ander straatwoon, is.
Dieselfde kontrakteur watdie Geel-gesin se elektrisiteitafgesny het, het in minder astwee uur weer by die huis op-gedaag om die krag kosteloosaan te sluit.“Hy het wel gesê dat hy ver-
seker die munisipaliteit dub-bel vir sy dienste sou laat be-taal omdat hulle hom tweekeer laat uitgaan het en hy virelke besoek aan ‘n huis betaalword,” het Venter gesê.“Die fout het voorgekom as
gevolg van data wat met diehand op ons stelsel ingevoeris. Die munisipaliteit het egtersy werkswyse verbeter enmaak nou eers seker van alleinligting voor elektrisiteit nahuise afgesnyword. Alle agter-stallige rekenings word virskuldinvordering en kriediet-beheer ingehandig.Die uitdaging is egter dat
baie eiendomme gedurendedie dag gesluit is en dat dit asgevolg hiervan onmoontlik isomopdié plekkewanbetalers
se elektrisiteit af te sny. Die munisipali-teit is egter besig om kredietbeheer enskuldinvordering in alle areas te doenom uitstaande gelde te herwin.“Ons vra om verskoning vir die ver-
keerdelike diskonneksie by Wulfs-
ohnstraat 18 en het die probleem dade-lik weer herstel na ons daarvan bewusgeword het,” het ‘n munisipale woord-voerder Dinsdag aan die Herald gesê navrae oor die probleem na die munisipa-liteit gestuur is.
Munisipaliteit sny verkeerde huis se krag af
nisipaliteit se opdragte uitvoer,” sêGeel.
Mev. Retha Geel wie se krag verkeerdelik afgesny is.
8 Carletonville Herald 3 April 2015
3 April 2015 Carletonville Herald 9
10 Carletonville Herald 3 April 2015
Kagiso Segone
A new project is helping young peopleto improve their skills so that they candeveloped agriculture in the area.The Primary Agriculture Short Skills
project is currently taking place at theKhutsong Youth Development Centreand it is a special agricultural projectaiming to benefit some 150 unemploy-ed Grade 9-12 youngsters from Khuts-ong, Wedela and Kokosi townships.The project commenced on Monday,
16 March. The Marang Incorporaedare the project owners, appointed bythe Gauteng Department of Education(GDE) and the agricultural training isdone by an accredited training provi-der from Shoshanguve at Tshwane.The aim of the project is to bridge the
unemployment gap in theGauteng Pro-vince through activation of structuredand meaningful training interventionsthat provide sustainability and quasi-employment for peripheral or semi-ru-ral communities such as Merafong.The short coursewill run for approx-
imately three months, after which thelearners will be trained in forming co-operatives to run sustainable agricul-tural processing businesses that canhopefully support them for the rest oftheir lives..A hundred and fifty unemployed yo-
uthswere identified through communi-cation with Mike Msukwini, the youthcoordinator based at theMerafongmu-nicipality. Theywere then inducted andrequested to fill bursary applicationforms, which were submitted to theGDE for processing.Once approved, the learners were in-
formed about their bursaries, enrolled
by both Marang Inc. and the GRCA(Gauteng City Region Academy) afterwhich the training commenced.The criteria used to select the indivi-
duals who are currently in the trainingprocess was evaluated by their age andonly unemployed young people from18 to 25 years were allowed to partici-pate in the programme.Some of the key subjects in the cour-
se course builds academic knowledgeand theory integratedwith thepracticalskills and values necessary for self-ful-filment and meaningful participationin society as citizens of a free country.It also provides access to further lear-ning in a specific vocational sector cho-
sen by the learner and facilities thetransition of learners from formal edu-cation to the workplace.After completing the course, lear-
ners will receive certificates.The project focuses on primary agri-
culture.The GCRA, through the training,
contributes to the reduction of unem-ployment and enables the school lea-vers and youths who are out of schooland those already employed by theGauteng provincial government andmunicipalities to becomehighly skilledofficials who can provide outcomes-fo-cused service delivery in the provinceand bring life to the slogan “Akushesh-
we” meaning “let’s make a move on”.Their future plans are to turn Mera-
fong into an agricultural productionprocessing hub, as per mandate of theWest Rand District Municipality as an-nounced by Lebogang Maile, the MECfor Local Economic Development ofGauteng, at the recently-held GautengAgricultural summit.According to the organisers the start
of the Primary Agriculture is a sign ofgood things to come out of the Mera-fong grid, to support and eradicateunemployment through sustainabletraining interventions that lead to occu-pational excellence and employment.
Newspotlight onagriculture
sStudents at one of the workshops. Another workshop in progress.
3 April 2015 Carletonville Herald 11
Carlodene Coetzee: 072 995 [email protected]
Carlodene Coetzee: 072 995 [email protected]
1 1 1
INVESTMENT!
ROODEBERG 201
Walking distance to Medi Clinic – Army Base andWitrand Hospital. 30sqm Bachelor flat situated in a securecomplex with a swimming pool.The flat offers great investment opportunities.Possible rental income of +- R3000.oo pm
EXCLUSIVE MANDATER356 000 OWNYOUR OWN PLACE
DAISY’S 27
Cosy flat for working person or student!This flat will quickly make you feel at home, it’s situatednear the Army base and the university with a swimmingpool and good security.
EXCLUSIVE MANDATER499 800 ONCE IN A LIFETIME
BELLAVIEW 14
This is a buy of a lifetime. This unique property is situated in a very popular secure complex.The kitchen is modern and spacious with granite finishes. It offers spacious bedrooms and2 bathrooms with 1 en-suite. The unit is 100 square meters big. This is an ideal investment.The levy is R680-00 pm and rates and taxes are R316-00 pm. Make your call now or youwill be disappointed!!
EXCLUSIVE MANDATER655 000 SPACIOUS FAMILY HOME
BAILLIEPARK
PIET CRONJESTR 60
Walking distance to Baillie Park Primary school and shoppingcentre. This family – open plan living and dining room with lotsof cupboards is just the place to live out your dreams. Lots ofpotential to make it your own dream house.
EXCLUSIVE MANDATER1 395 000
Gia Joubert: Cell : 084 993 [email protected]
Marietjie Mostert: Cell: 083 302 [email protected]
3 2 1 4 2 2
SHOWDAY:Thursday 2/04 16h00 - 18h00
EiendomsGIDSProperty GUIDEHeraldHerald
POTCHEFSTROOMAlta 082-925-2037, 018 297-6318
Faks: 018 297-7482Email: [email protected] EN PLASE TE KOOPWILDSPLAAS NABY POTCH
WILGEBOOM R1,6 milj
HAASKRAAL
129 Ha. 4 Chalets, lapa,verskeidenheid wild en tweetoegeruste boorgate. R4,2 milj
8,5 Ha opgedeel in 20 kampemet suipings, 2 toegerusteboorgate. 2 x 3 Slk woonhuise,1 w/stel, Groot sinkstoor metvoëlhokke
.91 HA. 35 HA onder spilpunt. 20HA droe lande. 34 HA weiding.Woonhuis. Stoor 311 vm.R5.7 miljNick 072 025 0375
PRYS VERLAAG!!SENTRAAL. R850 000
MIEDERPARKR1,1 milj
PUIK KOOP. Netjieseoutydse 3 slk huis met2 badk, grootleefareas, mooihoutvloere, komb,motorh in boomryketuin. Ruim kamers!
Stewige 4 slk huis met2 badk, studeerk, sitk,eetk, komb, lapa metstort wabak en toilet,braai en twee motorh.ALTA 082 925 2037
SUID. R950 000
MEENTHUIS NABY
VOLKSKOOL R795 000.
Woonhuis met 3 slk,
2 badk, sitk, eetk, komb,
lapa en ruim 1 slk
woonstel
MELINDA 083 743 5400
Meenthuis. Baie netjiese
2 slk meenthuis met 2
badk, oopplan leefarea,
komb met opwas. Eie
tuintjie.
ALTA 082 925 2037
SKAKEL GERUS EEN VAN ONS AGENTE VIR FLINKE PROFESSIONELE DIENSGERT 082 377 1313 OF ANELLE: 079 565 4888VIR MEER INLIGTING BESOEK ONS WEBBLAD: www.landlink.co.za
KOOPVAN DIEWEEK: !!SLEGS R950 000!!MIEDERPARK (MP1180)
BUITENGEWONE KOOP!!!!DIE DRIESLAAPKAMER HUIS IS IN ‘N GOEIE AREA
VIR DIE REGTE PRYS. NETJIESE KOMBUIS MET INGEBOUDEKASTE EN SITKAMER, 2 BADKAMERS,DUBBELMOTORHUIS
TWEE AFDAKKE AGTER STOEP EN BUITE TOILET
2 SLAAPKAMER MET NETJIESE INGEBOUDE KASTE SITKAMEROOPPLAN EN KOMBUIS MET PRAG KASTE BADKAMER MET
STORT,BAD,TOILET ENWASBAK TOESLUIT MOTORHUIS EN AFDAKWASKAMER IN MOTORHUIS EN NETJIESE TUINTJIE. GROOTTE 81M2
TE HUURte Huur
studenteBeHuisinGCOETZEESTRAAT (KAMERS) r2 800.00ROODEBERG (LOFT) r3 300.00HOFFMANSQUARE (1 SLPK) r3 500.00VARSITY LODGE (1 SLPK) r3 600.00AT VARSITY (1 SLPK) r3 850.00CAMPUS@HOME (2 SLPK) r4 000.00JONGE MOLEN (2 SLPK) r4 000.00AFFI BULT (2 SLPK) r4 950.00ONDER DIE RANDJIE (2 SLPK) r5 500.00BORCHERD HOUSE (2 SLPK) r6 500.00
te Huurresidensieel
VILLA DE BELL (KAMERS) r1 870.00DAISY (BACHELOR) r2 200.00LANGS DIE RANDJIE (BACHELOR) r2 400.00VILLA DE BELL (BACHELOR) r2 500.00ROODEBERG (BACHELOR) r2 970.00THE BATS (EEN SLPK) r3 850.00BARRISH PLACE (2 SLPK) r4 085.00BEACH AVENUE (2 SLPK) r4 675.00PHILLIPSLN (3 SLPK HUIS, 1 BDKM) r6 500.00RIVERSITE (3 SLPK HUIS, 2 BDKM) r9 500.00
WINKEL SPASIE TE HUURGOED GELEE IN BESIGE STRAAT, SENTRAAL DORPTE HUUR VIR SLEGS R16 300.00PM
!!!! TE KOOP R730 000 !!!!DIEREVRIENDELIK PRAG MEENTHUISIE (SD1056)
12 Carletonville Herald 3 April 2015
Retiefstraat 63Tel: 018 294 6544
E-pos: [email protected]
Lynette - 072 307 7653 Anthony - 061 123 8940 Ernst - 081 250 7197 Jeanette - 083 232 2843
KannoniersparKMeenthuis: 2 Slpk, 1 badk, 1 afdak en ‘n
pragtige privaat tuintjie vir r720 000
Bult-wesWoonstel vir jong werkendes: 2 Slpk, 2 badk
en 2 afdakke. Grondvloer r595 000
MiederparKRuim (160m²) 3 Slpk, 2 badk, 1 m/hdupleks in rustige area net r695 000
nuwe Baillie parKSplinternuut geboude 3 Slpk, 2 badk,
dubbel m/h huis. Netjies afgewerk en ‘ngroot tuin vir r1 890 000
nuwe Baillie parKBesonders pragtige meenthuis:
3 Slpk met 3 badk, dubbel m/h en‘n privaat tuintjie vir r1 590 000
Baillie parK722m² Erf in Sekuriteitskompleks.
r475 000
BultBachelor woonstel by die NWU
se hek. r430 000
Baillie parKRuim nuutgeboude huis: 4 Slpk,
1 studk, 2 badk, dubbel m/h en groottuin. r2 330 000
Granada2 Slpk Woonstel Sentraalwinskoop: r699 000
Kies jou droomhuis van die plan af!!!Mooivallei parK
3 Slaapkamer eenhede vanafr950 000 enkel tot r1 590 000 vir
dubbelverdieping
GriMBeeKparK3 Slpk Meent r730 000
sentraal (die eiKe)2 & 3 Slpk woonstelle inr430 000 - r450 000
sentraalMeenthuis 3 Slpk,
1½ badk, 1 m/h. r5 100Huis 3 Slpk, 2 badk,dubbel m/h. r6 350
Baillie parKMooi 3 Slpk huis met 2 badk
en dubbel m/h. r9 000
KanonniersparKMeenthuis 2 Slpk, 1 badk,1 afdak met privaat tuintjie.
r4 500
tuscany ridGeWoonstel 2 Slpk, 1 badk,1 afdak asook ingeboude
braai. r5 650
suid-sentraal3 Slpk woonstel, 1.5 Badk, aparte opwas,
toesluit m/h, sekuriteitskompleks. r827 000
van der HoFFparKLieflike gesinshuis met 4 slp, 2 badk, pragtigeontspanningsarea, swembad & 1 slp woonstel.
r1 890 000
woonstelleBult
Studente: 2 Slpk, 2 Badk, Grondvloer, mooigemeenskaplike tuin. Sekuriteitskompleks.
Baie veilig. r1 272 000
Studente: 2 Slpk, 1 Badk,Sekuriteitskompleks. r950 000
MiederparK2 Slpk meenthuis, 2 Badk, 1 m/h,sekuriteitskompleks, r848 000.
VERHURINGS
Kantoor Tel: 018 293 1845Faks: 018 293 3163E IENDOMME
OTNERROSBesturende agente
verKope / sales - 082 320 3847 - annatjiewoonhuis te koop – lifestyleRuim 4 slp leef huis, skuifdeureby elke kamer met Trellidors,3 badkamers, 3 motorhuise,groot omheinde erf r2,3 miljoenwoonstelle – sentraalRuim 2 slp woonstel op grondvloer,2 motor afdakke, met swembaden sekuriteit r530,000Meenthuis – Bailie park3 slp, 2 badkamers, sekuriteitskompleks, klein tuin en 1 motorafdak,troeteldiere r920,000
verHurinG/rentals082 586 7924 - susannewoonstel - sentraal- tramontoBachelors beskikbaar (kan deel) r3 0001 Slp – 2 Slp, badkamer, afdak r3 650 - r4 400Meenthuise – villa louanne, Bailliepark3 Slpk, 2 badkamers, afdak,tuin met plaveisel r6 200 - r6 400Grondvloer woonstel- Miederpark2 Slpk, 1 badkamer, afdak, nuut uitgeverf r4 200woonhuis te huur –lifestyle estateLuukse ruim 4 slpk,dbl motorhuis, swembad,sekuriteit r15 000
Faks: 0866 479 686Sel: 082 562 4248
E-pos: [email protected] 082 562 4248
Te koopVan der Hoffpark.
7 Slp huis met 5 badk.R2.1 mil.Te Huur:
Wonderlike meenthuis inBailliepark.
3 Slp., 2 badk., dubbelmotorhuis, ruim ooplan
Koopkrag.Beskikbaar 1 Mei 2015
R8 500/mHein 082 562 4248
eiendom van dieweekBailliepark R3 300 000Stylvolle ruim huis vir die
kieskeurige koper met
4 slaapkamers, 3 badkamers,
3 groot leefareas,
ontwerperskombuis,
opwas, bediendekwartiere,
onthaalarea en mooi tuin.
Skakel Petru 072 700 4100
3 April 2015 Carletonville Herald 13
Adele Louw
The Merafong City Local Municipalityhas, for the first time, openly discus-sed the fact that it is experiencing fi-nancial difficulties.
During her recent State of the CityAddress, the executive mayor, Ma-phefo Mogale Letsie, acknowledgedthat the municipality is struggling topay the bills.
“This is due to a number of reasons,butmainly because of the negative out-come of the mines’ appeals,” she said.
TheHerald has previously reportedthat mining houses in the area have ta-ken themunicipality to court over pro-perty valuations that they consider tobe excessive.
The mayor said the matter had ta-ken 18 months to finalise, after whichthe valuation appeal board found in fa-vour of the mines in November.
“This has resulted in a R12 milliondecrease in revenue per month, andthe matter has been taken up for re-view,” she said.
She also pointed out that Blyvoor
Gold Mine currently owes the munici-pality about R170million, and that thepayment rate for municipal serviceshas dropped by about 20 percent overthe past two years.The biggest challenges of credit
control come from areas such as Ko-kosi, Khutsong, Wedela and Green-spark,where residents are reluctant topay for services.Themunicipality’s difficult financial
situation once again came to the foreduring a council meeting on Tuesday.As Council discussed the proposed
first draft of the 2015/16 budget, DAcouncillor, Blackie Zwart, expressedhis concern over how this significantloss of incomewould affect themunici-pality’s operations.Not only is there expected to be a re-
duction in the number of essential va-cancies that will be filled, there is unli-kely to be a budget for training of per-sonnel.The capital and maintenance bud-
gets will also have to be reduced tosuch an extent that service deliverywillsuffer.
Merafongopenly discusses financial problems
Adele Louw
Residents of Khutsong Extension 3are complaining that the area’s sewe-rage problems are still far from over.
Earlier this year, residents com-plained, forweeks, about huge sewageleaks inmany of Extension 3’s streets.After they got worse, residents took tothe streets in protest.
According to the Merafong City Lo-cal Municipality, the problems stem-med from a sinkhole that damaged amunicipal sewage pipeline.Although the sewage problems in
the streets were cleared up, residentsonce again complained earlier in theweek that all was not well aroundHlanganani Primary School.This has been the site where there
have been many instances of groundsagging, mostly as a result of badly-built municipal sewerage pipelines.
About three years ago a big sinkho-le fell in opposite the school’smain ga-te. Two sinkholes also appeared next
to the school toward the end of last ye-ar. The newest one which, accordingto themunicipality, was the reason forthe sewage chaos in the rest of Exten-sion 3 earlier this year, also appearedin the same area near the school.MrChukuKerileng from theKhuts-
ong Crisis and Development Resoluti-onCommittee, also stays inExtension3.He says residents are worried that
a massive sewage leak from amanho-le near the school is going to causeeven more sinkholes.
When the Herald visited the site onMonday morning, a strong stream ofsewage was flowing from a manhole,which looks as if it had been delibera-tely opened, into a man-made trench.The trench channelled the sewage
from the site in a southerly direction.A group of workers were busy at thesite at the time of the newspaper’s vi-sit.
“The contractor anticipates thatthe sewage pipeline will be completed
by 13 April 2015 if everything goes ac-cording to schedule. The area hasbeen isolated and a honeysucker(truck) is on site to prevent sinkholes
from forming on a regular basis,” aspokesperson of the Merafong CityLocal Municipality told the Herald onTuesday.
Residents worried about new sewage leak(truck) is on site to prevent sinkholes Tuesday.
The sewage leak worrying residents.
Adele Louw
Compensation for miners who havecontracted tuberculosis (TB) duringthe course of their work was one of themain issues raised by speakers duringaWorld TBDay event thisweek.
World TB Day is cele-brated annually on 24March and a function lin-ked to this event was heldat Sibanye Gold’s KloofMine last Saturday. Vari-ous speakers highlightedissues related to the linkbetween this deadly, butcurable disease and mi-ning.
“In the past TB spreadunchecked in the mines.Mines put lots of moneyinto the development ofassets, but not into thedevelopment of their hu-man assets,” the firstspeaker of the event, la-bour representative MrBokang Lethala of the NUM(National Union of Mine-workers) told those who at-tended.
“We want TB fatalities tobe treated in the same way as other mi-ning fatalities becausemanyminers getthe disease through their work. Fami-lies must receive compensation. Mi-ners who lose their hearing as a resultof taking TB medication must also becompensated for it,” he continued.
They main speaker of the event, Dr
Patrick Osewe of the World Bank, alsosaid that a lack of compensation forthose who contract TB is one of themain issues in dealing with the diseasein mines.
He said that the World Bank is con-cerned about the link between mining
and TB and has, for thisreason, established vari-ous actions in countriesthat are part of the SADC(Southern African Deve-lopment Community) tocombat thedisease. The-se include ensuring thatthe same TB treatmentis given to patients in allSADCcountries so that amineworkerwho goes tohis home in a neighbou-ring country on holidaydoes not develop resis-tance to his TB treat-ment because he doesnot have access to hismedication. An effort isalso underway to ensurethat all known TB pa-
tients can be traced, even af-ter leaving the mines wherethey were first diagnosed.
“The fight against TB re-quires very strong collabo-
ration between governments, unions,mines and other institutions,” saysOsewe.
In order to help fight TB, the WorldBank has already given millions ofrands and is considering a proposaldrawn up by countries and institutionsfighting thedisease. Theywant tomake
an additional R600million available tofight the disease, he says. The WorldBank has also pledged an additionalR700million to the cause. World Bankfunding has helped set up a one-stopservice centre for current and formermine workers at Carletonville Hospi-tal.
Speaking on behalf of SibanyeGold,a member of its executive committee,Mr Shadwick Bessit, said Sibanye ack-nowledges the various problems. It isbusywith an action to ensure thatmostemployees are screened and tested,
and also receive treatment every year.The mine also ensures that TB medici-nes are used until every possible em-ployee is cured.
As part of the event, John Motole,a Sibanye employee that has been cu-red, discussed how his employer hadassisted him to be treated and cured.Motole, together with other speakers,called on all mine workers to make su-re that they are tested regularly and, iftesting is positive, to ensure that theydiligently stickwith their treatment un-til they are cured.
‘Minersmust be compensated for TB and related problems’
The Sibanye Gold choir opened the event.
Dr Patrick Osewe ofthe World Bank wasthemain speaker during the event.
Kagiso Segone
A man was hi-jacked on 13 Marchwhen he was stopped by “police” wearing reflectors.
The driver was travelling in AgnewRoad just before the R501 (P111) roadroad when he was suddenly stopped.The “police” mentioned that he wasdriving over the speed limit. They then
demanded money from the driver andthey robbed him of his cellular phonewhile pointing a firearm at him.They also took his car keys, put the
driver in the carboot anddrove offwith
him to Power Park West End Bricks inSoweto where they left him.
The driver’s vehicle is a white Chev-rolet Utility Bakkie RegistrationCX77ZHGP.
Robbers pretending to be Police hijack driver
14 Carletonville Herald 3 April 2015
Die V en Media24 het ooreengekom dat die adverteerder volle verantwoordelik aanvaar vir die nakoming van relevante wetge-wing in dieplasing van korrekte inligting ten opsigte van sy advertensie hierin geplaas. Derhalwe, aanvaar Media 24 geen aanspreeklikheid vir enige
skade opgeloop voortspruitend uit die plasing van enige advertensie hierin nie
It has been agreed between the Advertiser and Media 24 that the Advertiser is solely responsible for the correctness off all details concer-ning its advertisement placed herein, including compliance with all relevant legislation. Therefore, Media 24 does not
accept any liability for any damage resulting from any advertisement placed herein.
Nazalene Struben
Swembaddens /Swimming pools
41
Tuindienste /Garden services
38
Sekuriteit / Security36
Blindings / Blinds25
QUALITY SERVICE ALL THE TIME!
PERSOONLIK /PERSONAL1. Berading / Counselling2. Kerke / Churches3. Gelukwensings /Congratulations
4. Dankbetuigings/ Thank you5.Memoriam/Grafstene /Tombstones
6. Egskeidings / Divorce
7. Speurdienste /Private Detectives
8.Verlore / Gevind /Lost / Found
9. Saamrygeleenthede / Lifts10. Vriendskaplik / Friendship11.Persoonlikekennisgewings/Personal Notices
DIENSTE / SERVICES12. Dagsorg / Daycare13. Kleuterskole /
Pre-Primary Schools14.Naskoolsorg /
Afterschool care15.Onderrig / Education
16. Video&Fotografie /Video&Photography
17.Musiek /Music18.Onthale&Konferensies
Functions &Conferences19. Spyseniering / Catering
20.Wegneemetes&Restaurante / TakeAways&Restaurants
21. Lugversorgers / Aircons25. Blindings / Blinds26. Springkastele /
Jumping Castle27. Houtwerk / Carpentry28.Matte / Carpets29. Plaveisel / Paving30. Bouwerk / Building31. Beton&Palisade /
Concrete&Palisades32. Elektriese dienste&
Herstelwerk / ElectricalServices&Repairs
33. Loodgieters / Plumbing34.AlgemeneDienste /
General Services35. Rommelverwydering
Refuse Removal
36. Sekuriteit / Security37. Plaagbeheer /
Pest Control38. Tuindienste /
Garden Services39.Vervoer&Berging /
Transport&Storage40. Boorgate / Boreholes41. Swembaddens /
Swimming Pools42.Grasdakke / Thatch roofs43. Lenings / Loans44. Finansiele Dienste /
Financial Services45.Naaldwerk /Needlework46. Skoonheid&Gesondheid /
Beauty&Health48. Jaggeleenthede /Hunting49. Sweis&Staalwerke /
Welding&Steelworks50.Massering /Massages
EiENDOMME/PROPERTiES72. Algemeen te huur / To let80. Losies / Boarding81. EiendommeBenodig /
PropertiesWanted82. Besigheidsgeleenthede /
BusinessOpportunities83. Persele / Premises84.Woonstelle te huur /
Flats to let85.Woonstelle te koop /
Flats for sale86.Meenthuise te huur /
Townhouses to let87.Meenthuise te koop /
Townhouses for sale88.Huise te huur /
Houses to let89.Huise te koop /
Houses for sale.
62. Juweliersware /Jewelery
63.Veevoer / Animal Feeds64.Diere&Pluimvee
Animals&Poultry65. Plaastoerusting /
FarmEquipment66.Motors67. Bakkies68.Vragmotors / Trucks69.Motorfietse /
Motorbikes70.Woonwaens / Caravans71. Bote / Boats
TE KOOP / FOR SALE52.Algemeen te koop /
General for sale53. Te koop gevra /
Wanted to buy55. Rekenaars / Computers56. Kantoortoerusting /
Office supplies57. Selfone/Cell phones58. Pandwinkels /
Pawn shops59. TV / Elektriese
toebehore/TV / Electrical Appliances
60. Boeke/VersamelitemsBooks / Collectors items
61. Kuns /Oudhede/Artwork/Antiques
90.Hoewes&Plase te huur /SmallHoldings&Farmstolet
91. Hoewes&Plase te koop /Small Holdings&Farms for sale
92. Besighede te koop /Business for sale
93. Kamers te huur /Rooms to let
94.Gastehuise / Guest-Houses95.Vakansie Akkomodasie /
Holiday Accommodation96. Bestuurskole /
Driving Schools97. Betrekkings gevra /
VacanciesWanted98. Betrekkings / Vacancies99.VolwasseVermaak /
Adult Entertainment
Algemeen te koop /General for sale
52
Motors66
Sweis & staalwerke /Welding & steelworks
49
Algemene dienste /General services
34
KennisgewingDit is die verantwoordelikheid van die Adverteerder om seker te maak dat syadvertensie korrek is op die eerste dag van publikasie en geplaas is volgenssy/haar instruksies en dat alle foute gekorrigeer is voor die volgende uitgawe.Mooivaal Media neem geen verantwoordelikheid vir meer as een foutiewe
plasing nie. (018) 293 0750 / (018) 788 6693
A1RY
PH5
STRUGGLING TO PAY YOUR DEBT??LET OUR REGISTERED DEBT COUNSELLOR AND ATTORNEY
HELP YOUWITH DEBT RELIEF.WE CAN ASSIST YOUWITH DEBT REVIEW AND
ADMINISTRATION.TEL (018) 297-7580 OR 083 271 9345
CALL US BEFORE IT IS TOO LATE!!STRICTLY CONFIDENTIAL;
NO FIRST CONSULTATION FEE PAYABLE.
H Heinricha Hodgson Inc.Attorneys, Debt Counsellors & Mediators
Reg. No. 2015/03541/21
H
DIVORCES&FAMILYLAWMEDIATION
FAST, EFFICIENT & AFFORDABLE LEGALASSISTANCE &MEDIATION.
CALL HEINRICHAHODGSONATTORNEYS ON(018) 297-7580 OR ROZANNEON084 440 5505.
ADDRESS: 140 PETERMOKABA STR,POTCHEFSTROOM
H Heinricha Hodgson Inc.Attorneys, Debt Counsellors & Mediators
Reg. No. 2015/03541/21
H
U is wys as U myvravir ‘n prys!!
U is wys as U myvravir ‘n prys!!
Egskeidings / Divorces06
Berading / Counselling01
Opknap en spuitverf van dakke(airless). Teël, sink, asbes, ens.Geroesde dakke word herstel en geboue is
baie koeler daarna - tot 100C. Huisdakke wordin een dag gedoen. Algemene verfwerk.
Skakel Dirk 082-463-1436.
expandablesecurity products!
slamlock/std. lock & key alike features
cell: 082 7755 754fax: 018 293 [email protected]
FREEQUOTES!!
SANDMANDeon Van Zyl
TEL: (018) 291-1048/9SEL: 082-453-0195.Potchefstroom
VERHURINGS,TLB’s, Laaigrawe en
tippers.SKOONMAAK VAN ERWE
tuinmengsel, tuingrond, Bousand, riviersand,“G5 Filling”, crushersand, Buildersmix
INCREDIBLE DOOREXPANDABLE SECURITY DOORS & WINDOWSYour Security Is Our Priority
• Powder coated• 5 Year Warranty• All steel components• Excellent quality, strength and service• Competitive prices
FREEQUOTES
SLAM LOCK &HOOK LOCK
0861 102 340 en 079 876 7956www.incredibledoor.co.za
email:[email protected]
Skakel: 079-492-4149
Goeie kwaliteit!!Beste prys!!
KITSGRASINSTANT LAWN
LOWBED VERVOER BESKIKBAAR
A1U
KA
75
Veiligheids- Nette / seileMoenie datjou kind
verdrink nie!!!skakel: elize 072 187 2754
a1q
41aq
Voorsien en installeer van heinings enveiligheidshekke. Algemene sweiswerke
en oprig van Store en Afdakke.Skakel
Manie by 082-335-9761.
MANIE SWEISWERKE
AA ACCORD WENDYSFrom Pallert Wood
3M X 3M = R4 5003M X 4M = R5 200
2,4M X 2,4M = R4 100Wendys comes with 1 window,
with glass, wooden floor & zinc roof.Treated with wax oil.
Contact Dannis at 078-186-4770
A1U
KZFQ
NalediOns koop:
Breekgoed, meubelsyskaste ens. Wat het u?
Skakel gerus(018)-297-7755
HET U KONTANT NODIG?Lenings beskikbaar !! • ITCWelkom!!! Benodig voertuig?
FAKS VOLGENDE:Payslips, Identiteitsdokument • Bewys
van adres • 3 Maande bankstate• Rybewys indien nodig
Skakel: Hanlie 082 356 4343Zelda 079 133 1188Faks: 086-226-3285
Email: [email protected]
3 April 2015 Carletonville Herald 15
PersoonlikeKennisgewings /Personal Notices
11
Ek is 'n geestelike genees-heer met wonderlike krag-te, kry hulp met liefde, be-sigheid, huweliksgeluk ge-
sondheid enander probleme.(081-073-3694
GebedskliniekSMS naam en versoek na
(071-347-1214
Musiek /Music
17
GUITAR LESSONS:Rock, Blues, Praise &Worship, Acoustic andmuch more. We willrock you!! GUITAR
MAN MUSIC SCHOOL,Shop 5, Willow House,139 Peter Mokaba Str,Potchefstroom. (083-379-7944 or visitwww.guitarman.co.za
Springkastele /Jumping Castles
26
Space rocket, castles, foamdisco party's, tables, chairs
for birthday's balloons,generators and much muchmore fun!(072-257-3053
Houtwerk /Carpentry
27
Kobus houtwerke:kombuis kaste, ingeboudekaste + ander houtwerk.
(Potch). ( 072-192-4059.
Matte /Carpets
28
MATSORGOns maak matte,
beddens ensitkamerstelle skoon
Bel nou!!!!082 709 9438
Ons kan ookreuke uithaal!!
efc
MATSKOONMAAK-DIENSTE
SKAKEL CILDA VIVIERS(018) 294-7459 of082-442-9924
V4
Skakel Piet ofJohanita ViVierSby Modern autotriMMerS & uPh.
VOLVLOERMATTEEn bLindERs.
Tel: (018) 294-7459fax: (018) 293-0785
Plaveisel /Paving
29
Bouwerk /Building
30
8fc
BERTS BRICKS(Potchefstroom)
• KLEIPLEISTERSTENE• KLEI SIERSTENE
• KLEIPLAVEISELSTENE
• SEMENTPLEISTERSTENE
• SEMENTMAXI STENE• SEMENT
PLAVEISELSTENE
GElEwER:PoTChEfSTRoom,CaRlETonvIllE,foChvIllE, PaRySEn omGEwInG
Skakel Elaine(018) 292 1615www.bertsbricks.co.za
Kruger Afdakke. Skadu-netafdakke, 4 jaar waar-borg. Gratis kwotasie. 18Jaar diens. Potch omge-wing. ( 083-493-5876.
DAKLEKKE. 3 JAARwaarborg. Verfwerk, pla-veisel, bou en teëlwerk.
( 082-541-3073.
NHBRC GEREGISTREER
DAWID082 772 3731
DEWALD072 784 5107
BOUWERKVERFWERKSTAALWERKPLAVEISELTEëLWERK
Paving, tiling, palissades,lapas, precast walls &general construction.STONE-AGE
AGENTSKAP OOK NOU!SKAKEL GERUS VIR
GOEIE PRYSE & DIENSDeon [email protected]
SKADUNETTE / AFDAKKESTAALWERK
15 Jaar professionele diens+ waarborg.Skakel Rudolf
082-335-0118 / 082-683-9993
Beton &Palissades /
Concrete & Palisades
31
POTCHBETON
082-335-0118082 683 9993
Precast, Palissade-mure, plaveisel,
lapa’s.Gratis kwotasies.
Elektriese dienste &Herstelwerk/ Electrical
Services & Repairs
32
E63
REVAMPELECTRICAL
Eerlike enbetroubare
elektrisiën vir al unuwe installasies,foutopsporingsen herstelwerk.
Skakel Shaun by072-186-7311 ofJan Hendrik by076-199-6164.
RohanElEctRical* Pre-paid power* Fault finding
* Newinstallations* C.O.C’s* Geysers
* Gate motors
DaVE083 675 6370
7b3
Herstel vanelektriese probleme
en allehuishoudeliketoestelle soos
yskaste, stowe,wasmasjiene,
(Ingesluit SpeedQueen en whirlpool)
tuimeldroërs,skottelgoedwassers,
geysers,loodgieterswerk, ens.
WILLIE’SELECTRICAL &APPLIANCES(Potchefstroom area)
Vir billike tariewe enspoedige diens skakel
Willie 072 292 5537
D92
Vinnigeprofessionele enbetroubare diens!
Alle elektriesewerk
Geysers, stowe,yskaste.
Whirlpool &Speed Queen
RIAAN’SELECTRICAL& APPLIANCES
SkakelRiaan
082-681-7181
(PotchefStroom AreA)
Loodgieters /Plumbing
33
PIETMANPLUMBING* Alle loodgieters-
probleme* Installering van
Pre-paidwatermeters
* Uitreiking vanCOC sertifikate
* Gratis kwotasies* Ten volle
gekwalifiseerdeloodgieter
Skakel 082-496-8622/ 082-346-0066.(018) 297 0260
D2F
24/7
Gekwalifiseerdeloodgieter.Pyp en
lekkasie-sporing.Johan
083 328 0292Kantoor
018 294 8242VIR
BLITSVINNIGEKWALITEIT DIENSTEEN DIE BESTEPRYSE!!
JJWLOODGIETERS
ALLE LOODGIETERherstelwerk & installeringvan geysers. ( Gerhard
by 083-283-5700.
Call the PlumberWillem Hallaby(082-856-4287vir spoedige diens
JANNIEVAN GRAAFFLOODGIETERS
(018) 297 8168082 950 9633
AlgemeneDienste /
General Services
34
1DAGDIENSHERSTELWasmasjiene,Tuimeldroërs,
Stowe.* By u huis
* Geen uitroepkosteParys & FochvillePieter Bosch018 484 1118073 566 4927
c83
Herstel Speed Queen enWhirlpool wasmasjieneen tuimeldroërs by u
huis. ( 082 689 4248.
A A N D A G !!!Whirlpool services, herstel& diens alle outomatieseTop Loader, mikrogolf-oonde en tuimeldroërs.( Nick 082-825-0727.
ALLE HERSTELWERKin & om die huis. Boor-gate, besproeiing & druk-
pompe. Geen werk teklein. ( Gerhard by
083-283-5700.
19d
LEZMIN 1913CC T/A
XPANDA N.W.CK Reg. no. 2002/063528/23
Boomstraat 7,h/v Siddlestraat,KLERKSDORP
E-mail:[email protected]
Web:www.xpandanw.co.za* Tel: 018 462 6596* Faks: 018 462 1267Liza: 079 677 8235
Bianca: 083 294 0935André: 082 788 5616Xpanda Trellisdeure
Motorhuisdeure
Skylight
Voor
Daarna
Ons spesialiseer in:* Xpanda Trellisdeure* Motorhuisdeure enoproldeure
* Outomatisering van hekkeen deure
* Interkomstelsels* Elektriese omheinings* Roller Shutters* Blinders* Sonkappe (“Awnings”)* Houtvoudeure* Enige staalomheinings* diefwering* “Razor Spikes”* Storte* Skylight
Sien winkelvenstervir installeerder opdiens op naweke
STOOFDOKTER.Spesialiseer in herstelvan Defy stowe op u
perseel.( 082 812 8772.
5 Year written guarantee
D.I.Y. Kits also available
tel: (011) 674-3223 / 083-290-0642internet:www.mendabath.com
BATH ENAMELINGMEND A BATH
E92
Rommel-verwydering /
Refuse Removal
35
1. Algemene vervoer.Bourommel, huisvullis
en tuinvullis.( Pieter 082-950-8934
(Potch)
Plaagbeheer /Pest Control
37
WEEDCONTROL
SPECIALISTSPCO REG. P35308
JEAN082 802 4747
EUGENE083 443 9039
KANTOOR(018) 468-2128
INTELLIGENTPEST
CONTROL
DA5
Tuindienste /Garden Services
38
AFSAAG ENUITHAALVAN BOME• Afsaag en uithaal
van bome.• Skoonmaak vanindustriële- enwoonerwe.
• Aanplant van gras.VOERKRAALMIS• Gesiftemis vir“top dressing”beskikbaarR20 per sak
Skakel Johanalle ure
082-962-3125.
AFSAAG, SNOEIEN UITHAALVAN BOME!!
* Eenmaligeskoonmaak vantuine & leëpersele.
* Tuinrommelverwydering.
* Gratis kwotasies.
Skakel Kleinjan082-465-1699.
d16
BOME,BOME,BOMEVir verwydering vantuinafval, skoon-maak van erwe engeute, afsaag vantakke en bome,
algemene opknapvan tuine en ligtevervoerwerk.Skakel Lappies083 785 0333 of082 684 8982.
Vervoer &Berging /
Transport & Storage
39
J & HMEUBELVERVOER
* INPAK* STOOR
* VERSEKERING
Skakel onsvir ‘n gratiskwotasie:
(018) 290-6755of
083-637-7690(nood).
BA3
All removals 4 hireHyundai bakkie & 4mtrailer with driver (Nico [email protected]
8 Ton Trok te huur vir dievervoer van enige goedere,
bourommel, trekke ens.Maak ook persele skoon.(Arno 072-408-1692
MY PLACESELF STORAGE
Randfontein
Storage units:
R650 permonth.Safe and secure.
(011) 412-4247office hours or082 416 2048
EA8
J & HMEUBELVERVOERVir professionelevervoer en stoor.( (018) 290-6755.
NEEM KENNIS – TAKE NOTESpertyd vir advertensie
besprekings:STIPTELIK DINSDAE 10:00
Deadline for booking ofadvertisements:
PROMPTLY TUESDAY'S 10:00
16 Carletonville Herald 3 April 2015
Woonstelle te huur /Flats to let
84
DROOGTE’SVERVOERWIL U
VERHUIS?Benodig u ‘ntreklorrie enstoorgerieweteen billikepryse?
Skakel Droogtevir ‘n gratiskwotasie!
082-553-8226.
Swembaddens /Swimming Pools
41
Bou, herstel,ontwerp,
onderhou van alleswembaddens
& spa’s en vele meer.louwtjie naudè083 651 2637
Lenings /Loans
43
BRIDGINGCASH
while waitingfor
PENSION /PACKAGE
Payout(lumpsum only)(011) 394-6937
Sweis &Staalwerke /
Welding & Steelworks
49
DCE
KWALITEITSTAALWERKE.
Vir enige staal-werke, hekke& veiligheids-heinings, ens.
Gekwalifiseerdeambagsman.
Skakel Jan082 876 0809.
Vir die oprigtingvan palissades,diefwering,
veiligheidshekkeasook enige anderalgemenestaalwerk,
skakel Jaco(061 495 9425)of Gert
(082 313 4820)
vir beste pryse,gehalte produkteen uitmuntende
diens.
JORDAAN & SEUNSTAALWERKE
Alle masserings beskik-baar in enige area. (Zani079-025-8428 vir meer
inligting
Massering privaat endiskreet*. Slegs perafspraak* Potch.( 073-348-6246
Topklas! Massering met 'nverskil. VIP, stortgeriewe
08:15-20:00(073-900-0435 Potch
AlgemeenTe Koop /
General For Sale
52
Brand new thermorex ul-traviolet sterilizer. footspa
unused. Laminatedanatomical wall charts for
sale R900 for all.((018)-296-10574pm to 6pm only
f20
VEILING, VLOOI, MOTOR,PROMOSIE-MARKELKE SATERDAG
OM 09:00.BY DIE BOEREMARK,POTCH-INDUSTRIA.Skakel Die Afslaer:
082-800-7321
GELD
ANTIEKE MEUBELVEILINGWERKERSDAG
1 MEI 2015TYDENS MOTORSKOU
NIE PAASNAWEEK NIE
Navraag:082-334-1755,Potchefstroom
Ek koop Tsumebklippe.
In u stoor, lankweggebêre
Betaal kontant.
TSUMEBKLIPPE11
9F
Ons betaal
kOntantvir u OOrtOllige
artikelsskakel
(018) 294-5503 / 5Vinnige, vriendelikediens. Transaksies
vertroulik.
vlOOiMarkPAND + MEUBELS
h/v Kerk &du Plooystr. Potch
Gebruikte Canopiessowel as gebruikte ba-
gasie sleepwaens,koop aan vir kontant.( (018) 462-8993of 082-821-4245.
Te Koop Gevra /Wanted To Buy
53
Soek karavaan die prysevan R6 000 tot R7 000
Kontak my by(082-054-1234 asb
TV / ElektrieseToebehore / TV /
Electrical Appliances
59
MRSATELLITE TV- DSTV INSTALLEER- EXPLORA / OVHD- TV REPARASIES- SEIN INSTELLING- SuRROuND SOuND- WOONSTELBLOKKE- KRuISKYKINSTALLERINGS
- EXTRA VIEW
24/7FRANCOIS
072-434-2790Aandag: Since 1976
Tip Top TVDu Plooystraat 46
GastehuiseWoonstelblokkeTV-herstelwerkVerskuiwingsKlankstelselsDSTV / OVHD
Explora / STARSATExtra View
Skakel Andrè Vlok018 293 0277082 892 1315
Boeke / Versamel-items / Books /
Collectors Items
60
My boek "Die struggle- 'ngroot leuen." is
nou weer beskikbaar.((018)-264-2840.
Prys R100per eksemplaar,posvry. Skrywer
W.P. Prinsloo
Veevoer /Animals Feeds
63
ed9
GemaaldeGeelmeel (voer).
R125 /50kg.
Fochville omgewing.
082 853 2359.
Motors66
AAndAg !!!Ek koop graag u motor
/ bakkie vir kontant.doen ook verkope.
SkAkEl RAymondREinEckE
082 853 6752
KONTANTHoogste prysevir u gebruikteVOERTUIG OF
BAKKIE.Skakel Noshi by(018) 294-6169 of082-558-4000.
Koop voertuiein Lopende ofnie Lopende
toestand toten metr50 000.sKaKeL
079 498-3243
Ons KOOPskoonmotorsen bakkies virKONTANT.R10 000 –R80 000Pieter
076-278-5821.
106f
CARS & BAKKIESFOR CASH!!!
UNDER R250 000.GUARANTEED
BEST PRICES PAID.072-272-1988082-575-7531
Kontant dadelik vir joumotor/ bakkie/ trok in lo-pende toestand al dan nie.
Skakel/sms na(072-412-3107 alle ure
Bakkies67
Ons koopbakkies enmotors virKONTANT.Goeie pryse
word aangebied.Skakel:
072 126 7886
Dringend opsoek na enigemodel bakkie in lopendetoestand al dan nie. Ska-
kel/sms na(072-412-3107 alle ure
AlgemeenTe Huur /
General To Let
72
MEENTHUISTE HUUR:
GRIMBEECKPARK.3 X SLPK,
2 X BADKAMERSEN DUBBEL-MOTORHUIS.
HUUR:R7 000 P/M.
VERSKEIE SALETE HUUR BY
VYFHOEK PLOTTE.
VERSKEIEWOONSTELLEEN KAMERS IN
STUDENTE HUISEBESKIKBAAR.
SKAKELKANTOOR-URE(018) 293-0140
OF 082 929 9099.
11d4
WINS & BELEGGING,R9 500 p/m, 1 x 3 slpk,2 x 2 slpk, naby rivier,
Parys. R1.1 m. ( Agent079-509-6679.
Persele /Premises
83
KANTORETE HUUR IN
BAILLIEPARK.
Skakel inkantoorure
(018) 290-5018of
076-584-5768.
Netjiese kantoremet privaat kom-buis, toiletgerieween volop parkering
te huur inVan Riebeekstraat44 asook Malva-straat, Bailliepark.
WINKEL / KANTOORmet lugversorger (± 70m²)
te huur in Bailliepark.( 083-227-3117.
Woonstelle TeHuur /
Flats To Let
84
Bachelor flatfor rent withparking.
R2 500 p/m,w&l excluded.Single none
smoking personor student.No animal’s.Available
immediately.Wifi alsoavailable.R2 000 keydeposit.
For info call082 337 8030
2 SLPK W/STEL:Angela Hof @ R4 500p/m. 2 Slpk, Cle DuCap @ R4 510 p/m.2 Slpk, Majuba @R4 510 p/m. 2 Slpk,
Berma @ R4048 p/m.Verskeie studente ver-blyf. ( Lisa Brink by
Potch Eiendomme(018) 297-5506/7of 082-061-0184.
NuwevrystelliNg:
Sonvangerwooneenhede,Lifestyle Estate(toegang TuscanyRidge hoofhek).Ruim, modernewooneenhede
met hoë kwaliteitafwerking ingesogte buurtgeleë aan die
Noorde kant vanPotchefstroom.Ingeboude braaimet privaat patio,
optiesevesel internet,genoegsame
parkering. Lapa,gym, groot
ontspanningsareaen speelplek vir
kinders.
Potchefstroom:
Te huur
3 slaapkamers,2 badkamers:r7 500 p/m
(vanaf 15 Maart 2015)
2 slaapkamers,2 badkamers:r6 250 p/m
(vanaf 15 Maart 2015)
1 slaapkamers,1 badkamer:r4 900 p/m
(vanaf 30 Maart 2015)
soNvaNgerbied u
‘N idealehoë gehalte
leefstylteeN ‘N
bekostigbaretarief.
skakel lourens by(018) 771 2075
(kantoor)073 599 5999 (sel)[email protected]
1 SLAAPKAMERWOONSTEL
naby die Mall.Baie ruim ennetjies met baiekaste. Toe
sluit motorhuisen baie veilig.Verkieslik ‘n
werkende dame.Huur: R3 000per maand.
Sleuteldeposito:R3 000.Skakel
078-136-3774
M O O I V A L L E I :nuutgeboude 2 slpkgrondvloer woonstelgeleë in sekuriteits-kompleks. Oopplan
kombuis en sitk, volle-dige badk en veiligeparkering @ R3 800p/m. ( 079-511-6506.
2 Slpk, veilig, netjies, om-hein, R4 500pm alles
ingesl. Prepaid elek uitgesldep 3x R1 500, troeteldiere
welkom naby ML Fick.(082-552-3654
B A I L L I E P A R K :2 slpk woonstel @
R5 100 p/m.( 083-570-0037.
Persele / Premises83
Te Huur
Skakel083 235 0600
Netjiese 2 slpkrondawel. Kom-buis, woonvertreken badkamer.R3 000 p/m pluselektrisiteit
verbruik. Vyfhoeknaby Roots. Dade-lik beskikbaar.Geen troeteldiere.
WOONSTELLETE HUUR2 Slpk
studentewoonstelmet 2 afdakke,baie goeiesekuriteit en
loopafstand vanNWU.
Huur: R5 500 p/m.
2 x 2 Slpkgrondvloerwoonstelle inGoudstraat.
Goeie sekuriteiten baie privaat.
Huur: R4 000 p/m.
Skakel agent:Ellen 082 652 9404.
11d5
Aantreklike ruim bachelorw/stel @ R3 000 w/l inge-
sluit.(082-531-7210
B A I L L I E P A R K :2 slpk woonstel in gewil-
de kompleks met toe-gangsbeheer. Oopplankombuis en sitk, volle-dige badk, parkering vir
2 motors @ R5 100p/m. ( 082-885-9319.
Bachelor tuinwoonstel.Stil, privaat en veilig. Da-delik beskikbaar. R2 100p/m. ( 084-666-9889.
Bachelor w/stel te huurR1 800pm in Miederpark
Potchefstroom.Beskikbaar 1April.(074-996-9502
BULT: 3 slpk woonstel@ R5 580 p/m.( 082-888-2247.
C E N T R A L :3 bedroom flat to let
@ R4 460 p/m.( 079 511 6518.
Groot 2 Slaapkamer woon-stel te huur 1ste Mei, sen-traal, geen diere. ((018)-
294-4431082-452-3382
Luukse 2 slpk in TuscanyRidge sekurteits landgoed
R5 000pm.(Hans083-489-5365
M O O I V A L L E I :2 slpk woonstel@ R3 800 p/m.( 083-570-0037.
To let:Flat C/ville2Bedr,1Bathr,Lounge,
kitchen, garden ,braai areacontact Rawson Properties
((018)786-2424
Tuin Bach w/stel inCarletonville.Onder dak
parkering. R1 900 p/m w+lingesluit sleutel dep vanaf
1 Mei beskikbaar(072-743-8001
WOONSTEL TE HUUR.2 Groot slaapkamers +2 groot badkamers.
Ruim oopplan kombuis,eetkamer en sitkamer,154 vierkante meter.
Huur: R5 000 p/m + de-posito. ( 076-373-9077.
Woonstelle TeKoop /
Flats For Sale
85
Geen agenteasseblief. Ruim,netjies en skoon 3slpk, 2 badk,kombuis en
opwas. Ruim sit eneetkamer aaneen.Balkon vir ontspanen klere ophangaan kante. 1 Ruimm/huis. Siersteengebou. Gesonderegsbestuur,trustees en
trustrekening.R690 000 ohb.
WOONSTELTE KOOP
Skakel082 709 4318
Meenthuise TeHuur /
Townhouses To Let
86
BERN RICH PARK3 X SLAAPKAMERS.
KOOPKRAG.HUUR: R4 100PER MAAND.
DEPOSITO: R4 100.
EEN SLAAPKAMERKOOPKRAG.
HUUR: R2 500 PERMAAND.
DEPOSITO: R2 500.
BACHELORKOOPKRAG.
HUUR: R2 000 PERMAAND.
DEPOSITO: R2 000.
SKAKEL(018) 294-4306
11d6
MEENTHUISTE HUUR
3 Slpk, 2 badkmeenthuis in
kompleks met 'nklein tuintjie.
Huur:R6 500 p/m.Skakel agent:
Ellen 082 652 9404
2 Slpk meenthuis te huurArendstraat 12Grimbeeckpark(083-258-5921
TE HUUR FOCHVILLE2 SLPKWOONSTELLE R3,5372 SLPK MEENTHUIS W/STEL R3,5373 SLPKWOONSTEL R4,1323 SLPK MEENTHUIS W/STELR4,337
KOOS 072 187 2748
Te HuurKantore N12
680m² in aanbou.Voltooi 1 Mei 2015Verkieslik vir 1 / 2 groot
ondernemings
Insette van huurder kan nounog gedoen word.
Luuks. Verdieping, 2 vloere
Skakel rolene082 859 6209
Wil u inhierdie spasieadverteer?
Skakel Carolina(Potchef-stroom) by
(018) 293-0750of Liz (Carle-tonville) by
(018) 788-6693
nuut, veilig, ruim, baienetjiese, 1 slpk w/stelin erf by woonhuis.Omhein met onder-dakparkering. Eietuingedeelte, geteël,stoof, kaste, ADSL-
lyn. R3 800 p/m, wateringesluit. Koopkrag.Verkies senior studentof werkende enkelper-soon wat nie rook ofdrink nie. Onmiddellik
beskikbaar.Skakel Dalene
083 3796 032
POTCHSENTRAAL:
3 April 2015 Carletonville Herald 17
2 X SLAAPKAMERS.KOOPKRAG.HUUR:R3 900PER MAAND.DEPOSITO:R3 900.SKAKEL
(018) 294-4306
VASCOVILLA
3 SLPK, 2½ BADK,oopplan leefarea, grootkombuis, aparte opwasen spens. Netjies geboumet graniet afwerkings.
2 x Motorafdakke. R7 700p/m, w&l en alarmstelselingesluit. Geen troetel-diere word toegelaat.( 082-904-5898.
Bailliepark: Oopplan kom-buis en woonvertrek, 2
badk, 3 slpk, toesluit mo-torhuis en koop krag. R6
400pm + dep.( Eienaar 082-371-6305
FOCHVILLE: 2 SLPKmeenthuis, 1 badk metbad, 1 toesluit motor-huis, eie tuin. Koop-krag. Water ingesluit.
R3 950 p/m.( 083-5700-037 of
083-410-0188.
GRIMBEEKPARK:3 slpk meenthuis tehuur @ R7 250 p/m.( 074-241-9577.
Huise Te Huur /Houses To Let
88
11ce
HUIS TE HUUR.Kanonnierspark.GROOT 3 slpkmet aparte sitk,woonk, eetk en
studk.D/geriewe,2 x afstand-beheerde
motorhuise en2 x afdakke.Volledige
1 slpk woonstel.Beskikbaar1 Mei.
R7 950 p/m.Skakel
083 628 2220.
Ruim 3 slaapkamerhuis tehuur. Swembad en
alarmstelsel. Eienaar bly inwoonstel op erf. Suiddorp.
Beskikbaar 1 MeiR6 500pm.
(072-456-9832
S E N T R A A L :3 slpk huis met
groot erf@ R8 500 p/m.
( 082-885-9320.
Groot dubbelverdiepingwoonhuis met3 slaapkamers,3 badkamers,
3 motorhuise en grooterf. Swembad en braai-
area. Tuindiensteingesluit.
R13 900 p/m.Vanaf 1 April 2015.( 082 441 2323.
HUISMET2WOONSTELLE
TE HUUROF TE KOOP1.5 KM VANUNIVERSITEIT(018) 786 1728082 446 4888
11c6
MIEDERPARK3 Slaapkamerhuis te huur metenkelgeriewe en ‘nenkelmotorhuis.
Huur:
R6 500 p/m.Nuut oorgedoen.Beskikbaar1 Maart 2015.
Skakel
083 263 4982
Miederpark:3 Bedroom house
2 bathrooms, lounge,dinningroom. 1 Bedroomflat, lappa, jacuzzi, double
garage for 4 vehiclesR7 950pm.
(060-384-2430074-095-9020
PRIVAATVERHURING.3 X Nuutge-boude woon-huise te huur.Elk met
4 slaapkamers,2 motorhuiseen 'n swembad.Onmiddellikbeskikbaar.Skakel Koos082-855-4512
of virMarietjie
082-621-7530vir verdereinligting ofnavrae.
11db
Huise Te Koop /Houses For Sale
89
BULT.R945 000Lieflike
noordfrontwoning met
ruimleefvertrekke.Lapa metbraai.Dubbel-motorhuis.
Skakel Johan083 625 7437.
11dc
HUISMET2WOONSTELLE
TE HUUROF TE KOOP1.5 KM VANUNIVERSITEIT(018) 786 1728082 446 4888
11c6
R680 000. 4 Slpk, 2 badk,3 toilette, kombuis, eet &sitkamer + lapa en 2 slpkwoonstel + toilet & stort.
---------------------
WOONHUISTE KOOP:R520 000. 3 Slpk, 3 toilette,eet + sitkamer, buitegeboue
+ Alg. Handelaar.40 jaar in familie.
Skakel Nick082-353-5554
VENTERSDORPWOONHUISTE KOOP:
Hoewes & Plase TeKoop / Smalls Holdings
& Farms For Sale
91
Smallholding for salehouse recently renovated
R680 000 (Susan072-113-2245
BAIE GROOT KAMERmet eie badk & ingang.Veilig, stil & privaat.
R2 100 p/m.(084-666-9889.
Kamers te huur ten vollegemeubileerd, swembad +Dstv. Ontbyt + aandete
enkel R3 000pm,dubbel R5 000pm.
( Elize 082-300-2235
Gastehuise /Guest-Houses
94
ROB’S PLACEPOTCHEFSTROOM* Fully furnished rooms.* Daily / weekly /monthly.* Self catering function
venue.071-607-0099 or [email protected]
d17
Vakansie Akkom-modasie / Vacation
Accommodation
95
M A R I N AS T R A N D
/ U V O N G O.Vanaf 10 nagte vir
R3 000, buite seisoen.( 082-920-4063
Weeksdae 08:30 tot15:00 of epos na
Betrekkings /Vacancies
98
10 Agents 2 ManagersFuneral Policies very high
comm full training .Contact Rupert(082-737-1954
AGENTE GESOEKVIR GEVESTIGDEverhuringsagentskap.
Basiese salaris: R3 000p/m. Moet oor eie vervoeren selfoon beskik. Moetonmiddellik diens aan-
vaar. E-pos CV [email protected].
Drywer benodig met kode14 & vorige insleep onder-
vinding, salarisondehandekbaar.(083-639-6048
Werksoekers: Registreerby ons en word oorweegvir vele poste. ( (018)
294-4664. Oryx.
KennisgewingDit is die verantwoordelikheid
van die Adverteerder om sekerte maak dat sy advertensiekorrek is op die eerste dag
van publikasie en geplaas isvolgens sy/haar instruksiesen dat alle foute gekorrigeeris voor die volgende uitgawe.Mooivaal Media neem geenverantwoordelikheid vir meeras een foutiewe plasing nie.
(018) 293 0750 /(018) 788 6693
Fax CV’s to011 753-1084
An engineering company inWestonaria requires handymanMust have building, plumbing,
carpentry experienceMinimum 10 years experience
Valid driver’s licence
18 Carletonville Herald 3 April 2015
gearadvertising-1709B
CHIEFDIRECTOR: FINANCEANDFACILITIES
ELECTRICALANDELECTRONIC SERVICES
JUNIOR TECHNICIAN(ELECTRONICMAINTENANCE) (PC08973)
Minimum requirements: Grade 12 or an equivalent qualification with Electronics as a subject and higher than a 60% A valid driver's licence One year'sexperience in soldering andwith power tools One year's experience ofworkingwith cables and couplings One year's experience of electronic components Oneyear's experience in TCP/IP protocol and its application N4 in Electronics (a 60%average) as a recommendation.
Enquiries:MrAlbert Pienaar, 018 299 4116.
JUNIOR TECHNICIAN (ELECTRONIC INSTALLATIONS) (PC08972)
Minimum requirements: Grade 12 or an equivalent qualification Subjects in Electronics, preferably Industrial Electronics at NQF level 4 with proof of relevantexperience Approximately one year's experience in a comparable work environment with manual, electric and power tools, and interpretation and execution ofsite planswith regard to electronic systems Experience in TCP/IP protocol and its application A valid driver's licence.
Enquiries:Mr Tinus Steenkamp, 018 299 4113.
Closingdate: 10April 2015 Commencement of duties: 1May 2015.Benefits:Attractive study benefits aswell as the normal fringe benefits apply.For Application Forms: Contact the Human Capital Department at tel. 018 299 4961, or send an email to . Application forms are [email protected] at Room G25 or G27, C1 Building, Institutional Office. Completed application forms must either be handed in at the Human Capital Department on thecampuses as specified on the application form, or sent via email to [email protected], or faxed to 018 293 5308.The University subscribes to and applies the principles of the Employment Equity Act and is committed to transformation. All applications will be processed in terms of the Protection ofPersonal InformationAct.
HOOFDIREKTEUR: FINANSIES EN FASILITEITE
ELEKTRIESE ENELEKTRONIESEDIENSTE
JUNIOR TEGNIKUS (ELEKTRONIES INSTANDHOUDING) (PC08973)
Minimum vereistes: Graad 12 of 'n gelykwaardige kwalifikasie met Elektronika as vak en slaagsyfer van hoër as 60% 'n Geldige rybewys Een jaar ervaring insoldeerwerk en met kraggereedskap Een jaar ervaring van werk met kabels en koppelstukke Een jaar ervaring van elektroniese komponente Een jaar ervaringvan TCP-/IP-protokol en die toepassing daarvan N4 in Elektronika ('n 60%-slaagsyfer) as aanbeveling.
Navrae:MnrAlbert Pienaar, 018 299 4116.
JUNIOR TEGNIKUS (ELEKTRONIES INSTALLASIES) (PC08972)
Minimumvereistes: Graad 12 of 'n gelykwaardige kwalifikasie Vakke in Elektronika en verkieslik Industriële Elektronika opNQF-vlak 4,met bewys van relevanteervaring Ongeveer een jaar ervaring in 'n vergelykbarewerksomgewingmet hand-, elektriese en kraggereedskap, en interpretasie en uitvoering van terreinplanneten opsigte van elektroniese stelsels Ervaring in TCP/IP-protokol en die toepassing daarvan 'n Geldige rybewys.
Navrae:Mnr Tinus Steenkamp, 018 299 4113.
Sluitingsdatum: 10April 2015 . Diensaanvaarding: 1Mei 2015.Voordele:Aantreklike studievoordele sowel as die normale byvoordele geld.Vir Aansoekvorms: Kontak die DepartementMensekapitaal by tel. 018 299 4961, of stuur 'n e-pos aan [email protected]. Aansoekvorms is ook by kamer G25of G27, C1-gebou, Institusionele Kantoor beskikbaar. Voltooide aansoekvormsmoet óf by die DepartementMensekapitaal op die kampusse ingehandigword soosopdie aansoekvormgespesifiseerword, óf per e-pos gestuurword aan [email protected], óf aan 018 293 5308gefaksword.Die Universiteit onderskryf en pas die beginsels van die Wet op Gelyke Indiensneming toe en is verbind tot transformasie. Alle aansoeke sal ingevolge die Wet op die Beskerming vanPersoonlike Inligting geprosesseerword.
POTCHEFSTROOM CAMPUS / POTCHEFSTROOMKAMPUS
ALGEMENE PLAASVOORMAN /INSTANDHOUDINGSVOORMAN
BERTS BRICKS,POTCHEFSTROOM
Pligte sal die volgende insluit:* Verantwoordelik vir kleinbeesboerdery(ongeveer 100 beeste),
* Verantwoordelik vir die aanplant vanvoergewasse,
* Algemene instandhouding van plaas /plaasimplemente/eiendomme* Nutsmanwerk,* Bestuur van werkers
Vereistes vir die posisie:* Kennis en ervaring van basiese plaaswerk enbeeste,* Kennis en ervaring in onderhoudswerk.
Voordele van die posisie:* Pensioen en Mediese fonds* Moontlike verblyf opsie beskikbaar,* Mark verwante salaris pakket
Om aansoek te doen vir bogenoemde pos:Faks jou CV na (018) 292 1993 ofE-mail na [email protected]
Vir meer besonderhede kontak dieHR Departement op (018) 292 1615
REMOTE SUPPORT TECHNICIAN– POTCHEFSTROOM (RST2015B)
dELIVER TECHNICAL SERVICES ANd SOLUTIONSTO CUSTOMERS THROUGH PROBLEM dIAGNOSESANd SERVICE WITHIN EXPECTEd TIME FRAME.
CANdIdATE MUST HAVE GOOd KNOWLEdGE OFCOMPUTER & LAPTOP TROUBLESHOOTING & RE-PAIR, dIAGNOSTIC TOOLS, SOFTWARE & HARd-WARE SUPPORT, MUST BE ABLE TO WORK IN AVERYdEMANdING ENVIRONMENTMUST HAVE EX-CELLENT COMMUNICATION & CUSTOMER SERVICESKILLS.
PREREQUISITES: GRAdE 12; COMPTIA A+ & N+,dRIVER’S LICENSE, MCSE/MCITP WOULd BE Ad-VANTAGEOUS, MINIMUM 2 - 3 YEARS TECHNICALEXPERIENCE,
GOOd PROSPECTS, BENEFITS ANd OPPORTUNITYFOR GROWTH, TRAINING ANd CERTIFICATIONWITHIN LARGEST IT COMPANY IN NORTHWEST. BLUETEK IS AT THE FOREFRONT OF TECH-NOLOGY ANd OFFERS THE SUCCESSFUL CANdI-dATE GREAT EXPOSURE TO VARIOUSTECHNOLOGIES ANd MARKETS WITHIN A CHAL-LENGING ENVIRONMENT.
Applications close on 10 April 2015. Please indicate ab-breviation of job you’re applying for. Email application [email protected] or fax to 086 584 3110. Should you notbe contacted by us within 30 days, please assume that
your application has not been successful.
JUNIOR ADMINISTRATIEWESKAKELBEAMPTE
Ons firma, ‘n leier op ons gebied, is opsoek na ‘ndinamiese persoon wat binne ons omgewing
kan floreer.
Hierdie Administratiewe Skakelbeampte posvereis die volgende vaardighede:
• Tweetalig en woonagtig in Potchefstroom• Ten volle rekenaarvaardig en goeie telefoonetiket
• Begrip vir Administratiewe prosesse en struktuur• Goeie mense verhoudinge en vriendelik• Professionele koordinering• Netjiese en deeglike beplanning• Minimum Matriek• Agtergrond in versekeringsbedryf voordelig• Eie vervoer
Hierdie pos is ONMIDDELLIK beskikbaar enindien jy belangstel of dink dat die pos vir jouis, stuur jou CV na [email protected]
Suksesvolle kandidate sal binne 72 uurgekontak word vir ‘n onderhoud.
BUYERLeading FMCG company requires a Buyer
in Potchefstroom. 6 Months contract
Requirements:• Qualifications: Matric, Qualification inPurchasing or Buying• Experience: 5 Years solid experience inbuying especially from an engineeringbackground, purchasing of spares, doingrecons, excellent negotiation skills, ability todeliver on time, able to work under pressure,good communications skills etc.• High levels of computer literacy
Salary: NegotiableClosing Date: 7 April 2015
Send your CV to: Fax: 018 294 8521 orE mail: [email protected]
MANAGERSAVF VENTERSDORP OLD AGE HOME
Minimum requirements:• Grade 12• Recognised qualification in Nursing/Human Science /Management Science will serve as a recommendation
• Knowledge of old age care/ latest development in thewelfare industry• Bilingual
Duties:• Effective management of the Old Age home• Initiating of fundraising• Marketing of the Old Age Home• All other generic management duties
Salary: According to SAVF salary scalesStarting date: As soon as possibleClosing date: 2 April 2015Enquiries and application to:The Regional Manager: Mrs M TrollipFaks/Fax: 086 630 4279E-pos/E-mail: [email protected]
3 April 2015 Carletonville Herald 19
FACULTYOFHEALTH SCIENCES
RIIP/CENQAM
SUBJECT SPECIALIST (PC09265)
Minimum requirements: ADiploma in Analytical Chemistry/BPharm degree/BSc degree in a relevant discipline At least three years experience in HPLC analysesin a pharmaceutical QC laboratory, at least three years' experience in pharmaceutical analytical processes (five years in case of a diploma).
Closingdate: 10April 2015 Commencement of duties: 1May 2015.Enquiries:Dr Erna Swanepoel, 018 299 2325.Benefits:Attractive study benefits aswell as the normal fringe benefits apply.For Application Forms: Contact the Human Capital Department at tel. 018 299 4961, or send an email to [email protected]. Application forms are alsoavailable at Room G25 or G27, C1 Building, Institutional Office. Completed application forms must either be handed in at the Human Capital Department on thecampuses as specified on the application form, or sent via email to [email protected], or faxed to 018 293 5308.The University subscribes to and applies the principles of the Employment Equity Act and is committed to transformation. All applications will be processed in terms of the Protection ofPersonal InformationAct.
FAKULTEITGESONDHEIDSWETENSKAPPE
NIIF/CENQAM
VAKKUNDIGE (PC09265)
Minimumvereistes: 'n Diploma in Analitiese Chemie, of 'n BPharm-graad, of 'n BSc-graad in 'n verwante dissipline Ten minste drie jaar ervaring in HPLC-ontledings in 'n farmaseutiese gehaltebeheer-laboratorium, tenminste drie jaar ervaring in farmaseutiese analitiese prosesse (vyf jaar in geval van 'n diploma).
Sluitingsdatum: 10April 2015 . Diensaanvaarding: 1Mei 2015.Navrae:Dr. Erna Swanepoel, 018 299 2325.Voordele:Aantreklike studievoordele sowel as die normale byvoordele geld.Vir Aansoekvorms: Kontak die DepartementMensekapitaal by tel. 018 299 4961, of stuur 'n e-pos aan [email protected]. Aansoekvorms is ook by kamer G25of G27, C1-gebou, Institusionele Kantoor beskikbaar. Voltooide aansoekvormsmoet óf by die DepartementMensekapitaal op die kampusse ingehandigword soosopdie aansoekvormgespesifiseerword, óf per e-pos gestuurword aan [email protected], óf aan 018 293 5308gefaksword.Die Universiteit onderskryf en pas die beginsels van die Wet op Gelyke Indiensneming toe en is verbind tot transformasie. Alle aansoeke sal ingevolge die Wet op die Beskerming vanPersoonlike Inligting geprosesseerword.
POTCHEFSTROOM CAMPUS / POTCHEFSTROOMKAMPUS
gearadvertising-1709A
FULL TIMEEMPLOYMENT OFFERED
Are you young, energetic,motivated and know your sports?
A sports betting company isopening a new upmarket shop inPotchefstroom in April 2015.
We are looking for matriculated,computer experienced cashiers whomust be well presented and be ableto work with customers. You must
be honest and reliable.Reference check (education, ITCand criminal) will be conducted.
Send your CV [email protected], cnr. James Moroka Ave& Rivier Street, Potchefstroom.
[1]Benodig:
C – GRAAD REAKSIE BEAMPTESmet
Geldige bestuurslisensie • Reaksie SertifikaatWapen Bevoegdheid Sertifikaat
&Kontakbare werksverwysings
[2]
BEMARKERSMet eie vervoer en Kontakbare verwysings.
Opleiding sal verskaf word.Handig CV in by CSS Kantoor
HV Du Plooy en Peter MokabastraatSkakel: ( 018)-293 1582.
TangleWood Nature Estate is looking for a
CAMPSITE MANAGER.Young young dynamic person to manage newcampsite at Boskop Dam, Potchefstroom.
* Position will require weekend & holiday work.* Own vehicle & drivers license essential.* Computer literate, self motivated and have highwork ethics.
* Good communication skills, team player andadaptable.
* Professional/presentable to clients
Background check will be done.
Send CV's [email protected]
VACANCY FOR DRIVER• Code 10 with public licence
• Haschem training a recommendationPlease e-mail CV’s to
[email protected] bring CV’s to Gas World
Burger & Vorster Inc.Vakante betrekking beskikbaar vir
SAIPA Klerkskap.
Geskikte kandidate moet beskik
oor ‘n B.Com
Rekeningkunde graad.
CV kan gestuur word na
of faks na 086 684 4705.
Vir enige navrae kontak
(018) 294-4854
Ek lei talentvolle mense op om te groeivir hoër dienste in ons gemeenskap.
Poste vir dIEREVERPLEEG-ASSISTENT en VERKOOPSdAMES,
asook ‘n VOORRAAdKLERK.Matriek met Wiskunde en Wetenskap
en ‘n bestuurslisensie.Werk 40 uur per week tot 18:00en 10 ure elke 2de naweek.
CENTRAAL VEEARTSEEN PET HEALTH FOOD
CV’s na Retiefstraat 22,Potchefstroom.
Requirements:• Previous experience as a Broiler farm Manager• Must be prepared to relocate to the farm• Must be able to do basic handyman work• Must be self motivated
Salary negotiable subject to qualificationsand experience.
Email CV’S [email protected] Fax to 086 750 2649.
BROILER FARM MANAGER
KennisgewingDit is die verantwoordelikheid van die Adverteerder om seker te maak dat syadvertensie korrek is op die eerste dag van publikasie en geplaas is volgenssy/haar instruksies en dat alle foute gekorrigeer is voor die volgende uitgawe.Mooivaal Media neem geen verantwoordelikheid vir meer as een foutiewe
plasing nie. (018) 293 0750 / (018) 788 6693
20 Carletonville Herald 3 April 2015
KENNISGEWINGS • NOTICES
KENNISGEWINGS • NOTICES
NOTICE OF APPLICATION FOR APROSPECTING RIGHT
Notice is given in terms of Sections 16 of the MineralPetroleum and Resources Development Act (Act 28 of2002) and Regulations 3, 14 and 51 of the regulationspublished in the Government Notice, GN R527. Thisnotice will also serve as a notice in terms of Regula-tion 4(6) of the National Environmental ManagementAct (Act 107 of 1998) of intent to carry out the follow-ing activity as listed:
1. Description of proposed activity:MI Chiboo Farming II (Pty) Ltd(2009 / 010046 / 07) applied for a prospectingright in terms of Sections 16 of the Mineral andPetroleum Resource Development Act, 2002(Act no. 28 of 2002) to prospect for DiamondsAlluvial, Manganese Ore, Iron Ore and Gold Oreon the following properties:
(a) Remaining extent of portion 1 of the farmDigby Plain 63 IQExtent: 527.4974 hectaresHeld under title deed T60660/2014Magisterial district of Ventersdorp
(b) Remaining extent of the farm PrestonPans 59 IQExtent: 933.4614 hectaresHeld under title deed T60660/2014Magisterial district of Ventersdorp.
2. Location:The properties are located 17km north west ofCarletonville and 44km east of Ventersdorp in theNorth West Province.
3. Extent:1460.958 hectares
4. Name of applicant:MI Chiboo Farming II (Pty) Ltd(2009 / 010046 / 07)
5. Name and details of contact person:(a) Consultant: Milnex 189 CC
Attention: Riaan du PlessisPO Box 1086Schweizer-Reneke2780Tel: 053 963 1081Fax: 087 231 7021E-mail: [email protected]
6. Date of publication:2 April 2015
7. Date of public meeting:16 April 2015 at 11:00. Venue: Farm house on thefarm Preston Pans 59 IQ, Ventersdorp, 2710.
8. Submission of written comments:The purpose of the notice is mainly to invite allinterested and affected parties to submit writtencomments and/or objections regarding theapplication for a Prospecting Right and theapplication for approval of the EnvironmentalManagement Plan.
9. Documents and informationAny documents or information you mayrequire including the Environmental Manage-ment Plan to formulate your comments orobjections may be requested in writing from thecontact person.
10. Registration as Interested and Affected PartyIn order to ensure that you are identified as aninterested and/or affected party(IAP) and thatwe receive your comments, please submit yourname, contact information, interest and comments or objections that you may have in thematter, to the contact person within 30 days ofpublication of this advertisement.
..................................................................................... P076
KENNISGEWINGS • NOTICES
KENNISGEWINGS • NOTICES
N O T I C EENVIRONMENTAL IMPACT ASSESSMENT
APPLICATIONNotice is given, in terms of the EIA regulations published inGovernment Notice No. R982 under Section 24(5) and 44 ofthe National Environmental ManagementAct (Act No. 107 of1998), of the intent to carry out a Scoping & EnvironmentalImpact Report process (i.t.o. Listing Notice 2 – G.N. R984)for the following activity:
• Project title: The proposed Ikageng Extension 13 on a Por-tion of Portion 2 of the Remainder of Town and Townlandsof Potchefstroom 435, Registration division IQ, NorthWest.
• Project description: The proposed township establishmentwill result in the clearance of more than 20 hectares ofindigenous vegetation. The site is located adjacent to andeast of Ikageng Extension 7.
• Size of site: The site comprises a green-fields area of~35 hectares.
• Proponent: Tlokwe City Council• Consultant: Carli Steenkamp
Environamics Environmental ConsultantsTel: 018 299 1523Fax: 086 762 8336Cell: 082 220 8651E-mail: [email protected] Address: PO Box 6484, Baillie Park,
2526
The Environmental Impact Assessment application was sub-mitted to the National department of Environmental Affairson 2 April 2015. In order to obtain further information or toregister as an interested and/or affected party please submityour name, contact information and interest in the matter, inwriting, to the contact person given above within 30 days ofthis advertisement...........................................................................................P079
KENNISGEWINGS • NOTICES
KENNISGEWINGS • NOTICES
K E N N I S G EW I N GPOTCHEFSTROOM
DORPBEPLANNINGSKEMA, 1980
KENNIS GESKIEd HIERMEE ingevolge artikel 14(a)van die Potchefstroom dorpsbeplanningskema, 1980 datek, Andries Odendaal [namens die firma Smit and FisherPlanning (Edms) Bpk] van voorneme is om by die TLOK-WE STAdSRAAd aansoek te doen om toestemming totdie gebruik van die Restant van Gedeelte 31 van die PlaasTown and Townlands of Potchefstroom No. 435-IQ, geleëin Kruisstraat (die eiendom is ‘Onderrig met Bylae 542’gesoneer) vir die oprigting van ‘n sellulêre telefoon masen beheerstasie.
Besware teen of vertoë ten opsigte van hierdie aansoek,tesame met die redes daarvoor, moet binne 21 dae na pub-likasie van die laaste advertensie in die pers, skriftelik bydie Munisipale Bestuurder, Posbus 113, Potchefstroom,2520 en die aansoeker, in skrif ingedien word.
Besonderhede van die voorgenome aansoek lê ter insae bydie aansoeker by sy ondergenoemde adres:
NAAM: Smit and Fisher Planning (Edms) BpkAdRES: Melkstraat 371, Pretoria, 0181TELEFOONNOMMER: 012 346 2340POSAdRES: Posbus 908, Groenkloof, 0027
dATUM VAN EERSTE PUBLIKASIE: 03 April 2015dATUM VAN TWEEdE PUBLIKASIE: 10 April 2015
..................................................................................P078A
KENNISGEWINGS • NOTICES
KENNISGEWINGS • NOTICES
N O T I C EPOTCHEFSTROOM TOWNPLANNING SCHEME, 1980
NOTICE IS HEREBY GIVEN in terms of Section 14(a)of the Potchefstroom Town Planning Scheme, 1980 that I,Andries Odendaal [on behalf of the firm Smit and FisherPlanning (Pty) Ltd] intend to apply to the TLOKWE CITYCOUNCIL, for permission to use the Remaining Extent ofPortion 31 of the Farm Town and Townlands of Potchefst-room No. 435-IQ, situated in Kruis Street (the property iszoned ‘Educational with Annexure 542’) for the purposeof erecting a cellular telephone mast and base station.
Objections to or representations in respect of this applica-tion must be lodged, together with reasons, to the Munici-pal Manager, PO Box 113, Potchefstroom, 2520 and theapplicant, in writing within 21 days of the publication ofthe last advertisement in the press.
Particulars of the proposed application lie for inspection atthe applicant at his under mentioned address:
NAME: Smit and Fisher Planning (Pty) LtdADDRESS: 371 Melk Street, Pretoria, 0181TELEPHONE NUMBER: 012 346 2340POSTAL ADDRESS: P.O.Box 908, Groenkloof, 0027
DATE OF FIRST PUBLICATION: 03 April 2015DATE OF SECOND PUBLICATION: 10 April 2015
..................................................................................P078E
KENNISGEWINGS • NOTICES
KENNISGEWINGS • NOTICES
E S TA T E N O T I C E
FIRSTAND FINAL LIQUIDATIONAND DISTRIBU-TIONACCOUNT LYING FOR INSPECTION.In the estate of the late MANIE VANWYK, IDENTITYNUMBER 670303 5192 08 0, a businessman of 31 Har-wood Street, Promosa, Potchefstroom, married in commu-nity of property to Sarie van Wyk, ID NR 620113 0207 085. Estate Number: 1398/2010.
In terms of Section 35 (5) of Act 66 of 1965, notice ishereby given that copies of the first and final liquidationand distribution account in the above mentioned estate willbe open for inspection of all persons interested therein fora period of 21 days from the date of publication hereof, andat the offices of the Master of the High Court, PRETORIA,and the Magistrate’s office, POTCHEFSTROOM.
dE KOCKS PROKUREURS, 1st Floor, Jooste Building,Siddle Str 49, Klerksdorp, 2570. Telno. (018) 462-3504.Ref: S VOGEL/BdL094/O01372
.....................................................................................P077
REGSKENNISGEWING INDEKS• Insolvente Boedels• Bestorwe Boedels(Debiteure & Krediteure)
• Bestorwe Boedels(Likwidasie- &Distribusierekeninge)
• Boedeloorgawes• Algemene Kennisgewings• Algemene Jaarvergaderings• Dorsbeplannings:(Hersonerings, Onderverdelings,Opheffing van Beperkings,Tweede Woonhuise,Besigheidsregte,Minerale Regte,Spesiale Toestemmings)
• OIS - Omgewingsimpakstudies /Advertensieborde
• Dorpstigtings• Dranklisensies• Egskeidings /
Huweliksvoorwaardekontrakte• Eksekusieverkopings• Hofbevele / Sekwestrasies• Pensioenfondse• Verkoop van Besighede• Verlore Dokumente• Tenders• Veilings
It’s a sign of respect to cover the dead.
What about the living?
Donate a blanket by SMSing “Blanket” to 42290 at a cost of R30.00
or dropping one off at any Ster Kinekor cinema.
108365
Hiermee wil ons graagal ons lesers inlig dat
alle Regskennisgewingsvoortaan in die regs-
afdeling gepubliseer salword.
Herewith we would liketo inform our readersthat all legal notices
will be published in thelegals department.
Regskennis-gewings
legalnotices
KennisgewingDit is die verantwoordelikheid
van die Adverteerder om sekerte maak dat sy advertensiekorrek is op die eerste dag
van publikasie en geplaas isvolgens sy/haar instruksiesen dat alle foute gekorrigeeris voor die volgende uitgawe.Mooivaal Media neem geenverantwoordelikheid vir meeras een foutiewe plasing nie.
(018) 293 0750 /(018) 788 6693
3 April 2015 Carletonville Herald 21
www.humanjobs.co.za Human Communications 117192
Sibanye Gold is committed to the achievement and maintenance of diversity and equity in employment.
Vacancies
Candidates must be declared medically fit for the position and theenvironment, as determined by the risk-based medical examination at therelevant Sibanye Gold Occupational Healthcare Centre. Pre-screening andpsychometric evaluation may form part of the selection process. Short-listed candidates will be requested to attend a panel interview. Applicantswho receive no response to their applications within 14 days may considertheir application for the position to be unsuccessful.
SIBANYE GOLD ACADEMY
SUPERINTENDENTS: ETD TECHNICALCOOKE OPERATIONSJOB GRADING: D-LOWERSECTION: MININGThe successful candidates must be in possession of a certificate or qualification in HRD/ETDManagement/Training at NQF5, Mine Overseer’s Certificate of Competency and at least 2 years’experience in ETD practices, competency assessment and evaluation practices. This must besupported by at least 2 years’ prior work experience on trackless mechanised mining operationsand at least 5 years’ experience in the mining discipline, 2 years at the level of Mine Overseer.Knowledge of trackless mechanised mining methods and equipment, operational performanceimprovement process and technique as well as the integrated outcomes-based MiningCurriculum and NQF developments is essential, along with the skills to manage the building ofportfolios of evidence and sound interpersonal and problem-solving skills. Further requirementsinclude good communication, presentation, consulting and facilitation skills, proficiency inMicrosoft Office and ability to do research, analyse, consolidate and report on data collected.
Duties and responsibilities include: • Administering and managing the Quality AssuranceSystem and processes • Establishing and maintaining sound Human Capital Developmentpractices, policies and systems • Managing cost, budget and effect of deviation • Establishing,monitoring and revising administration and report systems • Developing, implementing andmaintaining mining quality programmes • Providing HRD solutions according to identified clientneeds • Managing the deliverance of Mining Learnership Programmes • Managing miningworkplace assessments and quality assurance • Maintaining Health, Safety and Environmentalpractices within domain • Performing all duties and responsibilities related to this position.
SUPERINTENDENTS: ETD TECHNICALKLOOF OPERATIONSJOB GRADING: D-LOWERSECTION: MININGThe successful candidates must be in possession of a valid certificate or qualification in HRD/ETD Management/Training at NQF5, Mine Overseer’s Certificate of Competency and at least2 years’ experience in ETD practices, competency assessment and evaluation practices. Thismust be supported by at least 5 years’ experience in the mining discipline. Knowledge ofoperational performance improvement process and techniques, behavioural models and changeprocess, NQF and QCTO developments as well as the integrated outcomes-based MiningCurriculum is essential, along with the skills to manage the building of portfolios of evidence andsound interpersonal andproblem-solvingskills. Further requirements includegoodcommunication,presentation, consulting and facilitation skills, proficiency in Microsoft Office and ability to doresearch, analyse, consolidate and report on data collected.
Duties and responsibilities include: • Administering and managing the Quality AssuranceSystem and processes • Establishing and maintaining sound Human Capital Developmentpractices, policies and systems • Managing cost, budget and effect of deviation • Establishing,monitoring and revising administration and report systems • Developing, implementing andmaintaining mining quality programmes • Providing HRD solutions according to identified clientneeds • Managing the deliverance of Mining Learnership Programmes • Managing miningworkplace assessments and quality assurance • Maintaining Health, Safety and Environmentalpractices within domain • Performing all duties and responsibilities related to this position.
SUPERVISOR: ETD (ELECTRICAL)JOB GRADING: C-UPPERSECTION: ENGINEERINGApplicants must be in possession of a valid Section 13 Electrical Heavy Current Trade TestCertificate, valid N2 qualification, Assessor’s Certificate and relevant mine-ward (including plant)experience. Relevant experience in employee development, well-developed leadership,interpersonal, managerial and organisational skills are also required. Excellent consulting/facilitation and English communication skills are essential, along with sound knowledge ofelectronic circuitry, systems and operations, record keeping and filing systems, basic legal,safety, environmental and hazard identification. Computer literacy in Microsoft Office andknowledge of information systems are imperative. An Engineering Supervisor’s Certificate, ETDPractitioner’s Certificate Level 4 and Skills Moderator's Certificate would be advantageous, aswould sound knowledge of Medium-Voltage Systems and practical understanding of SAQA,QCTO, MQA, SGA training policies, procedures and systems.
Duties and responsibilities include: • Presenting relevant electrical training interventions• Liaising with internal customers to determine internal needs and relevant best practices• Perform follow up audits to ensure effective implementation of training • Providing skills andknowledge training at the operations that support core processes as required • Ensuring fullcompliance with the relevant acts, standards and regulations by equipping learners with thenecessary knowledge, skills and competencies.
SUPERVISOR: ETD (INSTRUMENTATION)SECTION: ENGINEERINGJOB GRADING: C-UPPERThe minimum requirements for this position are a valid Section 13 Electrical/Instrumentation -Mechanician Trade Test Certificate, valid N6 Certificate in Electronics and Instrumentation and anAssessor’s Certificate. This must be supported by relevant mine-wide (including Plant) andemployee development experience. This role demands working knowledge of PLCs, SCADA,Wonderware, process flow and plant systems, winder controls and systems and networks as wellas an understanding of telemetry and telephone systems. Well-developed leadership,interpersonal, managerial and organisational skills and excellent consulting/facilitation andEnglish communication skills are essential, along with sound knowledge or record-keeping andfiling systems, basic legal, safety, environmental and hazard identification. He/she must becomputer literate in Microsoft Office and have knowledge of management information systems.An Engineering Supervisor Certificate, S4 Technikon light and/or heavy current and SkillsModerator’s Certificate would be advantageous. Sound knowledge of Medium-voltage Systemsand practical understanding of SAQA, QCTO, MQA, SGA training policies, procedures andsystems will also be to the candidate’s advantage.
Duties and responsibilities include: • Presenting relevant instrumentation training interventions• Liaising with internal customers to determine internal needs and relevant best practices• Performing follow up audits to ensure effective implementation of training • Providing skills andknowledge training at the operations that support core processes as required • Ensuring fullcompliance with the relevant acts, standards and regulations by equipping learners with thenecessary knowledge, skills and competencies.
SUPERVISOR: ETD (LEARNERSHIP)JOB GRADING: C-UPPERSECTION: ENGINEERINGCandidates must hold a valid Section 13 Trade Test Certificate, a valid N3 qualification, ETDPractitioner’s Certificate Level 3 and an Assessor’s Certificate. Further requirements includerelevant mine-wide (including Plant) and employee development experience, well-developedleadership, interpersonal, managerial and organisational skills as well as practical knowledge and
understanding to administer MQA, CETA and Sibanye Gold information systems. Practicalunderstanding of SAQA, QCTO, MQA, CETA, SGA training policies and procedures, excellentconsulting/facilitation and English communication skills and computer literacy in Microsoft Officeare essential, as is sound knowledge of record-keeping and filing systems, basic legal, safety,environmental as well as hazard identification. An Engineering Supervisor’s Certificate, ETDPractitioner`s Certificate Level 4 and a Skills Moderator’s Certificate would be advantageous.
Duties and responsibilities include: • Liaising with SETA on learners matters • Administerregistration, uploading of relevant data, scheduling trade test and other relevant processes• Planning and organising learners programmes and phases towards trade test • Managing record-keeping and filing system pertaining to Learnerships • Liaising with internal and external customersto determine internal needs and relevant best practices • Performing follow-up audits to ensureeffective implementation of Learnership processes • Ensuring full compliance with the relevantacts, standards and regulations by equipping learners with the necessary knowledge and skills
SUPERVISOR: ETD (FITTING)JOB GRADING: C-UPPERSECTION: ENGINEERINGThe successful candidate needs a valid Section 13 Fitting Trade Test Certificate, valid N2qualification, Assessor’s Certificate and relevant 5 years’ mine-wide (including Plant and DieselMachinery) experience. He/she must also have relevant experience in employee developmentand possess well-developed leadership, interpersonal, managerial and organisational skills.Excellent consulting/facilitation and English communication skills, sound knowledge of fitting,machining, hydraulic system and diesel machinery, computer literacy in Microsoft Office andknowledge of information systems are essential. Sound knowledge of record- keeping and filingsystems, basic legal, safety, environmental and hazard identification is vital. A Skills Moderator’sCertificate and practical understanding of SAQA, QCTO, MQA, SGA training policies, proceduresand systems would be advantageous, as would an Engineering Supervisor’s Certificate, valid N3qualification and ETD Practitioner’s Certificate Level 4.
Duties and responsibilities include: • Presenting relevant electrical training interventions• Liaising with internal customers to determine internal needs and relevant best practices• Performing follow-up audits to ensure effective implementation of training • Providing skills andknowledge training at the operations that support core processes as required • Ensuring fullcompliance with the relevant acts, standards and regulations by equipping learners with thenecessary knowledge, skills and competencies.
SUPERVISOR: OPERATIONS (UNDERGROUND ON-THE-JOB TRAINING)BEATRIXJOB GRADING: C-UPPERSECTION: MININGIn this role, candidates need a certificate or qualification in HRD/ETD Management/Training atNQF4 and at least 5 years’ production experience in the mining discipline of which a minimum of2 years must have been at Supervisory level. Knowledge and understanding of operationalperformance improvement process and technique, behavioural models and change processes aswell as outcomes-based learning, NQF and QCTO developments is essential, along with soundinterpersonal and problem-solving skills. He/she must possess very strong English languagecommunication, presentation, consulting and facilitation skills and be computer literate inMicrosoft Office and Outlook applications. At least 2 years’ experience in ETD practices,competency assessment and evaluation practice and knowledge and understanding of trainingadministration and quality assurance systems and processes will be to the candidate’sadvantage, as would an Assessor Certificate and Moderator Certificate.
Duties and responsibilities include: • Evaluating workplace conditions and identifyingconstraints to optimal safe production • Evaluating employee skills application and identifyingtraining and/or development needs • Facilitating on-site learning delivery to address trainingneeds • Facilitating development and implementation of remedial action plans aimed atimproving workplace conditions, performance potential and applied skills • Facilitatingdevelopment and implementation of learning solutions aimed at addressing specified technicalneeds based training or new skills training • Supervising selection, placement and on-the-jobpractical development of mining learners • Implementing and maintaining Human ResourceDevelopment practice, policies and systems • Controlling training expenditure according toallocated budget • Supervising, monitoring and maintaining relevant learner administration andreport systems • Managing Mining Learnership workplace assessments and quality assurance• Maintaining Health & Safety environmental practices within the domain • All duties andresponsibilities related to this position.
SUPERVISOR: ETD (PLATER/WELDER)SECTION: ENGINEERINGJOB GRADING: C-UPPERThe successful candidate must be in possession of a valid Section 13 Plater/Welder Trade TestCertificate, valid N2 qualification, Assessor Certificate and relevant mine-wide (including Plant)and employee development experience. We seek an individual with well-developed leadership,interpersonal, managerial, organisational and customer orientation skills. Excellent consulting/facilitation and English communication skills, sound knowledge of Arc, Mig welding and Tigwelding, contour marking, drawings and development, record-keeping and filling systems, basiclegal, safety, environmental and hazard identification are essential. Computer literacy in MicrosoftOffice and knowledge of management information systems complete the profile sought. AnEngineering Supervisor Certificate and ETD Practitioner’s Certificate Level 4 would beadvantageous, along with a Skills Moderators Certificate and practical understanding of SAQA,QCTO, MQA, SGA training policies, procedures and systems.
Duties and responsibilities include: • Presenting relevant Plater/Welder training interventions• Liaising with internal customers to determine internal needs and relevant best practices• Performing follow-up audits to ensure effective implementation of training • Providing skills andknowledge training at the operations that support core processes as required • Ensuring fullcompliance with the relevant acts, standards and regulations by equipping learners with thenecessary knowledge, skills and competencies.
SUPERVISOR: ETD (SECURITY TRAINING)JOB GRADING: C-UPPERSECTION: SIBANYE GOLD PROTECTION SERVICESApplicants need a National Diploma in Security Management or a relevant training tertiaryqualification with at least 5 years’ supervisory experience in a training environment. He/she mustbe registered as a Security Officer Grade A with the Private Industry Regulatory Authority (PSIRA),or have the ability to obtain this registration within 3 months of appointment. Further requirementsinclude proven competency as a Skills Development Facilitator, Assessor and Moderator, soundknowledge of all applicable legislation, particularly the Skills Development Act, well-developedEnglish verbal and written communication skills, as well as good interpersonal and relationshipbuilding skills in order to liaise with all levels of staff. Computer literacy in Microsoft Office and avalid Code 08 (EB) driver’s licence are essential. ETD Practitioner Level 4 Certificate, SkillAssessor Certificate and Skill Moderator Certificate would be advantageous.
Key responsibilities include: • Providing company-specific security training for securitypersonnel • Assessing and moderating learners and/or training material • Developing newlearning material and updating when required • Guiding and coaching learners in the process oflearning discovery • Consolidating data and reporting on interventions.
Interested parties should complete and submit the standard job application form to e-mail:[email protected] or fax: 086 639 8439, for attention: Recruitment.
Closing date: 7 April 2015
22 Carletonville Herald 3 April 2015
Candidates may submit their CV by fax to (013) 230-7032 or email [email protected] quoting the Reference Number SAM20477.
Closing date: 10 April 2015.
If you have not been contacted within 2 weeks after the closing date, pleaseassume that your application has been unsuccessful.
www.samancorcr.comThe Working Earth 03-20477
Samancor Chrome is a progressive, innovative company with an enviablereputation for being an employer of choice. We have a clearly defined commitmentto provide growth and development opportunities and these are evident at our
two mines, three smelters and our corporate head office.
The following opportunity has become available atEastern Chrome Mines
business unit near Steelpoort in the Limpopo Province.
Maintenance Supervisor(Trackless Machinery) C-UpperThe incumbent will supervise the safe and cost effective execution of all maintenanceof the underground machinery and workshop equipment as well as ensure high qualityworkmanship of artisans and contractors. Further areas of focus include safety and legaladherence, managing people, providing maintenance support, preparing schedules,executing work, managing contractors and handling budgets.
The selected candidate will have a Grade 12 / N3 qualification coupled with a relevantTrade Test (Trackless) and SAP experience. Experience in mechanised and conventionalmining as well as 5 years’ relevant experience with preferably 2 years’ supervisoryexperience will also be required. Ref. No. SAM20477
In making the final selection, consideration will be given to achieving the SamancorChrome’s employment equity and the mining charter objectives.
2015/16 Draft IDP and 2015/16Draft Budget
The 2015/16 Draft IDP and 2015/16 Draft Budget of the West Rand District Municipalitywere tabled at Council on 25 March 2015 and are open for public comments.
Copies of 2015/16 Draft IDP and 2015/16 Draft Budget are available for a period of21 days for public comments until 15 April 2015 on the WRDM website atwww.wrdm.gov.za and at the public libraries of: • Mogale City Local Municipality• Merafong City Local Municipality • Randfontein Local Municipality • Westonaria LocalMunicipality.
The documents will also be available at these Parliament Constituency Offices (PCOs):• Mogale City Local Municipality • Randfontein Local Municipality • Westonaria LocalMunicipality • Merafong City Local Municipality.
Written comments should be placed in the suggestion boxes provided at the respectivelibraries/municipalities and directed to the Office of the Municipal Manager: WRDM,
attention Thembi Ntshakala (tel. (011) 411-5000/5151, fax: (011) 412-3663or e-mail: [email protected]) on or before 15 April 2015.
M.D Mokoena - Municipal ManagerC/o Sixth & Park Streets/Private Bag X033, Randfontein 1760
Human Communications 117204
Cullinan Diamond Mine is situated in the town of Cullinan 30km east from Pretoria. Themine is currently mining at a depth of 747 meters using mechanised trackless block-cave mining.
Professional Nurse(2-year fixed-term contract)
PLEASE NOTE: This advert replaces Ref. CUL170 – Professional Nurse (2-yearfixed-term contract)
The incumbent will be responsible for ensuring the provision of a quality, ethical andlegally compliant Occupational Health and Primary Healthcare Service within the relevantlegislative framework.
Tasks and responsibilities: • Establish and maintain programmes for the following:* Health Risk Assessments, Biological Monitoring and Medical Surveillance * PrimaryHealthcare * HIV/Aids and Tuberculosis * Chronic Disease Management, Disability andIncapacity * Emergency preparedness and management of emergencies • Assist in themanagement of Injuries on Duty • Assist in the management of occupational diseases• Assist and participate during health campaigns • Ensure Health and Hygiene promotionand integration with Employee Assistance Programmes • Update and maintain all medicalrecords and registers • Update and maintain First Aid equipment and inspections ofFirst Aid rooms • Ensure adherence to Codes of Practice for medical fitness standards,procedures and protocols • Ensure personal and co-workers’ adherence to andcompliance with Security and the Company’s SHE objectives • Work according to theMine’s Code of Practice, and report any observations of this not being done.
Minimum requirements: • Relevant degree/diploma in Nursing with General Psychiatry,Community, Primary Health and an additional qualification in Occupational Health/Community Health • Registered with SANC as a Professional Nurse • Registered withSASOHN • Dispensing Certificate • Audiometry Certificate with instruction 171 update• Spirometry Certificate • HIV Certificate • 3-5 years’ nursing experience in primaryhealthcare and/or occupational health • Computer literacy in the Microsoft Office suiteand Windows system.
Other skills/competencies: • Sound verbal, written and interpersonal communicationskills in English and one other official language • Independent, proactive thinking andthe ability to organise and plan • The ability to work independently and as part of theteam • Quality-orientated • Focus on caring • Good interpersonal relationship skills.
(Ref. CUL171)
Cullinan Diamond Mine is an equal opportunity employer. Preference will be given tosuitable candidates from the designated groups in line with the Company’s EmploymentEquity Policy and Plan. Pre-screening, profile testing, on-mine assessments, medicaland security clearance form part of the recruitment and selection process. Short-listedcandidates will be required to attend a panel interview. Employment of the successfulcandidate is subject to the aforementioned criteria. Preference will be given to candidateswho reside within our host labour sending areas (proof of residence may be requested).
Please complete an application form (available on http://www.petradiamonds.com/careers/current-vacancies) and forward, together with your résumé, qualificationsand ID, to [email protected] or fax: 086 659 1334 by 8 April2015. Please note that incomplete application forms and documentation will notbe considered.
If you have not heard from us within 30 days of the closing date, please regard yourapplication as unsuccessful.
Please note that Petra Diamonds does not at any time require any form of paymentfor recruitment purposes. If you are approached in this regard, you should report theincident immediately via one of the following hotlines: South Africa 0800 22 22 00(toll-free from an RSA landline) or international +27 12 305-2711.
http://www.petradiamonds.com/careers/current-vacancies
Building a world-classdiamond group
Cullinan Diamond Mine
www.humanjobs.co.za Human Communications 117493
John WiliamHennings (11)onlangs as wenner van Goldfields Westgholfklub se junior kampioenskap uit die strydgetree. Hy is 'noudleerling vanLaerskool Dagbreek wat nou inBedfordviewwoon. Hy hetook die beste"gross" in die divisie vir spelersmet 'n voorgeevan 9 tot 18 gespeel.
Adele Louw
The North West Winter League started recentlyand the Fochville Squash Club was eager to getgoing in their defense of their position as ReserveLeague Champions.
The team was hosted by PCC5 at the PotchCountry Club. What looked like an easy night forthe guests at the start had them worried towardsthe end of the first game. First up was GerhardPretorius from Fochville against Sanet Meiring. Af-ter two almost non contested games Gerhard wason his way to a 3-0 win, but Sanet had other ideas.She fought back to win the next two games, tyingthe match at 2-2 with one game left to decide the
outcome of the match. In a nail biting finish, whichsaw the last game swing both ways, firstly in Ger-hard’s favor and then into Sanet’s favor, it eventu-ally Gerhard that claimed the last game and wonthe match 3-2 for Fochville.
The next three games all went in favor of Foch-ville 3-0, but also with some resilience from thePotchefstroom players as they nearly claimed a ga-me or two from the Fochvillers. Mark Metcalfe be-at Bennie van Wyk, Wouter Nel beat a previousteam mate Albert Schutte and Gavin Haringtonagain proved to be too strong for Philip Schle-busch. The final evening saw Fochville return ho-me with a full allocation of 16 points for the night,while PCC5 earned two.
Fochville squashplayers triumphoverPotch
Wouter Nel about to return a serve from Albert Schutte.
KennisgewingDit is die verantwoordelikheid
van die Adverteerder om sekerte maak dat sy advertensiekorrek is op die eerste dag
van publikasie en geplaas isvolgens sy/haar instruksiesen dat alle foute gekorrigeeris voor die volgende uitgawe.Mooivaal Media neem geenverantwoordelikheid vir meeras een foutiewe plasing nie.
(018) 293 0750 /(018) 788 6693
3 April 2015 Carletonville Herald 23
All of us at Harmony Gold are united by our values,ensuring that we measure, we measure up and we deliver.
Operation: Harmony One Plant -Free State
Title: Rigger
Roles and responsibilities:• Be responsible and accountable for the engineering services
• Perform rigging and other engineering installations and repairs
• Undertake legal inspections and testing of equipment (riskassessment)
• Update logbooks as per Harmony standards
• Undertake daily inspections and repairs
• Be on standby and work overtime if required
• Comply with HRMS systems
Contact person: Elizabeth SeroebeleDesignation: HR PractitionerFax: 086 547 1621E-mail: [email protected] date: 10 April 2015
Human Communications 117464www.humanjobs.co.za
OUR VALUES
If you have not received any correspondence within 21 days after the closing date, regard your application as having been unsuccessful
Minimum requirements:
• A recognised Trade Test Certificate
• A minimum of 5 years’ experience as a Rigger
• A Certificate of Fitness (Red Ticket)
• Good interpersonal and communication skills
• The ability to work independently and handle work pressure
• Experience as a Multi-skilled Artisan will be an advantage
• Plant experience will be an added advantage
• A valid driver’s licence and own transport (essential)
Adele Louw
Swimmerswhoexcelledduring thepastyear received medals and trophies du-ring the Carletonville Swimming Club’srecent prize-giving.
The club’s annual prize giving eventat the end of the swimming season tookplace at the municipal swimming poolin Carletonville on 20 March.
The trophy for thebest overall Swim-mer of the Year went to Caitlin Doran,who also scooped awards for Best Fe-male Swimmer and the “People’s Choi-ce” Best Female Swimmer of the Year.
The trophy for the Best Male Swim-mer of the Yearwent toMarkusHoman,who also walked away with the trophyas Best Swimmer of 14 years and over.
Julian Rheeder won the trophy forthemale swimmerwith themost coura-ge and determination and the “People’sChoice” Best Male Swimmer trophy.TammyvanNiekerkwas theBest Fema-le Swimmer of 14 years and over. Shealso scooped the trophies for Most Im-proved Time and the female swimmerwith themost courage and determinati-on.
DiwanWolfaardt andBianca Janekewalked off with trophies for being thebest swimmers in the 13 years and un-der category while TiaanWolvaardt andMinke Rheeder won the trophies formost improved male and female swim-mers. Annalisa Freese and Sharlenevan Niekerk shared the trophy for out-standing performance.Various other swimmers also recei-
vedmedals for outstanding performan-ces during the course of the season.
ThegoldmedalwinnerswereAnnali-
sa Freese, Bianca Janneke, ChristiaanDonato,DiwanWolfaardt, JaydonHart-ley,MarkusHoman,MinkeRheeder, Ri-chardHartley and Tammy vanNiekerk.The silver medal winners were Ben van
Niekerk, Caitlin Doran, ChristiaanLouw,DeWet Agenbach, HeinrichOost-huizen, Tiaan Wolfaardt and Sharlenevan Niekerk. Christiaan Agenbach,Chrizelle Velloen, Eugene Rheeder and
JulianRheeder received bronzemedalsfor third positions during races.Kealebogo Khoza and Rickus Collins
received bronze medals for ending infourth place in some races.
Swimmers rewarded for hardwork during the season
Annalisa Freese (goldmedal and trophy foroutstanding performance) andMarkus Homan (gold medal, trophy for best maleswimmer in category 1430 and trophy forbest male swimmer of the year).
In front are De Wet Agenbach (silver), Christian Donato (gold), Heinrich Oosthuizen (silver), Jaydon Hartley (gold), Tiaan Wolfaardt(silver and trophy for most improvement), Minke Rheeder (gold and trophy for most improvement). The themiddle are Julian Rheeder(bronze, trophy for courage and determination and trophy for people’s choice), Christiaan Agenbach (bronze), Diwan Wolfaardt (goldand trophy for best male swimmer 13 and under), Bianca Janeke (gold and trophy for best female swimmer 13 and under), ChrizelleVelloen (bronze), Caitlin Doran (silver and trophies for people’s choice, best female swimmer of the year and overall best swimmerof the year), KealebogoKhoza (bronze). At the back are Christiaan Louw (silver), Sharlene vanNiekerk (silver and trophy for outstandingperformance, Richard Hartley (gold), Tammy van Niekerk (gold and trophies for courage and determination, most improved time,best female swimmer in category 1430 and best female swimmer of the year award), Gerrie Grove (coach), Eugene Rheeder (bronze)and Rickus Collins (bronze). Ben van Niekerk (silver), is absent.
Adele Louw
Members of Kaizer Chiefs recently visi-tedMerafong in the first of many outre-aches to develop young soccer playersin the area.
Three u.17 teams from the Mera-fong area recently had the opportunityto play against their junior KaizerChiefs counterparts during a specialevent held by the Carletonville FootballClub at the PopoMolefe Stadium in Ko-kosi.
The teams, consisting of playersfrom Carletonville, Fochville, Kokosiand Blybank, were also coached by theChiefs visitors during the course of theday.
The visitors, headed by KaizerChiefs’ head of youth development,Kenneth “Conti” Kubheka, played 40-minute games against the local teams.
Although the local youngsters sho-wed much talent, they had to concedetheir games with scores of 1 - 0, 2 - 0and 1 - 0 to the strong Chiefs visitors.
“We cannot have a strong nationalteam if young players, especially thosefrom townships, are not developed. It
is also high time that schools get moreinvolved in soccer again,” ‘Coach Conti’told the Herald during his visit. He saidthe visit toKokosiwas only one ofmanyto come, as Kaizer Chiefs has develo-ped a good relationship with Carleton-ville Football Club.
‘CoachConti’ is well respected in thesoccer community, not only as the for-mer team coach of the u.23 nationalteam, but also as national director,technical manager and coach educati-on manager of SAFA (South AfricanFootball Association).
The relationship between the twoclubs started after one of the Carleton-ville FC coaches, Albert Kometsi, is aformer professional player who hadpreviously been coached by ‘CoachConti’.
One of the other coaches, TebogoKeitebetse, said this led to representa-tives of Kaizer Chiefs also travelling toCarletonville to attend the officiallaunch of Carletonville FC last year.Carletonville FC, which trains at Carle-ton Jones High School, said it wouldlike to get more talented young playersinvolved in future trainingmatches and
sessions with Kaizer Chiefs.“Wewould like to expose kids inMe-
rafong to better training and experien-ces that come with playing and beingcoached by the Chiefs visitors. We real-ly believe that there is huge talentamong local players and our aim is forsome of them to be identified, and ta-ken up by Chiefs,” Keitebetse told theHerald.
He called on parents to becomemo-re involved and supportive of their chil-
dren’s soccer activities, a view whichwas reiterated by Conti.
“I have many parents phoning andaskingme to look out for their childrenduring trials. But, when I ask themwhat positions their boys play, theycan’t answer me. It is a disgrace,” hesaid during the visit.
People who would like to get in con-tact with Carletonville FC can phoneKeitebetse at 081 040 1486 or Kometsiat 083 690 7184.
Chiefs players assist local youngsters
The Kaizer Chiefs visitors, together with Carletonville Football Club members duringthe recent event.
3 April 2015
Gesamentlik besit deur/Jointly owned by: (Edms)Bpk (RegNo.1964/04662/07)vanEkspagebou,AttieFouriestraat (Posbus351)Vanderbijlpark,deurPaarlColdset (Pty)Ltd,83HeidelbergRoad,CityDeepProduction
Park, City Deep.Alle regte van reproduksie van alle verslae, foto's en ander materiaal wat in hierdie koerant gepubliseer word, word hiermee volgens afdeling 12 (7) van dieWet op Kopiereg No. 98 van 1978 en enige amendemente daartoe, voorbehou. Ons onderskryf die Gedragkode van die Mediaraad van SA en aanvaar sy jurisdiksie.
Gedruk namens die eienaar en uitgewer
(Pty) Ltd. (Reg. 1964/04662/07) of Ekspa Building, Attie Fourie St. (P.O. Box 351 Vanderbijlpark) by Paarl Coldset (Pty) Ltd, 83 Heidelberg Road, City Deep ProductionPark, City Deep. All rights of reproduction of all reports, photographs and all othermaterials published in this newspaper are hereby expressly reserved in terms of section12 (7) of the Copywrite Act No. 98 of 1978 and any amendments thereto. We abide by the Code of Conduct of the Press Council of SA and accept its jurisdiction.
Printed for the owner and publisher
3 April 2015
portportS
9 771605 542004
01415
Sibanye Gold again took top honoursat the prestigious annual global show-piece, the Johannesburg leg of the JPMorgan Corporate Challenge.Sibanye’s athletes showed that they
are a force to contend with when theyscooped up the first position in themixed category. The event took place atthe Wanderer’s Club on 26 March.At the time of the newspaper going to
print it also looked as if Sibanye mayhave won the men’s prize.As a result of their achievement in the
event, which was the first rain-free runinmany years, Sibanye Gold earned anopportunity to fly aboard to improve on
a JP Morgan Mixed team record set ina very hot Singapore race back in 2011,sponsored by JP Morgan.The top performing women in the
eventwerePuseletsoMaema,PuseletsoThiane and Nthabiseng Sekhweka.The top men were Bhekinkosi Sibi-
ya, Pule Tyaoane and Coolboy Ngamo-le.“The sweet taste of success stems
from the fact that all Sibanye partici-pants are regular mine workers whohad to conform to stringent qualificati-on standards to gain the right to repre-sent the company. At a time when allprogressive corporates are channelling
all available financial resources to-wards safe, sustainable mining, goldmining powerhouse, Sibanye Gold, isrelentlessly putting money where itsmouth is,” Sibanye’s head of sport,Sydney Mdluli, told the Herald.“These are our ambassadors, totally
dedicated to excellence through sport,”says Elford Mayixale, senior manager:high density, whose portfolio overseessport and recreation.“Sibanye is all about investing in our
county’s future. Neal Froneman (CE)and his team have led by example, withpersonal and financial backing.”Newly-appointed Sibanye Gold
group sport and recreation superinten-dent, Benji ‘Smiles’ Monyane paid tri-bute to the commitment and sheer de-termination, not only of the victoriousathletes, but of all who made an effortto participate in the annual showpiece.“I reallywant to encourage even soci-
al runners to enter, run, and walk asit will benefit both self and company:This regularparticipation in a semi-fullintensity sporting activity keeps thedoctor away” Benji said after the event.The international JP Morgan bank
has organised the event for over 30 ye-ars to raise money for various causesaround the globe.
Sibanye Tops JPMorgan2015RelayA proud Elford Mayixale, senior manager: high density, poses for photos a few hours after motivating the victorious Sibanye running stars.
Adele Louw
Twee atlete van die Smithathlons atle-tiekklub is besig met hul laaste voorbe-reidings voordat hulle na die Suid-Afri-kaanse senior atletiekkampioenskappevertrek.Dié kampioenskappe word op 17 en
18 April in Stellenbosch gehou.Cindy Naude (23) het op 25 Maart ge-
hoordat sy vir die verspring-item tydensdie SA’s gekwalifiseer het.“Ek is nog maar my hele lewe lank ‘n
atleet,” het dié blonde onnie van Laer-skool Jongspan die afgelope week aandie Herald vertel. Sy is al vir 11 jaar lidvan Smithathlons en het op hoërskoolby Callies ook vir die nasionale junior-kampioenskappe gekwalifiseer. Behal-we vir verspring, het sy ook in die 100-en 200m items presteer.Volgens Naude was dit nog altyd ‘n
groot droom om verder met atletiek tevorder en geniet sy dit baie, ondanks diefeit dat sy elke week van Maandae tot
Vrydae moet oefen.“Ek geniet dit vreeslik en is baie opge-
wonde oor die SA’s. Mens se harde werkword altyd beloon,” het ‘n opgewondeNaude aan die Herald vertel.Nóg ‘n Smithathlons-atleet, Paul Tso-
tetsi, het ‘n dag na Naude gehoor dat hyook vir die senior SA’s gekwalifiseer het.Die 23-jarige Tsotetsi gaan sy staal ty-dens die 800m-item wys. Tsotetsi, watook ‘noud-leerling vanHoërskoolCarle-tonville is, vertel dat hy ook mal is ooratletiek en voel dat dit sy spesiale talentis wat hy moet ontwikkel.“Ek was nog klein toe ek agtergekom
het dat ek vinnger as die ander kindersis en dit is vir my ‘n wonderwerk om sogoed te kan presteer,” het hy vertel.Behalwevirdie800m,hethyookdeur
die jare in die 400m, verspring en drie-sprongpresteer.Hoewelhynie ‘n voltyd-se student is nie, het Tsotetsi ook die af-gelope naweek Wescol tydens die Suid-Afrikaanse kolleges-atletiekkampioen-skappe verteenwoordig.
Twee atlete deur na SA’sNewly-appointed Sibanye Gold
Cindy Naude is reg vir die SA's.
around the globe.
Paul Tsotetsi is mal oor sy sport.