August 2 2013.pdf

8/22/2019 August 2 2013.pdf

1/20

Vol. 131 No. 21 Friday, August 2, 2013

www.minnedosatribune.com

90 cents + tax

Weacknowledgethe

financial support of theGovernment of

Canadathrough the

CanadaPeriodical Fund of theDepartment of

Canadian Heritage.

WELCOME RODEO AND ROCKIN THE FIELDS FANS!Enjoy your August long weeknd in

friendly Minnedosa!

ready to rock!By DARRYL HOLYKhe tenth year oMinnedosas annual

August long weekend mu-

sic estival as a non-proftco-operative is set to kicko today with anticipa-

tion or the best three daysRockin the Fields has had.

Ater two previous ailed

attempts at estivals at thelocal rock site, the currentrendition o the estival has

ound its niche and as their

slogan says, Rockin theFields is solid as a rock.

With humble begin-nings to keep the rock es-tival going in Minnedosa,

Rockin the Fields hasexperienced continualgrowth since its frst esti-

val back in 2004.Weve grown in baby

steps and its been abu-

lous, said estival promot-er, om Crook. We havea great board o directors.

Tey stick to the budgetand thats one o the main

reasons we have survivedten years. Weve been ableto increase the budget alittle more every year.

As a result o this, an-nual improvements aremade to the site and bigger

name acts are booked.Last year we had one

o the biggest bands weve

ever had as Rockin theFields with Finger Eleven.Tis year, we have Teoryof a Dead Man so wereslowly getting there. Otherbig name acts scheduled

to appear this weekend in-

cludeTe Trews, Big Wreck,

Trooper, Monster Truck,

One Bad Son, Starship ea-turing MickeyTomas andTe Headpins. A number o

other bands will also be ap-pearing on the secondarystages.

wo years ago saw thereturn o the big main stage

at the bottom o the concertbowl. Tis was a huge step

orward or RFM and was

a goal o organizers rightrom day one. I think thatpaid o and people are see-

ing the hard work that is go-ing into this, said om.

Regulars attending

this years estival will seesome welcome improve-

ments to the concert bowlwith the installation o blue

ip seats, which RFM was

able to acquire rom the oldBombers stadium in Win-nipeg.

T anks to MartyMcNabb and the Winni-peg Blue Bombers, RFM

was able to take a crewinto Winnipeg earlier this

year to remove some othe seats or use at the rock

site. Tis year we have in-

stalled 198 ip seats whichwill be great or the rock-ers who want to sit down,

take a load o and enjoythe show, mentioned RFMPresident, Darcy Bialas.

Continued

on Page 3

Photo by Darryl Holyk

(L-R) RFM President, Darcy Bialas; Director in Charge of Site, Barry Couttsand Lead Hand, Blaine Instance are pictured with the reclaimed

Bombers seats recently installed in the main concert bowl.

By JENNIFER PAIGE

A local woman livingin Minnedosa wasrecently discovered to bea long-time American u-gitive, evading criminal

charges or the past 16year s.

Known in town as

Jean McPherson, Jeanerese Keating has beena wanted ugitive in the

state o Oregon since1998.

On April 13, 1997,

Keating, who was 38year s-ol d at t he tim e, wa sdriving under the inlu-

ence with her two smallchildren and caused aatal car accident which

killed 65-year-old, JewelAnd erso n.

Continued

on Page 13

Local resident

discovered to

be long-time

American

fugitive

Police photo

8/22/2019 August 2 2013.pdf

2/20

2 Te Minnedosa ribuneFriday, August 2, 2013

15% OFF1st 20 signed customersRoofng, Sot, Fascia, Eavestrough

[email protected]

SATISFACTION GUARANTEED!!!

By SARAH DALRYMPLE

As o July 2nd, MaxineWoodcock has takenup the role o Resource Co-

ordinator or Minnedosa

and District Services toSeniors. I look orward to

working with seniors andthose with disabilities. Iplan to ofer inormation

sessions and workshops

on various topics o inter-est, to the community as a

whole. We have an opendoor policy, so I look or-

ward to meeting and work-

ing with everyone. Maxine

commented. Her o ce islocated on the main oor o

the own View Manor andis open Monday throughFriday.

Minnedosa and Dis-trict Services to Senior(MDSS) is an organizationthat supports seniors in theown o Minnedosa, R.M.o Odanah, R.M. o Minto,and the northern part o theR.M. o Saskatchewan. It isunded through the PrairieMountain Health Authorityand governed by a Boardo Directors that aim tom ai nt ai n a se ni o r s

independence.According to Maxine,

My role as Resource Coor-dinator is to coordinate ser-

vices to help seniors main-tain independent living. I

will be recruiting serviceproviders such as drivers,those who will do clean-ing, help with shopping,laundry, errands, etc. andmatching them with clientsneeding a helping hand.

MDSS also has anequipment lending pro-gram or tub chairs, walk-ers, and canes in additionto three congregate meals

served at the own ViewManor three times a per

week. At the beginning oAugust, Maxine will begintraining with Victoria Lie-line to provide seniors withmore saety. Tis programofers help at the touch o abutton.

As or right now, I amin the process o updatingthe list o housing avail-able to seniors in Minnedo-sa. Tis means a list oprospective apartments,condos, etc. Maxine an-nounced.

Maxine Woodcock new Services to Seniors Coordinator

Photo by Darryl Holyk

A month into her new position as Services to Seniors Coordinator,

Maxine Woodcock is looking forward to new programs and

opportunities that are available to seniors in the community.

By DARRYL HOLYK

his weekend, theMinnedosa Maverickswill represent the SantaClara Baseball League atthe AA Provincial tourna-ment in Hamiota. Te Mav-

ericks are up against sevenother best o teams romaround the province.

Our local team hashad another successul

year deending its seven

year run as Santa ClaraLeague Champions. TeMavericks closed out theregular season with 11

wins and two losses andare now moving on to thesemi nals rom a suc-cessul quarter nal run.

Te Mavericks next gamewill be against the Por-tage Padres and ans canexpect a home game herein Minnedosa next week,although the date o that

game was not determinedat press time.

Ater a long run underthe coaching guidance oOrville Madill, the Maver-icks are now coached byJay Klym and appear to becontinuing their string o

baseball athletic strength.Good luck to the Maver-icks in the upcoming pro-

vincial tournament andsemi-nal games!

Mavericks in semi fnals

File photo

8/22/2019 August 2 2013.pdf

3/20

3Te Minnedosa ribune Friday, August 2, 2013

13075GG02

Continued

from Page 1

Additional f ip seatsare planned to be installedin the years ahead. Along

with the f ip seats, benchseating in the concert bowlprovides seating or 600people. Tis year, we canseat 800 people easily,mentioned Darcy.

Another addition tothe concert bowl is a per-manent handicap deck lo-cated at the top centre o theconcert bowl. Measuring16 eet by 16 eet, this deck

not only provides a great

view o the main stage but

also the secondary stage(the ormer Main Stage)and the smaller stage area

which is located where theprevious secondary stageonce was.

Pulling o a estivalo this magnitude takesmonths o hard work andplanning as well as anarmy o volunteers. RFM isortunate to have securedthe trust o local volunteers

which are rewarded with aportion o the weekendsprots. Since RFM began,local service clubs have

received approximately

$175,000 rom the estival.

All o these unds go backinto the community.Tis couldnt be done

without our volunteers. Itsturned into a great com-munity event and peoplerealize that and come outhere and help. It makesall the di erence in the

world, mentioned om.Organizers estimate

in excess o 250 volun-teers are involved with theRockin the Fields week-end. Tis number does notinclude the numerous vol-unteers who lend a help-

ing hand or a strong back

beore and ater the esti-

val, assisting with the set-up, teardown and cleanupo the site.

Gates or this yearsestival opened Turs-day at noon and at presstime Wednesday tickets

were still available. Wereahead o last year and weexpect a huge number o

walk-up as well, said om.Tat is dependent on the

weather but its lookinglike its going to be a nice

weekend so it should be agreat party.

Campground A has

been completely sold outwith about 50% o Camp-ground B also booked.Tis is an increase romprevious years. Last year,there was some overfowinto Campground B butonly three or our campers.With the nights lled

with music, new daytimeactivities have been addedto provide more options orrockers looking or some-thing to do during the day.Te annual beach volley-ball tournament returns

and other daytime events

will include aternoon mu-

sic at the small stage underthe tent, a scavenger hunt,a rock trivia contest andexas Hold-em poker tour-nament. Te best decorat-ed campsite contest is alsoreturning this year withsome great prizes avail-able.

Te land which is nowoccupied by the RFM siteis owned by ed and Di-ana Clarke. Back in 1995

when planning or the rstClassic Rock was under-

way, the Clarkes oered 17acres o their land with the

rental ee being the annualproperty taxes. ed andDiana are happy to see thesite still being used and areimpressed with the growthRockin the Fields has ex-perienced in the past de-cade.

Tis all started backin 1996 and back then itmight have been a little bitbigger but certainly wasntas much un as it is now,said ed. Tese volun-teers are doing just a great

job out here.

Fans may recall see-

ing ed roaming the site on

horseback throughout theweekend. Tis year, due toa recent health issue, ed

will not be on horsebackbut is looking orward to

joining in the party andwheeling around the sitesoaking up all the un andmusic RFM brings to theproperty what was ormer-ly his pasture.

RFM is ten yearsstrong and still rocking onand rom the growth andimprovements experi-enced over the years, thisestival has a bright uture

in our community. Partyon rock ans!

RFM ten years strong and growing

By DARRYL HOLYK

Aew months ago, it was an-nounced that SUBWAY wouldbe opening in the ormer ChickenDelight/Valley Cache building on theeast side o Main Street. At that time,the anticipated date or opening was

Fun Fest weekend. Tat weekend hascome and gone and no SUBWAY, so,

whats happening?Owner Ash Patel has con rmed

that SUBWAY will be opening inMinnedosa later this year. Ater somedelays, the required building permits

and approvals or renovations havebeen secured. Construction is hopedto begin within the next two weeks.He is also waiting or the necessaryequipment to be dispatched romSUBWAY headquarters.

I all goes as planned, theMinnedosa SUBWAY location

is now anticipating an openingdate sometime in mid September.

Te rst SUBWAY opened in Au-gust 1965 and has grown into a mega-ranchise chain with more than 39,000locations around the world.

Wheres Subway? If your labelreads

Its time torenew!

Call 867-3816

13/08/31

8/22/2019 August 2 2013.pdf

4/20


Darryl A. Holyk - Publisher & Editor- [email protected]

The Minnedosa Tribune Ltd.Box 930 Minnedosa, MB R0J 1E0

Published Friday o each week rom the premises oTe Minnedosa ribune Ltd. 14 - 3rd Ave. S.W.

Minnedosa, MB. R0J 1E0Member o Manitoba Community Newspapers Association

and Newspapers CanadaAudited twice a year by Canadian Media Circulation Audit

TRUSTED CONNECTED TARGETED

Phone: (204) 867-3816Fax: (204) 867-5171Cell: (204) 867 - 7000

Te Minnedosa ribune is independently owned and is theoldest weekly newspaper in the Canadian West and haspublished continuously rom the same premises sinceMarch o 1883. We acknowledge the fnancial support o theGovernment o Canada through the Canada Periodical Fund

(CPF) or our publishing activities.

E-Mail Addresses:

General: [email protected]/printing: [email protected]

Classifeds: [email protected]


T e Minnedosa ribune Ltd. does notguarantee the publication o all submitted articles andphotographs. Tese submissions, are at the discretion o thepublisher and will appear as space permits. Te Minnedosaribune reserves the right to edit any submission as deemednecessary by the publisher.

We are not responsible or ax transmissions or emailsubmissions that are not received. o guarantee that suchsubmissions have been received please confrm with a phonecall or in person.

All contents copyright 2013

Fromthe

Publishers

desk...ByDarrylHolyk

By ELISSA L.Edmonton, AB

Do you know what its like when everything you

do, everyday is hard? o be searching yourmind or childhood memories and fnd only blackholes? Or to suer rom debilitating migraines al-most every day? July 14th, 2013 marked the fve yearanniversary o my battle. Fighting to be me again, tobe normal, to receive support with my challengesand all around fghting or my lie. Heres my story:On July 14th, 2008 I was a passenger in a vehi-

cle t-boned by a semi that had run a red light. Mylungs collapsed and I was knocked unconsciousinstantly. Te First responders to the accident in-cubated and got me o to the hospital where doc-tors told my amily that due to the brain bleeds andswelling I likely would not survive. Well, it turns outthey were wrong. I woke rom the coma just in timeto celebrate my 20th birthday on July 20th, 2008.

Since this time, I have struggled to regain both cog-nitive and physical unctioning. I remember beingin the hospital and having to really concentrateon getting the timing o breathing and swallowingright so that I didnt choke on my ood. I still messthis up sometimes.oday, I am working part-time during the sum-mer as a Child Development Worker and pursu-ing a degree during the school year. I all goes asplanned, I will be graduating rom university inDecember with my elementary B. Ed. Minoring inSpecial Education.o most, I appear normal but dont let that

ool you. Ive spent a good part o the last fve yearshiding the di culties in hopes o one day fnding

mysel again and pushing my limits physically,mentally and emotionally to be the best I can be.Its hard living with a personality and chanllengesyou dont recognize.

Im writing to tell my story because theres adark side I believe people should be aware o. Tisaccident took place in Winnipeg, MB; a provincewith no-ault public insurance. Tis really isnt agood combination when it comes to personal inju-ries, especially brain injuries such as mine wherethe ull cognitive damage is di cult to measure.Since the car accident I have been struggling withManitoba Public Insurance Corporation (MPIC), to

get help and support, with very minimal success.Te maximum entitlement or permanent impair-ment in 2008 was approximately $133,000, and todate, MPIC has calculated my total entitlement be

$21,295.84. Tis includes a 5% rating or the mostsevere level o concussion or loss o consciousnessallowed, 5% or my loss o cognitive unction and2% or the largest o the brain bleeds in my let ce-rebral hemisphere.

Given the most recent inormation on bothlong and short term eects o brain injury and con-cussion particularly on a youthul brain this settle-ment seems sadly inadequate. Te insurance planis also supposed to provide income replacementwhile you recover rom your injuries but this hasproven to be extremely inadequate and an endlessbattle o letter writing, appeals and meetings thathave provided little. Most o the doctors recom-mendations have been ignored or Ive been givenexcuses that are not only ridiculous but insulting.

Excuses that imply Im not damaged enough to de-serve help, my anxiety is caused rom a romanticbreak-up two years ater the accident or even thatthe reason I struggle is because I live too ar awayrom my amily.I paid or insurance and assumed that should

the worst happen, my amily and I shouldnt bemade to carry the bulk o the burden alone. Whereare you now MPIC? I cant adequately unction inan average lie, I cant sue and I cant seem to getthe support I need rom you; so what now? It right-ens me to think about where I would be today without the amazing support o my amily, riends, doc-tors and teachers.

Tis letter is being sent across Canada because

although this accident took place in Manitoba, Idont believe I can be the only one in the countryfghting a battle likes this. Tis situation is wrongand Canadians deserve to know the injustice thatstaking place in our country.

Tere was nothing special about me, it couldjust as easily have been you in that car that day.Some people will think that I should just be thank-ul that Im alive today but to that I say, No, this isMY lie. As ar as I know, I only get one so I deservethe chance to LIVE it. I will not settle or just gettingby with Good enough!

Falling between the cracks

Were back...Ater a much needed, one week vacation, Te

ribunesta is back at it slaving away in the back shop.And when I say slaving, I truly mean slaving! It has beenquite the week to come back as we began the week withonly hal o our regular sta able to be here. Tis tem-porary sta shortage certainly let us eeling the strain.Its a little hectic when there are only two people to fllour positions, make a 20-page newspaper along withprinting and olding thousands o Rockin the Fields

and Rodeo programs, along with other print jobs ando ce duties. Somehow, we got it done! Hopeully, bythe time you are reading this, we are back to a ull com-pliment o sta.

Our new reporter...Mid week, we welcomed Jennier Paige as Te ri-

bunes new reporter/photographer. We are greatlulto have Jennier on sta and look orward to what shebrings to this newspaper. She comes to us with a greatdeal o past experience with other publications as aeature writer, editor and production assitant.

busy weekend ahead...Te August long weekend has arrived and or

Minnedosa that means a busy weekend with lots todo or rock and rodeo ans with the return o Rockinthe Fields o Minnedosa and the Minnedosa Rodeo.Tis year, RFM is celebrating its 10th annive rsary asa non-proft co-operative and the rodeo is hot o theheels o being named last years Heartland Rodeo As-sociations Rodeo o the Year (or a second time in itsshort history!) Many months o hard work, sweat and

volunteer time go into the oprganization o these twoevents and I would like to personally congratulate ev-eryone who has a hand in bringing these two Augustlong weekend attractions to our community. Yourhard work draws people rom near and ar, supportsour local economy and boosts our tourism profle!

8/22/2019 August 2 2013.pdf

5/20


TOP RATE1 year

1.75%**Rates subject to changeCertain conditions may apply

3 year

2.10%*5 year

2.40%*

Dave McDonaldBruce McNabbwww.ricefnancial.com

Call For More Terms & Rates 867-3946

Te Minnedosa ribune welcomes Letters to theEditor. All letters must include the writers ull name,address, and telephone number. Only the writersname will be published; address and phone numberare required or confrmation. Anonymous letters willnot be published. Letters that are deemed libelous,in bad taste, or describe an incident involving otherpeople, will not be published. T e Minnedosa ribune reserves the right toedit letters based on taste, legality, clarity, andlength. Letters to the Editor can be submitted inperson, sent by mail to Box 930, Minnedosa, MBR0J 1E0, by ax (204) 867-5171, or by email [email protected]

YeOld

Trib

Lettersto theEditor

Letters to the Editor

The Minnedosa

& District

FoundationThe thoughful consideration

of Verna Averill, whenplanning her Estate, continues

to provide a $2,000.00annual scholarship to a

graduating M.C.I. Student.Your legacy could help the

Minnedosa Foundation do more.Call Maxine Laws at204-867-2126

2003 A 40-oot high white medal cross, with a 20-oothorizontal arm has been erected at the Little River Rock-est site. Te cross was donated to Little River Faithest bya number o Westman companies.

1993 A sixteen-year-old driver suered two racturesin her let eye socket and a broken nose ater being struckby a water flled balloon which was thrown through hercar window as she drove along the Beach Road neat thecemetery junction. Tree local men have been charged

with aggravated assault.

1983 A proposal rom the Minnedosa Rotary Club topurchase a handivan has received approval rom ownCouncil.

1973 Mayor Joyce Stevenson and Agriculture Min-ister, Sam Uskiw signed an agreement or the extensionand modernization o Minnedosas water and sewer a-cilities. Te $400,00 0 project will be equally cost sharedby the own and Province.

1963 John Hnybida o Brandon very likely owes hislie to Mrs. Ruth Williamoski and her assistant RaymondOrr. While swimming at Minnedosa Lake, about 30 yardsrom shore, John ound himsel in trouble when he gotcaught in a strong current. Ruth and Raymond came tohis rescue and brought the visitor to shore.

1933 Te W.I. ladies rom south o town held a verysuccessul dance in Jas Stewarts barn in aid o a ladiesrestroom or town.

1923 Te excavation is complete or the new school.Building will begin as soon as the lumber arrives.

1903 - P.H. Chipman o the Canadian Northern LandDepartment, has sold several lots in Clanwilliam at pric-es between $100and $150 each.

1893 A severe storm blows out the ront o P.J. McDer-motts store and smashes numerous windows in G.W.Beynons residence.

Dear Editor,

On July 4th, River EastMLA Bonnie Mitch-elson introduced a reso-lution in the legislaturethat called on the NDP toprovide the necessary sup-ports or Manitoba ami-lies seeking any orm oautism treatment. Moreand more children are be-ing diagnosed with Autismin Manitoba and amiliesare increasingly unable toaccess eective therapiesthat treat autism.

One o those thera-pies is Applied Behavioral

Analysis or ABA. Te out-comes o children withautism who undergo thistreatment are nothingshort o remarkable. A re-cent study by the St. AmantCentre outlined that ateronly one year o this ther-ap y communication skillsimproved by 166 percent,social skills by 130 percentand adaptive skills by 67percent.

Just prior to the 2011election the NDP released

a policy statement on Au-tism called Trive! In thatdocument , the govern-ment made a commitmentto eliminate wait-listsor ABA therapy, providebooster sessions or

amilies that need them

and provide support atera child has completed the

ABA program by Grade 5.T e government did

not live up to that policystatement on this issue,and that amounts to noth-ing more than another in aseries o broken promises.Tis hurts the very Mani-tobans who need the mosthelp; yet another exampleo the NDP taking Manito-bans or granted.

Tere are currently 62children on a wait-list orpre-school-aged therapyand that number is grow-ing every day. Tere aretwo very serious problems

with this situation. First,autism specialists notethe importance o earlyintervention. Second, i achild does not receive pre-school ABA treatment theyare ineligible or school-aged services.

Currently there arenine children in Manitoba

who have received NOtreatment because theyhave aged-out o eligibility

and 20 more are set to age-out by September.

I dont agree withmuch that the govern-ment says or does thesedays but I will share a ewcomments rom a debatein the Legislature that I

do agree with. On July

4, the Minister o FamilyServices Jennier Howard,said: We need to providebetter training and bettertools or parents. Ministero Education Nancy Allanadded: We believe thatproviding services or am-ilies with Autism is impor-tant. Minister o Childrenand Youth OpportunitiesKevin Chie said: Is theremore to do yes. Minis-ter o Entrepreneurshipraining and rade PeterBjornson said: Tere ismore we can do to supportamilies with children with

Autism.During the July 4th

debate, this governmentsarrogance was in ull viewand worse yet, the gov-ernment had no problemlying on the record. Forexample, Bjornson saidthe government had: re-structured ABA program-ming at St. Amant (Centre)to promote a more exibleservice modeland hasincreased the number o

ABA Spaces.

Te acts tell a di er-ent story indeed there

was a restructuring o theprogramming which re-sulted in increased spacesbut this restructuring wasdone in partnership be-tween the St. Amant Cen-

tre and a parental advoca-

cy group called ManitobaFamilies or Eective Au-tism reatment.

Bjornson also saidthe governments supportor ABA has increased by36 percent since 2008.Strangely, this contradictsthe claims o both Howardand Allan, who says und-ing has risen 35 percent.

Which is it?Te acts tell a di er-

ent story. In act no newmoney has been investedinto the ABA programsince the release o thegovernments pre-electionpromise 2011, which wasclearly a promise simplymeant to placate thou-sands o Manitobans be-ore an election.

Tis is not an issue omoney; this is an issue ochoices. Being in govern-ment is about choices. Al-locating dollars to support

your political party ratherthan supporting Manito-bans with Autism is the

wrong choice. I think itstime to change the ones

making the choices.

Leanne Rowat,

MLA or Riding MountainPC Critic or FamilyServices

8/22/2019 August 2 2013.pdf

6/20


02'(51/22.6

AUGUST BACK TO SCHOOLSPECIAL

$10.00 Haircut & Style (12 and under)$15.00 Haircut & Style (13 to 18)

$10.00 OFF Highlights

BOOK NOW!!!

August 1st - 30th204-867-5694

*Other coupons or discounts will not be accepted with this promotion*

Greetings and wel-come to the CopsCorner. Summer is fyingby, and the mosquitos are

fying high. Just thought Iwould create a rhyme thisweek to start o the col-

umn keepin it resh.O cers responded

to 59 calls or service this

time around.A camper trailer was

on re at a rest stop near

Minnedosa, causing somealarm. Luckily there wereno injuries, and no oul

play suspected. Te unitwas hauled away to Bran-don ater the blaze was

put out.A multi-vehicle ac-

cident involving a semi-

trailer occurred on High-

way #16. Police responded

to nd no injuries, andmixed stories o the event.No charges were given,

and as always it is good tosee no injuries.

A police oot chase

ended with a male beingcaught with a stolen ste-reo rom a vehicle. Te

male was charged or theo ence and will appearin court to ace a judge on

his charges. He and hisriend were both charged

with underage consump-

tion o alcohol as well. Teprice o those two ticketstotaled $1347.30.

Tis weeks top mon-ey loser was drinking anddriving as well. A male

was stopped ater he was

ound travelling 153km/hr on Highway 16 nearMinnedosa. An odor o

alcohol was observed onhis breath and he wasdetained or an impaired

investigation. He blew a24 hour suspension, and asober passenger ended up

driving the rest o the wayhome. But not beore he

was given his $744.50 tick-

et or the excess speed.I wonder why the soberdriver didnt drive in the

rst place Consequentlydue to the males 15 day

suspension, he was laterstopped at a check stopin Brandon on a dier-ent day and ound with a

suspended license. Tis22-year-old will be with-out a license or a while

i Manitoba Public Insur-ance has anything to sayabout it. Tat is or sure.

So there it is. Anotherspeeder o the week, plusa little extra.

Be sae. Enjoy theRockin the Fields week-end here in town.

Cops CornerBy

Cst. JUSTIN

HUDDLE

127,&(2)5(*,675$7,212)35263(&7,9(&$1','$7()25*(1(5$/

081,&,3$/%

8/22/2019 August 2 2013.pdf

7/20


13075gg04

I need aboost!

Your childs safetyis important.

Starting August 8, the law

requires children to

remain in booster seats

until they are at least:

145 cm (49) tall36 kg (80 lb.) OR

9 years old

In the event of a crash, research shows thatbooster seats protect children from seriousinjury by more than 60 per cent.

Proper installation and use of a booster seat areimportant.For more information call 1-888-767-7640or visit the Road Safety section at mpi.mb.ca.

:DWHU7HVWLQJ'D\

$XJXVWWK$77(17,215HVLGHQWVLQWKH50VRI%ODQVKDUG'DO\+DUULVRQ3DUN6DVNDWFKHZDQ6WUDWKFODLU DQGWKH SDUWVRI &ODQZLOOLDP0LQWR2GDQDK 5RVHGDOHZLWKLQ WKH /65&' DQG WKH 7RZQV RI (ULFNVRQ0LQQHGRVD5DSLG&LW\DQG5LYHUV

7KH/LWWOH6DVNDWFKHZDQ5LYHU&RQVHUYDWLRQ'LVWULFW ZLOOEHFRRUGLQDWLQJDZHOOZDWHUWHVWLQJGD\IRUWKHVHUHVLGHQWVRQ$XJXVWWK$OOVKLSSLQJFRVWVZLOOEHFRYHUHGE\WKH'LVWULFW7KUHHGLIIHUHQWWHVWVDUHRIIHUHG

7HVW WRWDOFROLIRUPDQG(FROL7HVW WRWDOFROLIRUP(FROLDQGQLWUDWHQLWULWH7HVW WRWDO FROLIRUP (FROL QLWUDWHQLWULWH FDOFLXPPDJQHVLXP VRGLXP KDUGQHVV SRWDVVLXP PDQJDQHVH FRSSHU LURQ]LQFFKORULGHVXOSKDWHFRQGXFWLYLW\S+

3LFN XS VDPSOH ERW WOHV DW WKH IRO ORZLQJ ORFDW LRQV EHIRUH0RQGD\$XJXVWWK

5LYHUV50RI'DO\RIFH2DN5LYHU/LWWOH6DVNDWFKHZDQ5LYHU&RQVHUYDWLRQ'LVWULFWRIFH6WUDWKFODLU50RI6WUDWKFODLURIFH(OSKLQVWRQH+LOOWRS*URFHWHULD*DV1HZGDOH50RI+DUULVRQRIFH

6DQG\/DNH+HULWDJH&RRS*URFHU\6WRUH5DSLG&LW\7RZQRI5DSLG&LW\RIFH0LQQHGRVD0DQLWRED$JULFXOWXUH)RRG5XUDO,QLWLDWLYHVRIFH(ULFNVRQ50RI&ODQZLOOLDPRIFH2QDQROH50RI3DUNRIFH3OHDVHPDUN\RXUFDOHQGDUVDVZHZLOO21/

8/22/2019 August 2 2013.pdf

8/20


0LQQHGRVD&RPPXQLW\&KLOG&DUH&RRS

1HZ.LQGHUJDUWHQ3URJUDP

DW7DQQHUV&URVVLQJ6FKRRO

/LPLWHGVSRWVDYDLODEOHIRU6HSWHPEHU

GD\6XEVLG\$YDLODEOH

DPSP0RQGD\)ULGD\&DOO&KULVWDDW

SUBMITTED

Riding Mountain Na-

tional Park (RMNP)is celebrating its 80th an-niversary in true 80s style!On Saturday, August 24th,Juno Award winners Glassiger will headline this

years ree outdoor con-cert!

T e 80s? Yeah, whynot? Whether you are re-living past glory days orchecking out the retro styleo your parents era, thisevent will be entertainingor everyone with classichits rom Glass iger like

Dont Forget Me WhenIm Gone, Tin Red Lineand Someday.Opening act Jess Mos-

kaluke, SaskatchewansCMA 2013 Female Vocalisto the Year, is a young upand coming singer song-

writer rom Langenburg,Saskatchewan. From herbreakout single, Catch MeI You Can, to her new-

est entry onto the charts,Hit and Run, Moskalukeis making a name or her-

sel in the Country Musicworld with her sassy, con-f dent voice and her noholds barred lyrics.

Live entertainmentand special events con-tinue to be a park summertradition,said Acting ParkSuperintendent RichardDupuis. As we continueto work with our partnersand bring new experi-ences to our visitors, ParksCanadas goal is to oeroutstanding experiencesthat connect people to ourparks in new ways. Our vis-itors will be able to enjoymusic in a casual concertsetting and there is plentyo open space or them toset up their lawn chairsor an unobstructed viewo the stage in Manitobaspremier tourism destina-tion.In addition to the con-

cert, visitors will be able to

take in various activitiesthroughout the day. Te

Wasagaming Chamber o

Commerce will host theever popular Boo in thePark, the annual warm upor Halloween which givesthe parks youngest visi-tors a chance to go trick-or-treating and take part inseveral spooky activities.

Tis year visitors canexperience the new ParksCanada Zone. Tis popularactivity area eatures manylearning and entertain-ing activities or anyonecurious about nature andconservation. Tere willalso be an oENik openhouse or those who havenot yet seen this cozy andhassle-ree addition to themenu o options availableat the Wasagaming Camp-ground.

Te concert is targetedto appeal to all ages. Regu-lar park entry ees will ap-ply or the weekend.

By DIANE BACHEWICH

Glad to see FrancisKuzmak home romBrandon Regional Hospi-tal and doing much betterater her knee surgery.

Visiting with SadieProkopchuk were herdaughter Sandra andgranddaughter aylor oMoose Jaw, SK.A large amily gather-

ing attended the Sichews-ki-Stasiuk amily reunionheld at the Sandy Lake RecCentre on the July 20th

weekend.A baby shower or

little Brielle Antonationheld on the aternoon oSunday, July 21st at theDrop-in Centre was wellattended.Bev Marchischuk had

her nephew Dennis andEva Wahasko o Salmon

Arm, BC visiting with her.Te Communities in

Bloom held their annualBBQ supper on Friday,July 19th at the outdoorkitchen.

Happy Birthday to

Lorrie Lewandoski whotreated everyone at theDrop-in Centre to birth-day cake, ice cream andsaskatoons which hepicked o his Saskatoon

tree.

Gloria Campbell andJanice Duchominsky trav-elled to Medicine Hat, ABto Pick up her two grand-children and take themto Reston, MB to pick uptwo more grandkids. Glo-ria has our little onesrom ages two to six yearsholidaying and keepinggrandma Glo a hopping-happily.

Saturday was a busyday here with the celebra-tion o Heritage Days. Itstarted with the deliciousried bread at the outdoorkitchen. Ten at the frehall were demonstrationso Ukrainian Easter eggpainting by Lisa Rystepha-nuk, rope making by An-thony Rystephanuk, paper owers o roses, carna-tions and lilys by HelenDerhak, wheat weaving byDarcy Rystephanuk andcross stitching by OviaBachewich. Lorrie Lewan-doski was in charge o theclay hut and explainingall the details about it.Speeches and greetings

were given by Helen Le-wandoski, Robert Sopuck,Murray Davies and Do-reen Stapleton. It was niceto see so many volunteershelping out or this event.

Te inant dau ghter o

Chad and Melissa Davieswas hono ured with a babyshower on Friday eveningat the Drop-in Centre. It

was well attended.Janice Duchominsky

and Jean Derhak were outor a ew days, but unor-tunately Jean was takenback by son John Antoni-tion when she was calledor an emergency eyesurgery. Speedy recoveryand hope everything went

well. Janice stayed backor a holiday.

T e Legion Mensmonthly 50/50 draw orthe month o July was wonby Anne Huculak.

Te amily o GeraldRyback helped him cele-brate his 74th birthday onSunday, July 28th. Birth-day cake and coee werethey treat or everyonepresent.

Jennie Coulson oDauphin, MB spent theday with Helen Derhackon Monday.

Congratulations toPam Spitula and Graham

Fediuk who were mar-ried in Winnipeg on Sat-urday, July 27th. Pam isthe daughter o Ennis andDebbie Spitula.On July 21st and 22nd

some 60 descendants o

the late om and Ann Bu-hay held a amily reunionat the arm yard o Ger-ald and Gladys Ryback atLake Audy. Tere wer e 17children under the age oseven present.

Dennis and LaVerneLewandoski o Fort Mc-Murray are spending parto the summer here attheir cabin.

Helen Quellette andson o Cold Lake, ABcalled in or a surprise vis-it with Diane Bachewich.

Also spending the week-end with Diane were neiceShelly, Carlin and VictoriaBedrey o Vanscoy, SK.T ey also attended theSpitula-Stasiuk reunion.

Walter Prokopchuk o

Vancouver is presentlyspending a month withsister Elsie Spitula.Kathy and Brian Braggo Sherwood Park, AB arespending a ew days withmom Sadie Rystephanukand attended the Spitula-Fediuk wedding in Winni-peg.On July 26th and 27th,

once again Gerald andGladys Ryback o Lake

Audy hosted a amily re-union on the Ryback side.It was the frst time someo the cousins rom Chica-go, US have met and werenever out in this part othe country.Leonard and Pam Le-

wandoski held a great get

together, old ashioned

BBQ supper at the NorthHall or amily and closeriends. Also, we got tomeet their uture son-in-law om, fanc o daugh-ter Ayns. A good ellow-ship was held by all.

Wayne and RebeccaLewandoski and childrenMax and Isabella o Win-nipeg are holidaying orthe past three weeks hereat the lake.

Bill Shurvell o Kam-loops, BC and Betty Rosso oronto, ON and DennisShurvell and Bryan Siebeno Calgary, AB spent a ewdays visiting with Earleand Marcia Shurvell andthe rest o the amily.

SANDY LAKE NEWS

Glass Tiger in Free Outdoor Concert

at Riding Mountain National Park

Ifyourlabelreads

13 /08 /31Itstimetorenew!

Call 867-3816

8/22/2019 August 2 2013.pdf

9/20


7+(72:12)0,11('26$

6HDOHG WHQGHUVZLOOEH UHFHLYHG DW WKH7RZQRI 0LQQHGRVDV &LYLF$GPLQLVWUDWLRQ

%XLOGLQJORFDWHGDW0DLQ6WUHHW6RXWK0LQQHGRVD0%5-(XSWR

SPSUHYDLOLQJORFDOWLPHRQ0RQGD\6HSWHPEHU

)RUWKHIROORZLQJZRUNV

&RQVWUXFWLRQRIRRUVZDOOVPHFKDQLFDOHOHFWULFDODQGUHODWHGZRUNVWRFRPSOHWHDQGQLVKWKH0LQQHGRVD3XEOLF:RUNV6KRS 7KH VKHOORI WKLVDSSUR[LPDWHO\

[SRVWIUDPHEXLOGLQJKDVDOUHDG\EHHQFRQVWUXFWHG7KHLQWHULRUOD\RXW

ZLOOLQFOXGHDQRSHQVTIW6KRSDUHDDVZHOODVVTIWRIRIFHDQGZRUN

VSDFHVZLWKPH]]DQLQHDERYH

7KHVHDOHGWHQGHUVDUHWREHPDUNHGDV

5)4%LGIRU0LQQHGRVD3XEOLF:RUNV6KRS3KDVH,,

$VLWHUHYLHZLVVFKHGXOHGIRUDP0RQGD\$XJXVWDW&UHUDU

%D\0LQQHGRVD0%%LGGHUVDUHUHTXLUHGWRDWWHQG6HHWKHWHQGHUGRFXPHQW

DSSHQGLFHVIRUWKHORFDWLRQRI&UHUDU%D\

(DFK WHQGHU PXVW EH DFFRPSDQLHG E\ D IXOO\ H[HFXWHG%,' %21' RQ WKH IRUP

SURYLGHGDQGLQIDYRXURIWKH7RZQRI0LQQHGRVDIRUWKHDPRXQWVKRZQRQWKH7HQGHU

7HQGHUVZLOOEHSXEOLFO\RSHQHGDQGUHDGDWWKHORFDWLRQWLPHDQGGDWHVSHFLHGDERYH

7HQGHUGRFXPHQWVPD\EHREWDLQHGRQRUDIWHU 7XHVGD\$XJXVWWKDWWKH7RZQ

RI0LQQHGRVD&LYLF$GPLQLVWUDWLRQ2IFH0DLQ6WUHHW6RXWK0LQQHGRVD0%RUDWWKHRIFHVRI$VVRFLDWHG(QJLQHHULQJ )LYH'RQDOG6WUHHW6RXWK

:LQQLSHJ0%RQGHSRVLWRID&(57,),('&+(48(LQWKHDPRXQWRIRQ

HDFK7HQGHU'HSRVLWZLOOEHUHIXQGHGRQO\RQWKHVXEPLVVLRQRIDERQDGHWHQGHU

RUWKHUHWXUQRIWKHWHQGHUGRFXPHQWVZLWKLQVHYHQGD\VDIWHUWHQGHUFORVLQJLQ

UHXVDEOHFRQGLWLRQ

7KHORZHVWRUDQ\WHQGHUPD\QRWQHFHVVDULO\EHDFFHSWHG

.HQ*-HQNLQV

&KLHI$GPLQLVWUDWLYH2IFHU

7RZQRI0LQQHGRVD

MAIL THIS FORM WITH PAYMENT TO BOX 930,

MINNEDOSA, MB R0J 1E0 PHONE 204-867-3816

NAME:

ADDRESS:

TOWN:

PROVINCE:

POSTAL CODE:Online subscriptions at


Within Manitoba:

$37.29 tax included

Other Canadian locations:

$34.65tax included

New Subscription

Renewal

Subscribe to The Minnedosa Tribune

By RAVENS GLEN WI

Many rom town en-joyed the annualStrathclair Fair on July16th, starting with the pan-cake breakast, parade, dis-plays and then listening tothe mellow tunes providedby Corrine Mervyn, whoentertained in the rinkin the aternoon. Specialguests joining Corinne onstage were her Dad, Mur-ray Mervyn on guitar andZack Koscielny on violin.

A cold plate supper andball games ended the day.

Shirley Pederson hadher Normal School riendFern Dzaman, rom Den-

ver Colorado visiting heror several days in July.

While here Fern and Shir-

ley attended the 50th An-niversary o Georgina and

Albert McEvoy o Alexan-der, held in Brandon. Fernis a cousin o Georginas.Shirley then drove her toher sister, Hollis Stewartshome in Miniota, whereFern visited or severaldays beore heading hometo Denver. Also, Marilynand Arnold Grambo oBrandon stopped to visitShirley on their way homerom attending a HudsonBay Route meeting in Sas-katchewan recently.

Ralph and ShirleyPedersen and 190 am-ily members attended theStasiuk Family Reunionheld in Sandy Lake Curling

Rink on July 20th. Teir

daughter Gwen has spentmany hours over several

years, compiling the Sta-siuk amily history andspearheading this reunion

with help rom many am-ily members.Congratulations to the

Oak River Bantam AA ballteam on winning the Base-ball Manitoba Bantam

AA Championship July20-21st. Tey beat PilotMound in the fnal 8-1 and

went undeeated throughthe round robin games.Tis qualif es them to playin the Western CanadianChampionships in SwitCurrent in August. eammembers rom Newdale

were Eric Lamb and Rudy

Pederson. Best o luck!

T e Strathclair Mos-quito AA ball team playedin Morden on July 20th atthe Mosquito AA Cham-pionship,15 team tourna-ment, but came out onthe short end o the ourgames they played. New-dale members were ylerDalke, Nathan Lamb, KristiMorris and Ryan Pedersen.

Te Leisure Inns Daleand Melissa Smith, hostedthe third annual DALEF-ES on July 19 -20th. TeBad Marleys entertainedon Friday night in the bigtent and Saturday wasmud-bogging day, withlawn mower races start-ing o, ollowed by Quad-

bogging, with all entries

making it through in goodtime. Tis was ollowed bydierent classes o trucks,

with some going throughin great times and othersneeding a pull out! Hav-ing the time clock and anemcee made it much moreun or the ans.Mona Moyer, ParklandSeniors Co-ordinator tooka group o Strathclair andNewdale seniors on thesupper cruise on the Mar-tese at Clear Lake on July29th.

om and Marge (Su-lymka) Robinson andtheir daughter Cathy vis-ited with Ralph and Shir-ley Pedersen last week on

their way home to Gimli,

rom visiting amily in Sas-katchewan.

Welcome home to GeraldWatkins who has spent thelast three weeks visiting abrother in Brampton, On-tario.It was nice to see Di-

ane (Dymtar) Doerntlienrom Calgary here visiting

with Uncle John Dymterko,at Harrison House and hersister Brenda Passegger,or a ew days last week.Grandson, Pat, Sherry

and Carter Bradley o Win-nipeg visited with Grand-ma, Eileen Bradley last

weekend. Tey attendedthe Folk Festival in Bran-don.

NEWDALE NEWS

By ZELDA FIRBY

Deepest sympathy isextended to IsabellaProven and amily andrelatives on the passingo husband, ather andgrandather Harold Proveno Onanole, MB. A memo-rial service was held onSaturday, July 27th in the

valley at the residence oDave Proven.Patricia Menzies spent

two days in Winnipeg visit-ing her mother. She then ew to Edinburgh, Scot-land where she spent three

weeks. While in Edin-burgh, she was able to takea three-day course in Eliz-

abethan Embroidery. Shethen moved to London,England or three weeks a thrill to be in London

or the Royal birth! She re-turned to Edmonton, ABon Sunday, July 28th.

Recent visitors withRon and Gaileen Kingdon

were Jill Mills and Draytono North Battleord, SK,Janna Kingdon o Winni-peg, MB and Graeme andNakella Kingdon and Norao Dauphin, MB.Marion Ogibowski andRay, along with the Reisamily o Winnipeg and theerry McMillan amily oCalgary AB attended the

wedding o Brett Hextallin Bismark, ND on Friday,July 26th.

Mac, Gordon andCam Ross hosted a 25th

wedding anniversary atthe arm or their parentsBarry and Johanne Ross onSaturday evening.

Ron and MargaretSweet and Marla Pearceand amily have returnedto their homes in Calgary,

AB ater spending a weekwith the Stan and MarkFirbys. Tey were also hereto attend the celebrationo the marriage o MarvinSillen and Grace Yerex inJune. Te celebration washeld at their arm at Erick-son on July 20th.

Heather Emerson-Proven attended the wed-ding o a amily riend in

Winnipeg on Saturday inwhich aryn and RachelLuhowy were in the wed-ding party.

Heather Emerson-

Proven and Rachel Luhowyo Minnedosa spent a weekrecently in New York.

BASSWOOD NEWSBusiness Cards

We print business cards

in all styles & quantities.

Stop in today

or call us

for details.

The Minnedosa TribuneMinnedosa, MB 204-867-3816

Colour Cards

250

$45.00

500

$70.00

1000

$110.00

prices starting at

8/22/2019 August 2 2013.pdf

10/20

10 Te Minnedosa TribuneFriday, August 2, 2013

The Erickson 4-H Beef Club

would like to thank the followingbusinesses for purchasing their 4-H steers.

Minnedosa Pharmacy - 2 steers

Minnedosa Vet Clinic &Parkline Auto

Enns BrothersMinnedosa Insurance

Saler Bachoe & Ken KaneAerial Spraying

R.M. of Minto &

R.M. of Odanah

Chabot Equipment, Drayson

Brothers & PrimetimeEmbroidery

Johns Tax Service & AccountingBurgess Quality Foods &

Integra Tire

Heritage Co-op

Mowat Livestock

Thank you to the following for supporting theErickson 4-H Beef Club Achievement

Erickson Credit UnionRBC

Curle Farms

Crestview Land & CattleClanwilliam General StoreJoe & Helen Woychyshyn

Heritage Co-opLeanne Rowat

Cattlex LTD.

R.M. of MintoR.M. of Clanwilliam

Erickson LegionShirley Montgomery

Allen Kopechuk

Leona SmithParish Backhoe

Minnedosa Credit UnionCraig Pearson

Trackside AngusCook Family

R.M. of OdanahDorothy & Barrie Brooking

Thank you to Minnagro forsponsoring our new club shirts!

8/22/2019 August 2 2013.pdf

11/20


/8&.

8/22/2019 August 2 2013.pdf

12/20


127,&(2)120,1$7,216

585$/081,&,3$/,7

8/22/2019 August 2 2013.pdf

13/20


,QYLWDWLRQVDQG(QYHORSHV

(QYHORSH6HDOV6FUROO5LQJV

7KDQN\RXQRWHV

.HHSVDNHERRNPDUNV

3ODFH&DUGV

&RQIHWWL&DUGV

3HUVRQDOL]HGQDSNLQV

3HUVRQDOL]HGPDWFKERRNVDQGER[HV

7KHSHUIHFW

:HGGLQJ

LQYLWDWLRQLVWKHVWDUWRIVRPHWKLQJEHDXWLIXO

Te Minnedosa ribune

14 3rd Avenue SW

204-867-3816

Minnedosa

Lions ClubCongratulations

Gerri Cooke $500Cathy & Leonard Wark $300Kathy & Gord Lane $200

Winners of the July, 2013

Lions Club 200 Draw

5)

By BERYL PARROTT

Ron and Beryl Parrottvisited Jim Parrott andSally Sykes in Oshawa, ONand at the cottage at Glam-our Lake, ON ater spend-ing two days in TunderBay due to the food in theoronto Airport.We also visited Phyllis

Williams in Gravenhurst,ON, Laura Parrott in Ot-tawa, saw the Parliamentbuildings etc and droveacross the border intoGateneau, QC. ZacharyParrott and Sarah Ferencz

met us at Pappas Restau-rant on the Danord inoronto on the 15th o July.On the 16th o July we vis-ited with George and BethBudd at Lakeeld, ON. Wesaw the Locks on FenelonFalls and the Lit Lock onthe canal at Petersbor-ough, ON.

Te Henderson Fam-

ily held a Family Reunion

at the Franklin Hall on theweekend o the 13th oJuly.Dennis and Irene Mag-

wood visited with Patrick,Leanne, Seth and CamrynMagwood at Rocky Rapids,

AB recently.Congratulations to

Darryl Holyk and Karen

Dalgarno on their recentmarriage. May you enjoymany happy years to-gether.

Tought o the Day:People with many inter-ests live, not only longer,but happier.

FRANKLIN NEWS

By DOREEN TROTT

Congratulations toCandice Bramley andanner Babee who weremarried in Minnedosa onJuly 20th.

A number rom thearea attended the uneral

or Harold Proven at Da-vid Prov ens ar m in theval ley. Our symp athy toJane McKinnon on thispassing o a cousin andto other members o theProven amily.

Condolences also tothe extended Hales am-

ily on the passing o Eva(Hales) Shelvey o Bran-don, age 108.

Word has been re-ceived o the death o Ar-thur Lindenberg o Bran-don. he Lindenbergamily armed where Kenand Sherrie Sharpe now

reside and began theirseed business on thatland. hey were very ac-tive in Cadurcis Church.Jim and Nancy Greer

entertained a large num-ber o amily, riends andneighbours at the armon Sunday.

Mike, Maria, Rose-mary and Jasper Lea o

Winn ipeg ; Shir ley Met-cale o Brandon and Bar-ry and June Humphrieso Clanwilliam visitedlast week with Malcolmand Shirley Rose.

Donna and anya

Northam and childrenElectra and Sam Bohnero Airdrie, AB visited last

week with Don and Mar -garet Northam. Sam is re-maining or a visit.

CADURCIS NEWS

Continued

from Page 1

Keating sideswipedAndersons vehicle on In-terstate #5, near Albany,Oregon, causing Andersonto lose control o her ve-hicle and collide head-on

with an oncoming vehicle.Anderson died at the sceneand several other motor-ists involved experiencedminor injuries.

Keating was indictedin Linn County on rst-degree manslaughter,DUI, reckless driving andthree counts o recklessly

endangering another per-

son. However, in March1998 with a pending trialKeatings lawyer lost allcontact with her and thecourt issued a bench war-rant or her arrest.

Authorities believeshe crossed the Canadianborder in 1998 with hertwo children, ages one andthree.

O cials are unclearo the exact time or the de-tails o Keatings entranceto Canada but explainedthat in the late 1990s it wasunnecessary to produce

passports upon border

crossing.

Keating proceeded tobuild a lie with her twochildren and common-law husband, LeonardMcPherson, on a arm nearMinnedosa.Authorities in Oregon

continued to ollow leadsor several years in hopeso locating Keating to standtrial.

During her timein Manitoba, Keatinghad numerous run-ins

with authorities, includ-ing a conviction or im-paired driving. But, de-

spite her encounters with

law enorcement she

managed to keep her trueidentity a secret.Sixteen years later and

almost 3,000 km away, aninvestigator with ManitobaRCMPs Red River Integrat-ed Border Enorcementeam received a tip thata local woman, who wasoriginally rom Oregon,

was bragging at a bar abouthow she had escaped be-ing prosecuted or a DUI

wreck that killed a womana number o years ago.Manitoba RCMP con-

tacted border o cials

which ound that there wasno Jean McPherson liv-ing as a legal immigrant inCanada.

Canadian authoritiesurther identied Keat-ing by tracing the ngerprints and mug shot she

had earned in Canada with

an American law enorce-ment database. Matchingidentication con rmedthat Jean McPherson wasin act, Jean erese Keat-ing, the ugitive suspect in

Andersons death.Keating was arrested

in Minnedosa on April 4thand was issued deporta-tion documents two weekslater. She was detained in

Winnipeg, MB, as a fightrisk until June 12th whereshe was deported to NorthDakota and barred romre-entering Canada.

Last week Keating re-turned to an Oregon courtroom where a judge sether bail at $5 million. Ac-cording to a motion ledin Linn County the Dis-trict Attorneys O ce willbe seeking an enhanced

sentence based on Ke-

ating f eeing the UnitedStates, evading arrest andbecause o her additionalimpaired driving arrests

while in Canada under anassumed name.Andersons amily was

relieved to hear that theugitive had nally beencaptured and released astatement via the statepolice, While there is noprice to be put on repay-ment or taking a lie, and itcertainly wont bring Jewelback, we are thankul thatnally ater 16 years o run-

ning, hiding and torment,our amilies will have someclosure; knowing that Jeaneresa Keating is in cus-tody and justice will beserved.

American fugitive located in Minnedosa

8/22/2019 August 2 2013.pdf

14/20


Manitoba

The Surveys Act

Public NoticeIn accordance with section 11 of the above act notice is hereby given that the originalMonument at the following location has been lost: N Section 8, Township 14, Range17 WPM. A new monument to perpetuate the original location has been planted by KenBaley, Manitoba Land Surveyor on May 13, 2013.

Any person wishing particulars about the re-establishment of this monument is advisedto contact the following:

Ken Baley or Examiner of SurveysManitoba Land Surveyor Land Title Office100-158 11th Street 276 Portage Ave.Brandon, Manitoba, R7A 4J4 Winnipeg Manitoba, R3C 0B6Phone 204-727-0651 Phone 204-945-2281

Any person having an objection to or having any evidence which he desires to giveagainst confirmation of the re-establishment of this lost corner is to submit any suchobjection or evidence in writing verified by affidavit to the Registrar General within

thirty days from the publication of this notice in the Minnedosa Tribune.

Where no objection to or evidence against the confirmation of the re-establishmentof this lost corner is received by the Registrar General within thirty days afterPublication of this notice, or where any such objection is subsequently withdrawn inwriting, the Registrar General shall confirm the re-establishment of this lost corner.

Registrar GeneralManitoba JusticeLand Title Office276 Portage Ave.Winnipeg, Manitoba R0M 0B6

Reference: Altus File # 164926

Dear Reena,Being a bachelorette,

I have several pizza res-taurants on speed dial and

when the pizza arrives,it oten has a little plastic

white table looking item in

the centre o the pizza. Doyou have any ideas as tohow I can reuse these littlepieces o plastic insteado throwing them out?

Candace

Dear Candace,I know exactly what

you are talking about, re-use them to keep plastic

wrap of a rosted cake orsimilar ood item i yourebringing it somewhere ora party and dont want totransport a reusable ood

storage tub. Or use themor ower arranging, whenusing orists oasis (oasis isthe green oamy stuf theyuse). Stick it to the bot-tom o your container andit will stop the oasis rom

slipping. Florists oten sellthese items or this use.Additional Com-

ment: Many people as-sume that pizza boxes arerecyclable because theyare made rom corrugatedcardboard. However, whatmakes parts o them non-recyclable is what comesinside them, specically,the grease and cheeserom pizza. Food is one othe worst contaminants inthe paper recycling pro-cess. Grease rom pizzaboxes causes oil to orm at

the top o the slurry, and

paper bres cannot sepa-rate rom oils during thepulping process. Essential-ly, this contaminant causesthe entire batch to be ru-ined. Te easiest remedyor this problem is to cut ortear out the soiled portionso your pizza boxes andgarbage them.

Dear Reena,I have a dehumidi er

in my basement that needsemptying every day duringsummer months. Im won-

dering i this water is goodor anything such as water-

ing plants. Trevor

Dear Trevor,Dehumidier wa-

ter should not be used asdrinking water because it isclassied as grey water thatmay contain traces o leadand other dangerous ele-ments. However, there area ew interesting uses ordehumidi er water. Yes,

you can use it to water theplants in your home and

garden. Do not use this

water on plants grown orconsumption because othe risk o harmul con-taminants. You can alsouse dehumidier wa-ter to save on your waterbill by pouring the waterinto your toilet tank until itis ull ater each ush.

Dear Reena,Love your column and

your book series. I was re-cently married and nowlive in a small home. It ismy goal to recycle but I am

not clear on what is con-sidered recyclable. Canyou provide me with a listo items that may be re-

cycled? Signed, Newly

Wed and Clueless

Dear Newlywed!Congratulations and

good or you that you aretaking steps to reduce yourecological ootprint. Teollowing is a list o whatcan be recycled: News-papers, aluminium oodand drink containers,

glass ood and beveragecontainers, steel ood andbeverage containers, PE(#1 plastic) bottle, tele-phone books, magazinesand catalogues, boxboard,

juice boxes, gable top bev-erage containers, HDPE(#2 plastic) containers, #4,#5 and #7 plastics (Gee,can they make the numbersystem more complicatedplease?). For more inor-mation about recyclingcontact your local govern-ment.

Dear Reena,Please tell me whether

or not I can recycle ood

containers such as KratDinner boxes and empty

wa e boxes. Tey do havea recycling symbol onthem which says, Maderom 100% recyclable ma-terial. Does that mean they

were recycled previouslyor does that mean they can

be recycled? Tomas

Dear Tomas,I cardboard has a re-

cycling symbol on it; addit to your blue box. Mostcardboard can be recycled

several times beore thebers become too weak tomanuacture into a newproduct. T ereore, it isa good idea to recycle allo the cardboard items in

your home that carry a re-cycling logo.

Additional Note: Agood rule o thumb is to re-cycle according to the listabove. Plastic grocery bagscannot be recycled butthey can be re-used overand over again. I you havean abundance o plasticbags in your home, donatethem to a second handstore instead o throwingthem into the garbage.

Dear Reena,One o your previous

columns suggests switch-ing to white vinegar to re-duce static cling. I am nothaving much luck withdryer balls. I have two veryhairy dogs; try as I mightto clean of the hair be-ore the washing machine,some ends up in the dryer.

Fabric sotener sheets stillseem to work the best to

get hair of the items, and

onto the lter, but I wouldlike to try an alternative.So, my question is, howdo you put the vinegar inthe dryer, or is it addedto the wash rinse? I lookorward to hearing rom

you. I enjoy your columnvery much and have re-ceived many useul tips.

Candice

Dear Candice,Add hal cup white

vinegar to your washload (not the dryer). Your

clothes will not smell ovinegar and you will saveyoursel a pile o moneyas vinegar is cheap. Fabricsotener sheets and liquidabric sotener do a won-derul job in clogging upthe hoses in your washingmachine. Vinegar on theother hand works to cleanout your washing machinehoses and leaves every-thing resh and static ree.But dont get your hopestoo high, lets ace it as longas you have pets you will bein a constant ur battle. An-other great tip is to lightlysponge your clothes with

water beore putting theminto the washing machine,this helps to remove someo the ur. I you are desper-ate, purchase clothes thatmatch the color o yourdog, this will make pet hairmuch less obvious. Lastly,be sure to empty your linttrap ater each use.

Fabulous Tips

of the Week:

I you want to reusea Styrooam egg cartonheres a neat little trick. For

young children who haveclass parties, ll each cup

with Jell-O and reriger-ate them until they are set.Kids can pop the Jell-O outand enjoy a yummy treat.

Gently exoliate yourskin by rubbing it withbrown sugar. Keep a con-tainer near your shower.Brown sugar is the productthat many spas use; it owseasily down the drain and

leaves skin eeling sot.

THE TOWN OF MINNEDOSA

HOLIDAY

GARBAGE COLLECTION ROUTES

***TO BE OUT BY 8:00 A.M.***

021'$

8/22/2019 August 2 2013.pdf

15/20

TO PLACE AN AD

BY PHONE Call 867-3816Hours to place, correct or cancel ads:Monday - Friday 9 a.m. - 4 p.m.

BY MAIL CLASSIFIED ADVERISINGT Mda b, P.O. Bx 930,

Mda, Maba R0J 1E0

BY FAX 204-8675171

BY E-MAIL [email protected]

Te Minnedosa ribune Ltd. reserves the right todelete any words or phrases deemed by Te Minnedosaribune Ltd. to be objectionable, or to reuse to publish anyadvertisement. Te Minnedosa ribune Ltd. shall not beresponsible or any loss or damage to any advertiser or thirdparty resulting rom the ailure o an advertisement to appearin Te Minnedosa ribune Ltd. or rom any error or omission

in any advertisement which is published.

RATES

$9.00 or frst 40 words, additional words .10 each.

Repeat ads - Hal Price.

Classifed Display - $9.00/col. inch each insert.

(Incl. logo, box & bolding, and centering).

Happy Snaps: (Birthday, Engagement, Wedding, Birth, &Graduation)- $16.00 or the frst 20 words and the picture.

Obituaries: $6.50 per col. inch.

Reach the entire province (50 weekly newspapers) $189.00Westman and Eastman: $119.00

All Ads plus 5% G.S..

DeadlinesClassifed advertisements must be submitted no laterthan noon uesday or insertion in the ollowing Fridaysedition. ALL CLASSIFIED ADVERISEMENS MUS BE

PREPAID BEFORE INSERION.

Te Minnedosa ribune is not responsible ortypographical errors published AFER the frst insertion, nordoes it assume responsibility or errors published as a result oan advertisement placed, changed, or cancelled, by telephone.o ensure your advertisement appears correctly please submit it

in person, by ax, mail, or email.

FOR SALE

15Friday, August 2, 2013The Minnedosa Tribune

O PLACE AN AD

BY PHONE Call 867-3816

Hours to place, correct or cancel ads:Monday - Friday 9 a.m. - 4 p.m.

BY MAIL CLASSIFIED ADVERISING

T Mda b, P.O. Bx 930,

Mda, Maba R0J 1E0

Y A 2 4- 1 1

BY E-MAIL [email protected]

Te Minnedosa ribune Ltd. reserves the right todelete any words or phrases deemed by Te Minnedosaribune Ltd. to be objectionable, or to reuse to publish anyadvertisement. Te Minnedosa ribune Ltd. shall not beresponsible or any loss or damage to any advertiser or thirdparty resulting rom the ailure o an advertisement to appearin Te Minnedosa ribune Ltd. or rom any error or omission

in any advertisement which is published.

RATES

$9.00 or frst 40 wor s, a itiona wor s .10 eac .

Repeat ads - Hal Price.

Classifed Display - $9.00/col. inch each insert.

(Incl. logo, box & bolding, and centering).

Happy Snaps: (Birthday, Engagement, Wedding, Birth, &Graduation)- $16.00 or the frst 20 words and the picture.

O ituaries: $6.50 per co . inc .

Reach the entire province (50 weekly newspapers) $189.00Westman and Eastman: $119.00

A A s p us 5% G.S..

DeadlinesClassifed advertisements must be submitted no laterthan noon uesday or insertion in the ollowing Friday sedition. ALL CLASSIFIED ADVERISEMENS MUS BE

PREPAID BEFORE INSERION.

Te Minnedosa ribune is not responsible ortypograp ica errors pu is e AFER t e frst insertion, nor

oes it assume responsi i ity or errors pu is e as a resu t oan a vertisement p ace , c ange , or cance e , y teep one.o ensure your advertisement appears correctly please submit it

in person, y ax, mai , or emai .

WANTED

RECYCLING

REAL ESTATE COMING EVENTS

CAMPER

FOR SALE

COMING EVENTS

PAINTER

Selling something? Letour readers know! Place anad in Te ribune Classifedsstarting at $9.00 plus tax. (tn).

2005 Ameri-Camp Sum-mit Ridge 30 oot long, bump-er hitch-Queen bed(separateroom)- Quad bunks (separateroom)-Sleeps 8- Large Fridge-expandable kitchen table-Pull out soa bed- Large awn-ing-Sewer, water, propaneand cable hookups. Delivery

Available. $13,499 OBO 204-573-1412 or 204-761-7803

NEW HOME FOR SALE

Beautiul, open-concept 1308sq. t. bungalow fnished

top-to-bottom built in 2010.Home eatures walk-out

basement, 3 + 2 bedroomsand 3 bathrooms located in anewly developed residentialarea o Minnedosa. Nicely

landscaped back yardoverlooks the own rom thedeck or rom the brick patioarea below. In-oor heated

double attached garage.Includes main oor laundrypair as well as stainless

steel kitchen appliances.oo many extras to list.

$338,000.00Call or text 204 867-7405 or

204 867-7154(18-2x)

Come and Go bridalshower in honour o Kristinaman, bride-elect o RyanHyrsak, to be held on Satur-day, August 10th rom 2:00 4:00 p.m. at the home o thegrooms parents, Delmar andKaren Hrysak, 165 3rd St. S.E.

You are invited to a brid-al shower on Sunday, August11, 2013 in honour o AynLewandoski, daughter o Lenand Pam, engaged to omCameron, son o Stew andKathy (o Forrest, MB) at theSandy Lake Community Hallat 2:00 p.m. Everyone Wel-come! (21-2)

Join us or a bridal show-er in honour o KaadaK, bride-to-be o RyanSynchyshyn on Sunday Au-

gust 11th rom 2 4 p.m. at345 2nd St. S.E Minnedosa.Please accept this as your in-

vitation.

Looking or something?Our readers may have it! Placean ad in Te ribune Classi-feds starting at $9.00 plus tax.(tn)

1RZ%XLOGLQJ6FHQLF5LGJH(VWDWHV

&RQGRV

8QLWV$YDLODEOH)RUGHWDLOVFDOO

3HWHU+DUULVRQRI6XWWRQ+DUULVRQ5HDOW\

BRIDAL

SHOWER

Have an upcoming eventyoud like to let everyoneknow about? Get the wordout there with a ComingEvent listing in Te ribune.

Ads starting at $9.00 plus tax.(tn)

UC Bingo at UkrainianHall, uesday nights. Doorsopen at 6:00 p.m. Early bird at7:00 p.m. ollowed by regulargames. License #3359 B1 and3359 BO. (47-tn)

Minnedosa Service to

Seniors Congregate MealProgram serving suppermeals or seniors at theownview Manor 6th ooruesdays, Tursdays, Sun-days starting at 5:00 p.m.$8.00 dine in, $10.00 de-livered. Call 204-867-2198ater 1:00 p.m. on day o themeal or call 204-867-5190or all other inquiries.

Service to Seniors

Menu:

Ag 4h:

Roast bee and gravy, rolls,potatoes, vegetables, salad,

pickles, dessert, tea andcoee

Ag 6h:Baked ham with applesauce, rolls, potatoes,

vegetables, salad, pickles,dessert, tea and coee

Ag 8h:

Roast pork loin with gravy,rolls, potatoes, vegetable,salad, pickles, dessert tea

and coee(12-tn)

Elphinstone Lions Club,8th annual yard sale. Saturday,

August 17, 2013, 10:00 a.m. 2:00 p.m. at the lions park.Bad weather in the hall. ables$10.00 each or 3 or $25.00. obook a table phone 204-625-2423. No outside ood conces-sions. Lunch Available. (21-2)

Newdale HorticulturalSociety ower show. Wednes-day, August 14th, 2013. DoorsOpen at 2:00 p.m. Roast Beesupper rom 5:00 7:00 p.m.

Adults $10.00 Children (6-12yrs) $5.00 5 and underFREE. Everyone Welcome!(21-2x)

Combined PAL/HunterEd Course at anners Cross-ing School, Minnedosa, Sat-urday, August 24th, 2013, 9:00a.m. to 4:00 p.m. $50.00 orHunter Ed, $60.00 or PAL,$100.00 or both. Call MikeBonner 204-848-7582 or in-ormation.

Bethel Lutheran SocietyAnnual Meeting will be heldon uesday, August 20 at 7:30p.m. at the church. All inter-ested parties are invited to at-tend.

Communities inBloom. Te judges are com-ing on August 14th to tourour town and surroundingarea. Looking or volunteersto join us or own Clean Up

on August 8th at 7:00 p.m. atArmitage Park. Bring yourgloves! We supply garbagebags and water.

Garage sale undraiseror Robyn Dragans 11 monthmission trip. I you have anyitems to donate, please dropo at 215 2nd St. N.W. or call204-867-0468 or 204-867-1978. Garage sale will takeplace at the Minnedosa Cal-

vary Church, 52 2nd Ave S.W.on August 17th at 9:00 a.m. (x)

GARAGE SALES

Qualifed Painter with25 years experience. All workguaranteed. Call Blaine at204-874-2399. (43-tn)

aluminum brass zinc steel

e-waste lead

catalytic converters

stainless steel batteries copper

www.urbanmine.ca

204.774.0192

72 Rothwell RoadWinnipeg, MB

(1 block south of IKEA)

The trusted name inmetal recycling

OPEN HOUSESaturday 2 - 3:00 p.m.

8/22/2019 August 2 2013.pdf

16/20

16 Friday, August 2, 2013 The Minnedosa Tribune

HELP WANTED

NOTICE

DAYCARE

BIRTH

ANNOUNCEMENTIN MEMORIAM

LEBOUTILLIERMark and Megan

LeBoutillier and big sister,Brooke o Carberry MBare excited to announce

the arrival o their newestamily member on

May 15, 2013, a boy,Kale Steven.

Proud grandparents areMurray & Gwen LeBoutillier

o Minnedosa MB andEd & Cindy Cuthill

o Moosomin.Proud great-grandparents

are Jim & Nellie LeBoutillierand Doreen Lochhead o

Minnedosa MB,Shirley Cuthill, Ruth Gray

and Gil Gray o Moosomin.

Kingdon Electric is nowworking exclusively on theprojects o one general con-tractor and so will not be ac-cepting work rom any othercustomers. I apologize or anyinconvenience, and wouldlike to thank past customersor their support. (21-2x)

Tank you to Bob Grie-der or his SILVER SPONSORDONAION and we apologizeor the omission in the paperlast week. Your donation likeall other donations receivedare very much appreciated.Minnedosa Ag Society

Little Sprouts ChildcareHome is SAYING in Minne-dosa!!! I currently have one In-ant/Preschool spot and threeSchool-Age spots availablestarting ASAP. I am a licensedECE II, and provide tons o out-door play as well as develop-mentally appropriate activities.I also provide two snacks and ahot home cooked lunch daily.

We go on feld trips withinwalking distance o my house,and oten spend all day explor-ing outside! I am open 7:30a.m. - 5:00 p.m., Monday-Fri-day. Please call Karen at (204)867-3626 or email shaash79@

yahoo.ca, or more inormationor to book a spot! ( 16-tn)

Little Wonders CountryDaycare near Erickson has

various spots available orAugust and September. I alsohave one ull time inant/pre-school spot available late Au-gust. I you would like moreino please call Lynne at 204-636-2931 (21-5)

*(1(5$/0$1$*(5675$7+&/$,5&223

7KH&RRSHUDWLYH5HWDLOLQJ6\VWHP&56LVDXQLTXHPXOWLELOOLRQGROODURUJDQL]DWLRQEDVHGRQWKHIXQGDPHQWDOSULQFLSOHVRIFRRSHUDWLRQ,WLVFRPSULVHGRIDQHWZRUNRIDSSUR[LPDWHO\DXWRQRPRXVUHWDLOFRRSHUDWLYHVDFURVV:HVWHUQ&DQDGDDORQJZLWKWKHLUEUDQFKRSHUDWLRQVDQG)HGHUDWHG&RRSHUDWLYHV/LPLWHG)&/)&/LVWKHZKROHVDOLQJPDQXIDFWXULQJDUPRIWKH&56ZKLFKSURYLGHVWKHUHWDLOFRRSVZLWKDUDQJHRISURGXFWVDQGVHUYLFHV6WUDWKFODLU&RQVXPHUV&RRS/WGLQYLWHVDSSOLFDWLRQVIRUWKHSRVLWLRQRI*HQHUDO0DQDJHU5HSRUWLQJWRDQHOHFWHG%RDUGRI'LUHFWRUVWKH*HQHUDO0DQDJHULVUHVSRQVLEOHIRUDOODVSHFWVRIWKH&RRSVRSHUDWLRQLQFOXGLQJPDUNHWLQJPHUFKDQGLVLQJILQDQFLDOPDQDJHPHQWKXPDQUHVRXUFHVDQGPHPEHUDQGERDUGUHODWLRQV7KHRSHUDWLRQLQFOXGHV)RRG+RPH&HQWUH*HQHUDO0HUFKDQGLVH/LTXRU/RWWHU\$JUR3HWUROHXPDQG3XPSV7KHVXFFHVVIXOFDQGLGDWHVKRXOGKDYHSULRUUHWDLOPDQDJHPHQWH[SHULHQFHZKLFKLQFOXGHVRYHUVHHLQJDODUJHVWDIIFRPSOHPHQW7KHLQGLYLGXDOPXVWDOVRKDYHGHPRQVWUDWHGVWURQJOHDGHUVKLSH[FHSWLRQDOFRPPXQLFDWLRQDQGLQWHUSHUVRQDOVNLOOVDQGVWURQJSODQQLQJDQGRUJDQL]DWLRQDOVNLOOV6WUDWKFODLU&RQVXPHUV&RRSRIIHUVDFRPSHWLWLYHVDODU\DFRPSUHKHQVLYHEHQHILWVSDFNDJHKRXVLQJDQGH[FHOOHQWRSSRUWXQLWLHVIRUDGYDQFHPHQW7RDSSO\SOHDVHVHQGDFRYHUOHWWHUDQGUpVXPpWRWKHHPDLODGGUHVVEHORZRU

6WUDWKFODLU&RQVXPHUV&RRSHUDWLYH/WG

%R[6WUDWKFODLU0E5-&

$WWQ'DUUHQ5R]GHEDHPDLOGBUR]GHED#KRWPDLOFRP

:HWKDQNDOODSSOLFDQWVIRUWKHLULQWHUHVWEXWRQO\WKRVHFDQGLGDWHVFRQVLGHUHGIRUDQLQWHUYLHZZLOOEHFRQWDFWHG&ORVLQJ'DWHIRU$SSOLFDWLRQVLV0RQGD\$XJXVW

WK

0,11('26$&20081,7

8/22/2019 August 2 2013.pdf

17/20

17Friday, August 2, 2013The Minnedosa Tribune

MCNA PROVINCE

WIDE CLASSIFIEDS

Bertha Bun Rudy

April 26, 1917 August 3, 2012

In loving memory o ourmother.

Tank you mother or all

that you have done,You took great care, o your

daughters and son.

You loved us all

rom the very start,

With your warm, kind

and loving heart.

Tank you mother,

or being strong,

While trying to teach us

right rom wrong.

I anytime, we had

a problem,You were there to help

us solve them.

Youd lit us up, when wewere eeling blue,Tank you mother, or we

could always count on you.You were such anawesome mother,

Te love you showedwas like no other.

Tank you mother or yourdear sweet love,

Now youll watch over us romheaven above.

Remembered with love,Keith, Myrna, Frank and

Grace, Bobbie and Stewart,Joan and Clif

(x)

Bun RudyAugust 3, 2012

Mother and Grandmother

In tears we saw y ou sinkingWe watched you ade away.

Our loving hearts were brokenWhen you oughtso hard to stay.

But when we saw you sleepingSo peaceully and

ree rom pain.We could not wish you back

o sufer that again

We love and miss you MumLove Te Family

(x)

IN MEMORIAM OBITUARIES

DIANE SLATER

(nee McNabb)

In Loving Memory o Diane Slater who was born on May 27th,1942 and passed away July 5th, 2013 at the age o 71.

Diane lost her courageous battle with cancer at Health Sci-ence Centre Hospital with her daughters at her side.

Diane will be lovingly remembered by her daughtersMelody (Gord) Boszko, Shelli (Doug Carlyle) Falconer, Sherri(Rick) Desrosiers and her grandchildren: Leah, Lyndsay, Brett,Ecko, Shawn and Nathan, Sister Sandi McNabb and niece

Victoria and nephew William and extended amily.She was predeceased by her parents Donald and Olive

McNabb and also by her late husband Don Slater.Dianes greatest pleasure was her yearly travels to Mexico in

particular Boca Beach. So much so that it was one o her wishessome o her ashes be spread with Dons, overlooking the beachat Boca, Mexico.

Donations in memory o Diane may be made to Friends ForFurry Friends Animal Rescue, Suite 208-740 Rosser Ave. Bran-don, MB R7A 0K9 or Cancer Care Manitoba.

ANNE WALL

Anne was born on February 10,1928, daughter o Johan and

Helena Wiebe, on a arm nearHorndean, Manitoba.

On July 20, 1952, she marriedthe person she would continueto love or 61 years Henry

Wall. Tey made their rsthome in Morden, Manitoba,

where they began raising theirour children. Te amily moved

to Erickson, Manitoba in 1968 andbegan arming.

Anne enjoyed arming; she workedside by side with Henry and was attached to the land and the

animals. She and Henry enjoyed travelling to visit amily andriends or just or the adventure.

Anne was a loving wie, mother, grandmother, great-grand-mother and riend. She was gentle, patient, kind, tender-hearted and orgiving. She was quick with a smile and had a

witty sense o humour. She loved lie.Anne passed away peaceully with her amily at her si de ues-

day, July 23, 2013, at the age o eighty-ve.She was predeceased by her sister Elizabeth and brothers

John and Jacob. She leaves to mourn her passing her husbandHenry; daughters Joan (Brock), Gladys (Dwight), Leona (Mur-ray) and son Loren (Sandy); grandchildren Lauren, Lyndie,Kristin, Dana, Jacob, Colin and Erik ; great-grandchildren Isaac,Levi, Grace, Gabriella, Ava, Aaron, Jeremiah, Brayden, Raina,Danika, Chrissy, and Giana; sisters Agatha and Helen (Peter);brothers Neil (Kathy) and Abe (Lenore); sisters and brothers-in-law; and many nieces and nephews.

Anne was loved. She will be missed by all who knew her.

And you know the way to the place I am going.Service was at Hilltop Baptist Church, in Erickson, Manitoba,

Sunday, July 28, 3:00 p.m.Memorial donations may be made to the Mennonite Central

Committee or World Vision.Raes Funeral Service, Erickson, were in care o arrangements.

PASTERSHANK

It is with great sadness that ouramily announce the passing oeenie Pastershank on ues-day, July 9th, 2013 at the SandyLake Personal Care Home atthe age o 95.

eenie was born in the Har-rison area on January 26, 1915.

She attended schooling at theMartin Dale School. eenie

married Frank Pastershankin Olha, MB on June 14, 1932.

Tey armed at Wisla , Manitobauntil 1937, then moved to Elphinstone.

Frank and eenie moved to Minnedosa in 1971 when they re-tired rom arming.

eenie was devoted to her husband, amily, riends. Shepicked many pails o wild ruit or her amily over the years.

Also was a very avid gardener and provided many jars o ruit,vegetables and pickles.

For many years she enjoyed playing Bingo and cards withamily and riends.

eenie was predeceased by her late husband Frank o58 years, inant son Larry, her parents Joeseph and MaryKristalovich ands her nine siblings, three sister-in-laws andthree brother-in-laws.

eenie is survived by her son, Edward (Sylvia) Pastershank,Daughters, Helen (Ed) Antosen, Mabel (Nick) Stebeleski: Fivegrandchildren, Nine great grandchildren and our great greatgrandchildren. She is also survived by sisters, Lavinia, Regina,Brothers, Nick, Joe and numerous nieces and nephews.

Te uneral service was held Saturday, July 13, 2013 at theSandy Lake Holy Ghost Ukrainian Catholic Church with Fr.Emil Kardasinec o ciating. Interment ollowed at the CatholicCememtery. I riends so desire, donations maybe made to theSandy Lake Personal Care Home tub und.Raes Funeral Service o Shoal Lake was in care oo arrange-

ments.Vichnaya Pomyat!

MCNA PROVINCE WIDE CLASSIFIEDS

AUTOMTOIVE

Guaranteed approval driveaway today! We lend moneyto everyone. Fast approvals,best interest rates. Over 500

vehicles sale priced or im-mediate delivery OAC. 1-877-796-0514. www.yourapprove-donline.com.

FARM MACHINERY

RUBBER RACKS mini ex-cavators, tracked loaders,dumpers, trenchers, horizon-tal drills. Lets see what wecan do! rackmasters CanadaLtd. 1-866-553-0090. Calgary403-771-6008. Vancouver604-218-2825.

FINANCIAL SERVICES

MoneyProvider.com. $500Loan and +. No Credit Re-used. Fast, Easy, 100% Se-cure. 1-877-776-1660.

FOR RENT

Approximately 1300 sq. t. re-tail space or rent in CrystalCity. Available immediately.Contact Jack Lewis 204-873-2441 or Bill McKitrick 204-873-2091.

FOR SALE

SAVE! NEW! WRAPPED! NewBed Line - Queen Pillow-op Bed Set $395! (King set$595.00) (6-piece Bedroom

Suite including Pillow-opBed set $900). 12 DrawerQueen Storage Bed $495! 5piece 42 round drop lea set$459. SOLID RUSIC OAK a-ble Set 60 to 96 (No Veneer)6-high back padded chairs$2,295 ($4,200 value)! Leather3-Piece Set! Soa, Love Seat &Chair. Sacrice $1,495, Store

Value $3,100. (Can Separate)Call: 204-571-1971. Brandon.

2004 Mustang, Dark Red,98,000 KMs, 3.8 litre, V6 Stan-dard rans, Satied, Beauti-ul Condition. $7,000 Firm.Baldur, MB 204.535.2276 or204.245.0165 No rades.

Advertisements and state-ments contained herein arethe sole responsibility othe persons or entities thatpost the advertisement, andthe Manitoba CommunityNewspaper Association andmembership do not makeany warranty as to the ac-curacy, completeness, truth-ulness or reliability o such

advertisements. For greaterinormation on advertisingconditions, please consult the

Association s Blanket Adver-tising Conditions on our web-site at www.mcna.com.

BAERIES FOR EVERY-HING Automotive, arm,construction, AV, marine,cycle, gol carts, solar. Phones,tools, radios, computers, etc.

Reconditioned, obsolete, andhard-to-nd batteries. SOLARpanels, inverters, and acces-sories. Te Battery Man Wpg.1-877-775-8271 www.battery-man.ca

DISCONNECED PHONE?Phone Factory Home PhoneService. No One Reused! Free

Activation! Low Monthly Rate!Calling Features and Unlim-ited Long Distance Available.Call oday! 1-877-336-2274.

www.phoneactory.ca.

MANUFACTURED HOMES

HOMES, COAGES & More.RMI - Ready to Move in. Call1-888-733-1411; rtmihomes.

com. Red ag Sale on now!

MOBILE HOMES

New 2013 SRI mobile homemodels AVS-20631 and AV-667 are now onsite or view-ing. Custom order your newhome now or all delivery.Glendale Mobile Home Sales,Brandon 204-724-7907

SERVICES

Notre Dame Used Oil Prov-ince Wide Collection, usedoil over 500 L, used oil l-ters, containers, antireeze,batteries. Ecocentres, Rms,

Businesses, Farms. Phone1-204-248-2110, www.notre-dameusedoil.com

STEEL BUILDINGS

SEEL BUILDING SIZZLINGSUMMER SAVINGS EVEN!20X22 $4,188. 25X24 $4,598.30X36 $6,876. 32X44 $8,700.40X52 $12,990 47X70 $17,100.One end wall included. Pio-neer Steel 1-800-668-5422.

www.pioneersteel.ca

SEEL BUILDINGS/MEALBUILDINGS 60% OFF! 20x28,30x40, 40x62, 45x90, 50x120,60x150, 80x100 sell or bal-ance owed! Call 1-800-457-2206 www.crownsteelbuild-ings.ca

We Do It All!Social Tickets, Raffle Tickets, Business

Cards, Receipt Books, Flyers, Posters,

Colour Copying

867-3816

Tribune Printing

BUILD UP

YOUR

CLIENTELE

Advertise with the

Minnedosa Tribune

204-867-3816

BookYour Spot

Today

8/22/2019 August 2 2013.pdf

18/20

M & MAUTO BODY

All Auto Body Repairs

Ph: 867-20835 Main St.North

Friday, August 2, 2013 The Minnedosa Tribune

ACCOUNTING

Income Tax Filing Farm and Business Accounting Payrolls Government form filing

Phone 867-5550Fax 867-5808

116 Main St. S.

Minnedosa, MB R0J 1E0

Tax Ser v i c e& A c co u n t i n g

Parish BackhoeServices

Septic Systems Weeping tiles

Water Sysyems Basements

All types of excavation

Certifed in waste

water management

Call: Ian874-2134 or 867-0383

BIRBIRCHCHCONSTRUCTION

CommercialResidential

GENERAL

CONTRACTORS

LTD.

867-0400

0r

867-7506

PRAIRIE CONCRETEMinnedosa - 867-3853

Ready Mix ConcreteConcrete orms, Rebar, Wire Mesh,

Weeping Tile, Concrete Sealer, Snap Ties

All at Competitive

prices

Specializing in water & sewerinstallation & repair

All types of excavation Basements, Demolition Snow removal Gravel, Topsoil Sales of septic tanks

Tony 867-7582

Kirk 867-0180

Clint Moffat

& Sons Ltd.OFFICE

867-3356

Sand & Gravel Products

Excavating

Water & Sewer

Installations

Site Preparation

Landscaping

Snow Removal

ALLARD

YAKUBCHAK

WIRCHCERTIFIED GENERAL

ACCOUNTANTS

George Allard, C.G.A.*

Gateway Street

Onanole, Mb

848-7413

Howard Wirch, C.G.A*

9-515 4th Ave

Shoal Lake, MB

759-2680

Dauphin Office - 15 1st Ave S.W.

Phone: 638-3005

Fax: 638-5817*Denotes Professional Corporation

PROPERTIES FOR SALE

CONSTRUCTION ELECTRICAL

BURTON

Enterprises Ltd.

Air Conditioning,Heating & Electrical

30 Years

Ex perience!!

Bus : 867-3950

Fax:

867-2340

Refridgeration

70 Main St, S.Minnedosa, MB.

Personal Tax Returns

Farm Returns

Business Returns

Cash Back

Phone: 867-5124

18

EAVESTROUGH

$1'FRQWLQXRXVSUHQLVKHGHDYHVWURXJK

6LGLQJ5RRQJ6RIW)DVFLD&ORVHGFHOO

3RO\XUHWKDQH6SUD\IRDP%ORZLQ$WWLF:DOO

)LEUH,QVXODWLRQ)LUH5HWDUGHQW&RDWLQJ

PFUHDO#OLYHFD

AUTO CONSTRUCTION

B

BA SSWO OD

A SS

WOOD

A

A UTO

UTO B

BODY

ODY

A ND

A ND G

G LA SS

LA SS

WILD LIFE COLLISION EXPERTS

WEST ST., BASSWOODPHONE: 874-2270

E-GLASS REPLACEMENT

& REPAIRS

Catharine M Gijsbers.Certified General Accountant.Professional Corporation - 213 2NDStreet NEBox 385, Minnedosa MB R0J 1E0

x Personal & Corporate Income Taxx Accounting and payroll servicesx AgExpert Analyst Certified Advisorx V.I.P. InstallerGroup trainerTel: 867-3884 Cell: 867-0190Email: [email protected]

AC

FINANCE

Minnedosa

Credit

UnionMain line867-6350

Joanne Clarke867-6364

Susan Glasgow867-6353

Alayna McTavish867-6354

Debbie Strelczik867-6359

Lori McNabb867-6360

Harvey Wedgewood867-6363

Carol Dalrymple867-6367

Carol Taylor867-6368

Kim Robinson867-6352

Jeff Dusessoy

867-6369Sylvia Firby867-6361

Candice Brown867-6362Brad Ross867-6366

Fax867-6391

MCU MCU

BookThisSpotforonly$13.74per

week!

Rick Taylor 867-7551

[email protected]

/RW0LQQHGRVD%HDFK&RWWDJHDW0LQQHGRVD/DNHZLWKQLFHYLHZV7KLVEHGURRPSLHFHEDWKFRPHVIXOO\IXUQLVKHGDWDQDIIRUGDEOHSULFH6FUHHQHGGHFNRYHUORRNVWKHYDOOH\DQGODNH&RWWDJHLVZLQWHUL]HG

DQGKDV$&DQGFDEOH79

WK6W1(8QLTXHEHGURRPEDWKIDPLO\KRPHLQGHVLUDEOHODNHDUHD*UHDWSDWLRDQGGHFNZLWKKRWWXERXWGRRUUHSODFHDQGEHDXWLIXO[LQJURXQGSRRO9HU\ZHOOPDLQWDLQHGKRPHVLWVRQORWDQGIHDWXUHVVN\OLWPDLQEDWKZLWKSRXUHGPDUEOHVXUURXQGDQGVRDNHUWXE)LQLVKHGEDVHPHQWKDVDIDPLO\URRPODUJHEHGURRPSLHFHEDWKPHGLDURRPXWLOLW\VWRUDJHDQGIRRWFHLOLQJV

VW6W1:

ELOHYHOKRPHIHDWXUHVEHGURRPVIXOOEDWKVQLVKHGEDVHPHQWFHQWUDODLUDQGDLUH[FKDQJH+DUGZRRGWLOHQHZFDUSHWQHZGRRUVDQGGHFNZLWKJODVVUDLOLQJ'RXEOHGHWDFKHGJDUDJH

ZLWKQHZVKLQJOHV

QG6W1:

7KLVVTXDUHIRRWEHGURRPKRPHLVYHU\WLG\DQGZHOO

PDLQWDLQHG+RPHIHDWXUHVODUJHEHGURRPVPDLQRRUXWLOLW\URRPDQGFHQWUDODLUFRQGLWLRQLQJ1HZVKLQJOHVPRVWO\QHZHUZLQGRZV

$SSOLDQFHVLQFOXGHG

VW6W1(0LQQHGRVD7KLVVTIWEXQJDORZKRPHLVORFDWHGLQDJUHDWDUHDDQGIHDWXUHVDIDPLO\URRPRIIWKHNLWFKHQODUJH

GLQLQJURRPDQGEDVHPHQWUHFURRP0DLQRRUEDWKZLWKMHWWHGWXEDQGSLHFHEDVHPHQWEDWK)RUFHGDLUJDVIXUQDFHFHQWUDODLUDQGZDWHUVRIWHQHU

'RXEOHGHWDFKHGJDUDJH

WK$YH6:9HU\VROLGVTIWEHGURRPEXQJDORZZLWKDIHQFHG\DUGDQG

WRZQYLHZ8SGDWHGZLQGRZVVLGLQJLQVXODWLRQQHZVKLQJOHVIHQFHDQGQHZODPLQDWHRRULQJ/RFDWHGRQDTXLHWVWUHHWFORVHWRVFKRRODQGGRZQWRZQ

/LYLQJLQ\RXU

&RPPXQLW\

VW$YH1:

*UHDWVWDUWHUKRPHQHDUVFKRRO6KLQJOHVVLGLQJDQGDOOZLQGRZVXSGDWHGVLQFH0DLQRRU

EHGURRPDQGEHGURRPVXSSHURRU/DUJHEULJKWNLWFKHQDQGODUJHOLYLQJ

URRPZLWKKDUGZRRGRRU%LJIHQFHG\DUG

1(:/,67,1*

6WUDWKFODLU6SDFLRXVEHGURRPKRPHRQODUJHORWLQ6WUDWKFODLU/DUJHHQWUDQFHOHDGVWRWKH

VSUDZOLQJHDWLQNLWFKHQZLWKDQDEXQGDQFHRIRDNFDELQHWV7KHGLQLQJURRPDQGVXQNHQOLYLQJURRPDUHYHU\

QLFHZLWKORYHO\ZRRGZRUNDQGKDUGZRRGRRULQJ7KHQLVKHG

EDVHPHQWKDVDVHFRQGNLWFKHQDQGFRXOGVHUYHDVDPRWKHULQODZVXLWH7KLVKRPHLVLQH[FHOOHQWFRQGLWLRQDQGKDVEHHQ

QLFHO\XSGDWHGWKURXJKRXW

'0LQQHGRVD%HDFK7KLVFR]\FRWWDJHDW0LQQHGRVD/DNHLVDUHDOFKDUPHU.LWFKHQVXQNHQOLYLQJ

URRPEHGURRPVDQGDSLHFHEDWKURRPDOODGGWRWKHOLYHDELOLW\7KHGHFNRYHUORRNVDVPDOO\DUGZLWKDUHSLW6XPPHUVDWWKHODNHFDQEH

DIIRUGDEOH

1(:/,67,1*

Gwen UsickBroker/Realtor

Ph: 204-867-4657Fax: 204-867-2150

[email protected]

PRAIRIEMOUNTAINIndependently Owned

and Operated

0LQQHGRVD

6WXQQLQJULYHUIURQW%GP%DWKKRPHGHVLJQHGIRU

ZKHHOFKDLUDFFHVV&HQWUDODLUJDVUHSODFHMHWWHGWXEKDUGZRRGRRUVJDUDJH

FDUSRUWIHQFHG\DUG[GHFNPXFKPRUH0/6

Take a tour on realtor.ca or our website

www.remax

-prairie mountain-npwa.mb.com

0LQQHGRVD4XDOLW\%GP%XQJDORZZLWKDWWDFKHG26VLQJOHFDU

JDUDJH*'2RQDGHHSORWFORVHWRGRZQWRZQ0DLQEDWKODXQGU\+(JDVIXUQDFHFHQWUDODLUSDWLRYHJHWDEOH

JDUGHQ$UHDOJHP0/6

50RI2GDQDKVTIWKRPHZLWKPXQLFLSDOZDWHUEGPEDWKWULSOHFDUJDUDJHQHZHUZLQGRZV7KHUHDUHIHQFHGSDVWXUHV[VKHGEDUQVKD\ODQG

JURRPHGZDONLQJSDWKYHJHWDEOHIUXLWJDUGHQVDOO

ORFDWHGRQDFUHV0/6

0LQQHGRVD8SGDWHG%GP%DWKVWRUH\FKDUDFWHUKRPH

)HDWXUHVVWDLUFDVHVWRPDLQVOHHSLQJDUHDQGWRPDLGV

TXDUWHUV9HUDQGDKVPXGURRPFHQWUDODLU

UHSODFHGHFNPRUH0/6

Working in your community to meet all

your real estate needs --

Your Home is Where M Heart Is

www.suttonharrison.comLouise McInnes204-867-4346

'0LQQHGRVD%HDFK5RDG

3ULYDWHEHGURRPFDELQ/RWVRIXSJUDGHV

3DQRUDPLFYLHZ

0/6

WK$YH6:VTIW

EHGURRPRQD[IHQFHG

FRUQHUORW6SDFLRXVIDPLO\

KRPH

0/6

35,&(5('8&('

0DLQ6WUHHW1VTIW

EHGURRPRQDQLFHO\KHGJHGFRUQHUORW

/RWVRIXSJUDGHV

0/6

UG$YH6:VTIW

EHGURRPRQDORYHO\WUHHGIHQFHG

FRUQHUORW*UHDWORFDWLRQ

0/6

50RI0LQWR)DEXORXVEHGURRPFKDUDFWHUKRPHRQDFUHVZLWK

FUHHNDQGLQJURXQGSRRO

0/6

3OHDVHVHH0/6IRUGLUHFWLRQVRUFDOORUWH[W

6KDG\/DQH2WWHU/DNH

VTIWQHZO\EXLOWFDELQRQD

[WUHHGORW2ZQ

\RXURZQSODFHDWWKHODNH

0/6

8/22/2019 August 2 2013.pdf

19/20

RESTAURANT

PRINTING

More than just a

Newspaper!

We offer a full line of

Custom Printing.

Posters, Brochures, Invoices,

Envelopes, Business Cards,

Letterhead, Tickets, Invitations

and MORE! We also provide

Colour Photocopying, Pho

August 2 2013.pdf

Documents

Transcript of August 2 2013.pdf