Post on 22-Feb-2022
Transcriptional Control during Quorum Sensing byLuxR and LuxR Homologues
Marie A. Faini
Thesis submitted to the faculty of the Virginia Polytechnic Institute and State University
in partial fulfillment of the requirements for the degree of
Master of Science
in
Biology
APPROVED
_________________________Ann M. Stevens, Chair
_________________________ _________________________ David L. Popham Timothy J. Larson
April 23, 2003
Blacksburg, Virginia
Keywords: Vibrio fischeri, quorum sensing, LuxR, RNA polymerase, transcriptionalactivation, luminescence, intergenic suppression
Copyright 2003, Marie A. Faini
ii
Transcriptional Control during Quorum Sensing byLuxR and LuxR Homologues
Marie A. Faini
Ann M. Stevens, Chair
Department of Biology
ABSTRACT
Quorum sensing is a mechanism used by many proteobacteria to regulate
expression of target genes in a population-dependent manner. The quorum sensing
system of Vibrio fischeri activates the luminescence (lux) operon when the autoinducer
signaling molecule (N-3-oxohexanoyl homoserine lactone) is recognized and bound by
the activator protein LuxR. LuxR subsequently binds to the lux box centered at –42.5 bp
upstream of the transcription initiation site and activates transcription from the lux
operon promoter, resulting in the emission of light at high cell densities. LuxR consists
of 250 amino acids arranged into an N-terminal (regulatory) domain and a C-terminal
(activation) domain, and is thought to function as an ambidextrous activator capable of
making multiple contacts with the alpha and sigma subunits of RNA polymerase
(RNAP). Published work describing the results of alanine scanning mutagenesis
performed on the C-terminal domain of LuxR (residues 190-250) has identified residues
(K198, W201 and I206) that appear to play a role in positive control of transcription
initiation. Additional mutagenesis of residues 180-189 has been undertaken via a three-
primer or four-primer PCR-based method in this study. Variants of LuxR were screened
for their ability to activate luciferase production and to repress transcription from an
artificial promoter, and production of full-length LuxR was measured, in an attempt to
identify additional positive control variants. No additional positive control variants were
found in this study. Work has also been undertaken to identify intergenic suppressors
between positive control variants of LuxR and the RNAP alpha subunit, RpoA. Starting
with a recombinant Escherichia coli strain encoding the lux operon and LuxR variant
iii
I206E, a random chemical mutagenesis was performed on a vector encoding RpoA.
Following transformation of the mutated plasmids encoding RpoA, high throughput
luminescence assays were used to identify isolates with phenotypes brighter than the
control. Isolation of an intergenic suppressor will confirm the existence of protein-
protein interactions between LuxR and RpoA within the transcription initiation complex.
The ability of other LuxR family members to establish productive protein-protein
interactions with RNAP necessary for transcription initiation was also examined. LuxR
homologues EsaR of Pantoea stewarti ssp. stewartii, a repressor of known function, and
ExpR of Erwinia carotovora subsp. carotovora were also analyzed for their ability to
activate the lux operon, as well as to repress transcription from an artificial promoter
containing the lux box.
iv
ACKNOWLEDGEMENTS
I thank Ann Stevens for her continuous guidance, inspiration and enthusiasm. Shemanages to strike the perfect balance between providing direction and encouragingindependence. In the past two and a half years, I felt I always had a great support systemwith her by my side. Hope I didn’t give you too many gray hairs!!!
I thank my committee members David L. Popham and Timothy J. Larson for all of theirsupport and guidance during my time here at Virginia Tech. Your encouragement gaveme the strength to continue onward during my failed experiments; thanks for the vote ofconfidence.
I am grateful to Lauren Senty for outstanding technical assistance in the construction andanalysis of the LuxR variants. She was a bright ray of sunshine in our windowlesslaboratory on the fourth floor of Derring. Hope that hike went well! A big thanks to allcurrent and past members of the Stevens’ Lab for their support and good nature throughall of my experiments. To Debbie and Mary: thanks so much for being there for me!!!
This work encompassing the site directed mutagenesis and analysis of luxR, as well as theinteractions between RNAP and LuxR was supported by NSF CAREER award MCB-9875479.
I thank the laboratory of E. Peter Greenberg for the materials that they have provided tous. I also thank Mark Urbanowski for supplying our laboratory with the lambda reporterstrains. Their support allowed for the current thesis research.
I thank the laboratory of Susanne Beck von Bodman for their support, assistance, andperseverance in our quest together in analyzing the ability of EsaR and ExpR to recognizeand bind the lux box. I am grateful to Jessica Ball for all of her hard work and help inconstructing plasmids and performing assays in this project.
My parents have always encouraged me and guided me to independence, never trying tolimit my aspirations. I am grateful to them and amazed at their generosity. I couldn't havedone it without you! Most importantly I thank my fiancé David O’Brien, who has shownuntiring patience and support, reminding me of my priorities and keeping things inperspective. I look forward to our new life as we start it together. You are myeverything!
v
TABLE OF CONTENTS
Page
ABSTRACT ii
ACKNOWLEDGEMENTS iv
LIST OF FIGURES vii
LIST OF TABLES ix
CHAPTER ONE: Literature Review
QUORUM SENSING 1
LuxR: THE ACTIVATOR PROTEIN 4
LuxR HOMOLOGUES 10
CHAPTER TWO: Amino Acid Residues Involved in Protein-Protein
Interactions Between RNA Polymerase and the Quorum Sensing Activator LuxR
INTRODUCTION 18
MATERIALS AND METHODS 20
RESULTS AND DISCUSSION 36
CONCLUSIONS 46
CHAPTER THREE: Ability of EsaR and ExpR, Two LuxR Homologues,
To Bind To the lux Box and Activate the lux Operon
INTRODUCTION 47
MATERIALS AND METHODS 48
RESULTS AND DISCUSSION 58
CONCLUSIONS 61
vi
TABLE OF CONTENTS
Page
CHAPTER FOUR: Annotating the Vibrio fischeri Genome
FIAT TEAM 62
OVERALL CONTRIBUTIONS 63
CHAPTER FIVE:
REFERENCES 64
CURRICULUM VITAE 70
vii
LIST OF FIGURES
Page
CHAPTER ONE
Figure 1: Model of quorum sensing in Vibrio fischeri at high cell densities 2
Figure 2: Cartoon Model of the Two Domain Structure of LuxR 5
Figure 3: Arrangement of the lux operon genes 6
Figure 4: Cartoon Model of the five subunit structure of Escherichia coli 7 RNA polymerase (RNAP) holoenzyme and its interaction with LuxR bound to the DNA at the luxI promoter of the lux operon
Figure 5: Amino Acid Sequence Alignment between Lux R and LuxR 9 homologues TraR and NarL
Figure 6: Amino Acid Sequence Alignment between Lux R and LuxR 15 homologues EsaR and ExpR
CHAPTER TWO
Figure 7: Map of expression vector pSC300 24
Figure 8: Luminescence Assays for LuxR Variants 37
Figure 9: Luciferase Assays for LuxR Variants 38
Figure 10: DNA Binding/Repression Assays for LuxR Variants 40
Figure 11: Western Immunoblot of LuxR Alanine Substitution Variants 42
Figure 12: Intergenic Suppression Results for IGS1 and IGS2 44
Figure 13: Complementation Analysis for Intergenic Suppressors 45
viii
LIST OF FIGURES
Page
CHAPTER THREE
Figure 14: Plasmid Map of pBAD-LuxR (pJKB1-1.5) 52
Figure 15: Plasmid Map of pBAD-EsaR (pJKB2-11.11) 54
Figure 16: Plasmid Map of pBAD-ExpR (pJKB3-1.2) 56
ix
LIST OF TABLES
Page
CHAPTER TWO
Table 1: Mutagenic primers for luxR 21
Table 2: Amplification primers for luxR 22
Table 3: Sequencing primers for luxR 22
Table 4: Sequencing primers for rpoA 22
CHAPTER THREE
Table 5: Primers for luxR amplification 49
Table 6: Sequencing primers for pBAD-LuxR, EsaR, and ExpR 49
Table 7: Primers for esaR amplification 49
Table 8: Primers for expR amplification 49
Table 9: Mutagenic primers for expR 49
Table 10: Activation Assays for LuxR, EsaR and ExpR 59
Table 11: Repression Assays for LuxR, EsaR and ExpR 60
1
CHAPTER ONE
LITERATURE REVIEW
Quorum Sensing:
Many bacteria have the ability to regulate expression of specific target genes in a
cell population-dependent manner. This mechanism of gene regulation is termed quorum
sensing and is seen in Gram-positive as well as in Gram-negative bacteria. This process
depends on signaling molecules produced by the cells. In Gram-negative bacteria, these
signals are acyl-homoserine lactones and are commonly termed autoinducers. Upon
reaching a threshold at a critical concentration, the autoinducer is able to stimulate the
activation and/or repression of target genes (reviews: Miller and Bassler, 2001; Fuqua, et
al., 2001; Withers et al., 2001).
In the Gram-negative marine bacterium, Vibrio fischeri, the quorum sensing
model has been extensively studied using the luminescence or the lux operon and its
ability to produce light (Nealson et al, 1970). V. fischeri is capable of free-living in
seawater, as well as living in symbiotic relationships within the light organs of the
Hawaiian squid, Euprymna scolopes, and with other fishes (Visick et al., 2000). In order
for the system to work, the Vibrio fischeri autoinducer, produced by the autoinducer
synthase (LuxI), and the autoinducer receptor protein, LuxR (an activator), form a
complex. It has been proven in V. fischeri that the autoinducers can freely diffuse across
membranes (Kaplan and Greenberg, 1985). At a high concentration, the autoinducer-
LuxR complex binds to the promoter region at the lux box of the lux operon, and
activates transcription, (Figure 1). Transcriptional activation of the operon leads to the
2
Figure 1: Model of quorum sensing in Vibrio fischeri at high cell densitiesAt high cell densities, a critical concentration of autoinducer (blue diamonds) is reached. When complexes of LuxRand autoinducer form they bind at the lux box, and together with RNAP, activate transcription thereby producingbioluminescence.
lux box
LuxR
LuxR
LuxI
luxR
3-oxo-C6-HSL
luxI C D A B E G
LIGHT
2
3
production of proteins Lux I, C, D, A, B, E and G. LuxC, D, and E are involved in the
synthesis of the aldehyde substrate for luciferase; LuxA and B are the α and β subunits of
the luciferase enzyme, and LuxG has no known function corresponding to
bioluminescence. A positive feedback loop occurs as the LuxI protein is produced; LuxI
synthesizes the autoinducer, N-3-oxohexanoyl homoserine lactone (3-oxo-C6-HSL). As
the V. fischeri autoinducer (VAI) accumulates, the molecules form complexes with LuxR,
the transcriptional activator of the system, which binds at the lux box and increases light
production accordingly (Fuqua et al., 1996; Eberl et al. 1999; Withers et al., 2001). Thus,
activation of this operon occurs only at high cell density. Within the light organ crypts, a
high cell density is reached and activation of the operon is possible (Nyholm and McFall-
Ngai, 1998). However, in the low nutrient environment of the open ocean, the low cell
density of V. fischeri cells prevents activation of the lux operon. At low cell densities,
there is always a basal level of autoinducer being produced, but the signal molecules do
not reach a sufficient concentration to efficiently form complexes with LuxR.
Transcription of the lux operon is not activated, and bioluminescence does not occur.
This autoinduction system allows V. fischeri to chemically communicate and respond to
changing environmental conditions. Whether the cells are in a high cell density/nutrient
rich environment or in a low density/nutrient free-living state, V. fischeri cells have the
capacity to make this distinction and either expend the energy needed for
bioluminescence or conserve the energy for other essential functions (McFall-Ngai and
Ruby, 1991; Ruby and McFall-Ngai, 1992). This type of communication is seen in other
4
bacteria, where a measurement of self population-density is important to their survival.
However, V. fischeri remains the best understood quorum sensing model system.
LuxR: The Activator Protein
Studies of luxR mutations in recombinant Escherichia coli have suggested that
LuxR is a two-domain polypeptide consisting of 250 amino acids (Figure 2; reviewed in
Stevens and Greenberg, 1999). The domains are defined as the N-terminal regulatory
domain (NTD) and the C-terminal activation domain (CTD). The NTD functions to bind
autoinducer, and modulates the ability of the CTD to bind to the DNA. Between residues
116 and 160 of the CTD, multimerization is thought to occur as LuxR is hypothesized to
function as a homodimer (Choi & Greenberg, 1992). Between residues 200 and 224, a
helix-turn-helix (HTH) motif is seen which was the first indication that the CTD played a
role in DNA binding.
In order for transcriptional activation to occur, LuxR must make specific protein-
protein contacts with RNA polymerase, as well as the autoinducer, as it is bound to the
lux box. The lux box is a 20 base-pair (bp) region with dyad symmetry, centered at the
-42.5 position from the luxI transcriptional start site and is important for transcriptional
regulation of luxR and luxI, (Figure 3). When LuxR is bound to the lux box, it is
positioned to potentially make contacts with the RNA polymerase on both its proximal
and distal surfaces (Figure 4). To investigate which specific amino acid residues of LuxR
are required for making such contacts with the RNA polymerase and activating
transcription, site-directed alanine mutagenesis was previously performed (Egland and
3
Figure 2: Cartoon Model of the Two Domain Structure of LuxR
LuxR is a 250 amino acid polypeptide. The N-terminal domain functions in autoinducer binding and itmodulates the activity of the C-terminal domain. The C-terminal domain functions in DNA binding/positivecontrol
* = LuxR variants with alanine substitutions at residues 198, 201, 206 proved to be positive control mutants(capable of binding to the DNA, but not in activating transcription) (Egland and Greenberg, 2001).
* = The role of LuxR residues 180-189 were analyzed in the current study Constructs were generated via a PCR-based site directed mutagenesis protocol.
N C
HTH200-224
Positive Control?
Multimerization116-169
AI Binding79-127
********** * * *
180-189 198, 201, 206
5
44
lux R lux I lux C lux D lux A lux B lux Glux E
155 bp
-10 -35 -10crp box lux box
-42.5
Figure 3: Arrangement of the lux operon genesBased on Figure 1 Stevens et al., 1994. See text for details.
6
23
Figure 4: Cartoon model of the five subunit structure of Escherichia coli RNA polymerase (RNAP) holoenzymeand its interaction with LuxR bound to the DNA at the luxI promoter of the lux operon(See text for details).
lux box -10
ααNTDLuxR
σσ
ββ ββ′′
α αCTD
7
8
Greenberg, 2001; Trott and Stevens, 2001). These studies resulted in the generation and
analysis of LuxR alanine substitution variants from amino acids 190-250. Originally, it
had been hypothesized that the extreme C-terminal 40 residues of LuxR were involved in
positive control of transcription activation (Choi and Greenberg, 1991). However, none
of the variants between 210 and 250 were found to be involved in activation of
transcription without affecting the ability of LuxR to bind at the lux box (Trott and
Stevens, 2001). This phenotype demonstrated that the C-terminal amino acids of LuxR
are not involved in transcriptional activation, but are involved in positioning the HTH for
DNA binding. Conversely, of the variants generated between residues 190 and 224, three
were found to be involved in transcriptional activation and were termed positive control
variants (Egland and Greenberg, 2001). The positive control mutants, (198A, 201A, and
206A), have the ability to bind lux regulatory DNA but fail to activate transcription of the
lux operon. These specific residues are hypothesized to be essential for making contacts
with the RNA polymerase and facilitating the initiation of transcription (Figure 4).
Other activator proteins, homologous to LuxR, such as NarL and TraR, have been
crystallized and their structures analyzed. In alignment with NarL, LuxR is seen to have
sequence similarities of the C-terminal domain, or activation domain. Exposure studies
of surface areas in specific NarL residues have been conducted and the accessibility to
the solvent has been determined (Baikalov et al., 1996). Positive control variants of
LuxR, (Egland and Greenberg, 2000), correlate to some of these exposed residues in the
eighth α helix as well as areas between this helix and the seventh helix of the C-terminal
domain of NarL (Figure 5). It is possible that other LuxR amino acid residues,
9
LuxR MKNINADDTYRIINKIKACRSNNDINQCLSDMTKMVHCEYYLLAIIYPHSMVKSDISILDTraR --------MQHWLDKLTDLTAIEGDECILKTGLADVADHFGFTGYAYLHIQHKHIIAVTNNarL -----------MSNQEPATILLIDDHPMLRTGVKQLIS-------------MAPDITVVG :: . . * : *:: .
LuxR NYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWN-IFENNAVNKKSPNVIKEAKTSGLITraR -YHHDWRSLYFDKKFDALDPVVKRARSRKHVFAWSGEQERPALSKEERAFYAQAADFGIRNarL EASNGEQGIELAESLDPDLILLDLNMPGMNGLETLDKLREKSLSGRIVVFSVSNHEEDVV : : .: ::. . : .. ::. . . . .:
LuxR TGFSFPIHTANNGFGMLSFAHSEKDNYIDSLFLHACMNIPLIVPSLVDNYRKINIANNKSTraR SGITIPIRTANGSMSMFTLASERTAIPLDREIDAVAAAAAVGQLHARISFLRITPT-AEDNarL T----ALKRGADGYLLKDMEPEDLLKALHQAAAGEMVLSEALTPVLAASLRANRATTERD : .:: . .. : : . :. . : ..
LuxR NNDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAILTraR AVWLDPKEATYLRWIAVGKTMEEIADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAIRNarL VNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVWVHQ * :* * . * . *: . . :* .:: . ::. .: . .
LuxR TGAIDCPYFKNTraR RKLI-------NarL ERIF------- :
Figure 5: Amino Acid Sequence Alignment between LuxR and LuxR homologues TraR and NarL
* indicates single, fully conserved residue 180A -189A (LuxR alanine substitution variants): indicates strong conservation 198A, 201A, 206A (LuxR positive control mutants). indicates weak conservation Amino acid residues in bold: seventh and eighth surface- indicates no conservation exposed helices of NarL
9
10
corresponding to those that have their surface areas exposed in NarL when substituted,
could also yield positive control variants for transcriptional activation during quorum
sensing in V. fischeri. This hypothesis has been investigated during this thesis project
(Chapter 2).
Interestingly, two positive control variants in TraR have been identified. Unlike
the residues found in LuxR, they are located in the N-terminal domain (Luo and Farrand,
1999). Though TraR is in the family of LuxR transcriptional activators, and has sequence
similarities present throughout the protein, it nonetheless appears to function differently
in some regards. An N-terminus deletion of LuxR still allows for activation of the lux
operon (Choi and Greenberg, 1991; Stevens et al., 1994) while in TraR this deletion
prevents activation of its corresponding operon (S. Winans, Personal Communication).
Therefore, it seems unlikely that positive control variants in the NTD of TraR could
correspond to any in LuxR. However positive control variants of LuxR map to a surface-
exposed region on the crystal structure of TraR (Zhang et al., 2002).
LuxR Homologues:
Quorum sensing systems homologous to the LuxI-LuxR system of V. fischeri
have been identified and studied extensively in other Gram-negative bacteria where they
regulate various cellular processes such as plasmid conjugal transfer, motility, biofilm
formation, antibiotic biosynthesis, and virulence factor production in plant and animal
pathogens (reviews: Williams et al., 2000; Vannini et al., 2002; Miller and Bassler,
11
2001). For years, V. fischeri has served as the model for such systems of quorum
sensing.
In Pseudomonas aeruginosa, quorum sensing is used to regulate means to invade
and overtake a complex eukaryotic host (Parsek and Greenberg, 2000). The virulence of
P. aeruginosa stems from its production of extracellular virulence factors such as
exotoxins and proteases. The activation of the virulence genes is due to two quorum
sensing systems homologous to the LuxI-LuxR system, called the Las and Rhl systems
(Fuqua et al., 1994; Beatson et al. 2002). The autoinducer of the Las system is N-(3-
oxododecanoyl)-homoserine lactone; it has a longer acyl side chain on the molecule than
does the primary autoinducer of V. fischeri. This autoinducer forms complexes with
LasR and regulates transcription of lasI, rhlR, and four other genes encoding key
virulence factors (Beatson, et al., 2002). RhlR, complexed with its cognate autoinducer,
N-butyryl-L-HSL regulates transcription of rhlI, rhlA, lasB, and phzA (additional key
virulence factors). Even within these regulatory systems of quorum sensing, a hierarchy
regulating virulence factors exists with the Las system being upstream of the Rhl system.
As P. aeruginosa invades a host, it is to its advantage to wait until the bacterial
community is at a high cell density to express the virulence genes. The bacteria may
evade the host’s immune system until they are at an overpowering density, to only then
attack when they are at their strongest, so as to defeat the host (Greenberg, 1997).
Quorum sensing is activated when P. aeruginosa forms microcolonies and biofilms. By
using quorum sensing as a way to monitor the army’s strength, P. aeruginosa will only
express its virulence genes when there is a high cell density; this eliminates the chance
12
for the host to detect the bacteria and overcome the infection. This system of invasion can
be found in many bacteria (Koiv and Mäe, 2001; Mäe et al., 2001; Whitehead, et al.
2001).
Another example of this type of regulation during pathogenesis is seen in the
quorum sensing system of Pantoea stewarti ssp. stewartii (P. stewartii). A P. stewartii
plant infection causes Stewart’s wilt disease in sweetcorn and leaf blight in maize (Pataky
et al., 2000). Unlike LuxR, the transcriptional regulator of this system, EsaR, is thought
to function as a repressor, instead of an activator, controlling capsular polysaccharide
synthesis (CPS) through quorum sensing (Minogue, et al., 2002; Miller and Bassler,
2001). A high level production of CPS blocks the corn xylem vessels and hence causes
necrotic lesions. The disease symptoms are thus a result of the function of the quorum
sensing LuxR/LuxI homologues, EsaR and EsaI. EsaI, the autoinducer synthase of the
system, produces the diffusible signal N-(3-oxo-hexanoyl)-L-homoserine lactone, which
is identical to the V. fischeri autoinducer. A mutated or nonfunctional signal synthase
leads to a loss in signal production, as well as a loss in CPS synthesis and bacterial
virulence. In contrast, a mutated esaR gene results in an excessive production of CPS
independent of the levels of signal present (von Bodman et al., 1998). Therefore, EsaR
acts as a repressor, and only derepresses the system in the presence of inducing levels of
signal.
A lux box-like palindromic sequence, called the esaR box, coincides with the
putative -10 element of the esaR promoter. This suggests a negative autoregulatory
function for EsaR since in the absence of an inducing level of signal, EsaR will repress
13
the esaR gene and prevent transcription. In contrast, LuxR functions as an activator when
it associates with its cognate autoinducer, 3-oxohexanoyl HSL and thus binds at the lux
box, which is -42 bp upstream from the transcriptional start site and recruits RNA
polymerase to the promoter.
In the presence of inducing levels of signal, EsaR will bind the signal and hence
derepress the system, leading to CPS synthesis. Derepressed esaR strains produce CPS
constitutively at low cell densities, and are significantly less virulent than when compared
to a wild-type parent (von Bodman et al., 1998). This phenotype suggests that the
quorum sensing system of P. stewartii may work to delay the expression of CPS during
the early stages of infection, and therefore reduce the interference with other mechanisms
of pathogenesis (von Bodman et al., 1998).
A previous study demonstrated that the LuxR homologue, LasR from
Pseudomonas aeruginosa, is able to recognize, bind and activate transcription of the lux
operon from the palindromic lux box (Gray et al., 1994) while in the presence of its
cognate autoinducer signal. In the presence of 3-oxohexanoyl HSL, LuxR is capable of
weakly activating the lasB gene that encodes for elastase by recognizing, and binding the
20 bp palindrome upstream of lasB. Both regulatory proteins, LuxR and LasR, were
unable to activate transcription from lasB and luxR respectively, without their cognate
autoinducer present; the heterologous autoinducer was not recognized. The palindromic
sequence reported upstream from lasB shows sequence identity at 10 of the 17 conserved
sites of the V. fischeri sequences (Gray et al., 1994). It is predicted that bacteria
possessing autoinducible genes might contain similar palindromes at the appropriate
14
positions for transcriptional activation/repression and hence may be recognized by other
bacteria capable of quorum sensing (Welch et al., 2000). A consensus sequence for
comparing these cis-acting regulatory elements based on DNA sequences from V.
fischeri, P. aeruginosa, Agrobacterium tumefaciens, among others has been deduced
(Gray et al., 1994).
Interestingly, the palindromic sequences found upstream from luxR (Egland and
Greenberg, 2000) and esaR (Minogue et al., 2002) are similar. In the current study
(Chapter 3), EsaR was tested to determine if it could recognize and bind the lux box, and
in so doing, activate transcription from the luminescence operon. In P. stewartii, EsaR
allows for derepression, and hence transcriptional activation solely in the presence of its
cognate autoinducer. To more directly measure potential function as an activator, E. coli
λ reporter strains were used to determine/analyze the ability of EsaR to increase the rate
of transcription of the lux operon promoter and to bind to the DNA and repress
transcription at an artificial promoter (Personal communication M. Urbanowski).
Another LuxR homologue, ExpR, negatively regulates extracellular enzyme production
in Erwinia carotovora ssp. carotovora (E. carotovora) and has significant amino acid
homology to EsaR (Andersson et al., 2000) and LuxR (Figure 6). This LuxR homologue
was also included in the activation/ binding analysis along with EsaR.
Unlike LuxR, ExpR is convergently transcribed from its quorum sensing
counterpart, ExpI, and does not transcriptionally regulate ExpI. The expression of
virulence determinants, such as plant cell wall-degrading enzymes, in Erwinia carotovora
ssp. carotovora depends on a critical concentration of autoinducer. In E. carotovora, this
15
ExpR MSQLFYNN-----ETISRIIKSQ FDMALSHYG--- ----D IKYAYMVLNKKKPTEILIISEsaR MFSFFLEN-----QTITDTLQTY IQRKLSPLG--- ----S PDYAYTVVSKKNPSNVLIISLuxR MKNINADDTYRIINKIKACRAYD INQCLSDMTKMV HCEYY LTLAIIYPHSMVKSDISILD
* .: :: :.*. :: ** * . ::: *:.
ExpR NHHDEWREIYQANNYQHIDPVVIAALNKITPFPWDEDLLVS TQLKMSKIFNLSREHNITNEsaR SYPDEWIRLYRANNFQLTDPVILTAFKRTSPFAWDENITLM SDLRFTKIFSLSKQYNIVNLuxR NYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNA VNKKSPNVIKEAKTSGLIT
.: .:* . * * **:: : .. :*: *: : : .:::. :: .: .
ExpR GYTFVLHDHSNNLVMLSIMIDESNVSNIDDVIESNKDKLQMTLMTIHAETISLY-REMI REsaR GFTYVLHDHMNNLALLSVIIKGNDQTALEQRLAAEQGTMQMLLIDFNEQMYRLAGTEGE RLuxR GFSFPIHTANNGFGMLSFAHSEKD-NYIDSLFLHACMNIPLIVPSLVDNYRKIN----- -
*::: :* *.: :**. . .: . ::. : .: : : : : :
ExpR NKEDERSNDKDIFSQRENEILYWASMGKTYQEIALILDIKTGTVKFHIGNVVKKLGVLNAEsaR APALNQSADKTIFSSRENEVLYWASMGKTYAEIAAITGISVSTVKFHIKNVVVKLGVSNALuxR -IANNKSNND--LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNR
::* :. ::.**:* * **. **: :*: * . . **.**: *. **.. *
ExpR KHAIRLGIELQLIRPVQS- --EsaR RQAIRLGVELDLIRPAASA ARLuxR CQSISKAILTGAIDCPYFK N-
::* .: *
Figure 6: Amino Acid Sequence Alignment between LuxR and LuxR homologues EsaR and ExpR
Consensus key:* - single, fully conserved residue . - conservation of weak groups : - conservation of strong groups - no consensus
15
16
signal molecule is N-(3-oxohexanoyl)-L-homoserine lactone (Jones et al., 1993;
Pirhonen, et al., 1993), which is identical to that of V. fischeri, and P. stewartii. In the
absence of autoinducer, or without the ability to synthesize/express autoinducer as in the
case of E. carotovora expI mutants, these strains are avirulent (Jones et al., 1993). Thus,
quorum sensing systems found in E. carotovora and in P. stewartii, regulated by the
proteins ExpR/ExpI and EsaR/EsaI respectively, are additional examples of microbial
pathogens that regulate virulence determinants via quorum sensing.
Work described in this thesis examines questions related to the mechanism of
transcriptional activation used during quorum sensing. In Chapter 2, the effects of
alanine substitution mutations in the CTD of the activator protein LuxR were analyzed.
The ability of these variant forms of LuxR to activate transcription of the lux operon at
mid-exponential log phase was determined in the presence and absence of autoinducer.
The interactions between LuxR and RNAP as they bind in complex at the lux box and
initiate transcription was also analyzed in an intergenic suppression study. By examining
the ability of positive control variants of LuxR to activate the lux operon in the presence
of mutated forms of the RNAP alpha subunit, putative intergenic suppressor mutations
were discovered. Future analysis of the nature of the genetic change in the suppressing
forms of alpha may reveal essential amino acid interactions between RNAP and LuxR at
the lux box. In Chapter 3, the ability of LuxR homologues EsaR and ExpR to
recognize/bind the lux box, and activate transcription from the lux operon was examined.
Though these proteins function differently from LuxR, their capacity to recognize and
activate transcription from a non-native promoter in the presence and absence of
17
autoinducer was determined. This analysis has increased our understanding of the
versatility and flexibility of the LuxR family of proteins to function as activators of
transcription. Finally, Chapter 4 focuses on contributions made to the Fischeri Intrinsic
Annotation Team (FIAT) of Integrated Genomics, Inc. (Chicago, IL) in a multi-lab effort
to annotate the Vibrio fischeri genome. These efforts will lead to a better understanding
of functions encoded in the genome that are necessary for establishment of a successful
symbiosis between V. fischeri and its eukaryotic host and will also permit a complete
analysis of the regulon controlled by LuxR during quorum sensing.
18
CHAPTER 2
Amino Acid Residues Involved in Protein-Protein Interactions BetweenRNA Polymerase and the Quorum Sensing Activator LuxR
INTRODUCTION:
To investigate which specific amino acid residues of LuxR are required for
making contacts with RNA polymerase that lead to an activation of transcription
initiation, alanine scanning site-directed mutagenesis was performed on LuxR. Each
amino acid starting at residue 189 and moving upstream, until amino acid 180, toward the
N-terminus of the CTD was separately mutated. Alanine-substituted LuxR variants were
subsequently tested for their ability to activate transcription at the lux operon, bind at the
lux box and produce the LuxR protein in an effort to identify additional positive control
mutants.
Phenotypes of the previously identified LuxR positive control variants 198A,
201A, and 206A, revealed that these variants were unable to interact with E. coli RNAP
in the appropriate manner to activate transcription of the lux operon (Egland and
Greenberg, 2001). The specific amino acid residues of RNAP contacting these positive
control residues of LuxR have not been elucidated. An intergenic suppressor study was
undertaken to answer this question. Amino acid residue 206 was changed to glutamate,
giving this residue an overall negative charge, rather than being nonpolar as the original
amino acid, isoleucine. A dramatic change in overall charge may allow for a
compensatory substitution to form in the RNAP α or σ subunits, hence reversing the dark
phenotype of I206E, and allowing for the detection of a bioluminescent phenotype. The
19
α subunit of RNAP was chosen for this mutagenesis based on genetic evidence that
specific, single amino acids were essential to initiate LuxR-dependent transcription
(Finney et al., 2002). The σ subunit was not initially chosen since prior research
involving this RNAP subunit did not give evidence of individual residues in σ being
essential for LuxR-dependent transcription (D. Johnson and A. Stevens, Personal
Communication).
20
MATERIALS AND METHODS
PCR-Three Primer Method:
A three primer method of PCR (Michael, 1994) was employed for the alanine
scanning site-directed mutagenesis of LuxR. Mutagenic (internal) primers (Sigma-
Genosys, The Woodlands, TX) were designed to change one specific amino acid to
alanine, and to add/delete a restriction endonuclease site for screening purposes (Table 1).
External primers (Sigma-Genosys) flanking the target sequence were also designed
(Table 2). Mutagenic primers (Table 1) for creating LuxR amino acids E189A, E187A,
and R186A, and I206E (for the intergenic suppression analysis) were phosphorylated
with T4 polynucleotide kinase (New England Biolabs, Beverly, MA) before their
addition to the PCR reactions. Components of the 30 µL phosphorylation reaction
included 250 pmol primer, 1X T4 polynucleotide kinase buffer, 1.7 mM ATP, and 10
units T4 polynucleotide kinase. The reaction mixture was incubated at 37°C for 30
minutes, heat inactivated at 65°C for 20 minutes, then the entire phosphorylation mixture
was added to the master mixture for the 100 µL PCR reaction. All other mutagenic
primers subsequently used have been 5’ phosphorylated during synthesis by the
manufacturer (Sigma-Genosys) and added to the PCR reaction at a concentration of
3 µM.
The PCR master mixture contained the following final concentrations of reagents:
2 µM XBA200 primer (Sigma-Genosys), 2 µM PVU200 primer (Sigma-Genosys),
21
Table 1: Mutagenic Primers for luxR 5' àà 3'
LuxRAminoAcid
Residues
SequenceaRestriction Site
Change
180AB CGAAAAATAAATATTGCAAATAATAAATCAGCAAACGATTTAAC Adds SspI site180AC GTTAAATCGTTTGCTGATTTATTATTTGCAATATTTATTTTTCG Adds SspI site181AB CGAAAAATAAATATTGCAAATAATAAATCAAACGCAGATTTAAC Adds SspI site181AC GTTAAATCTGCGTTTGATTTATTATTTGCAATATTTATTTTTCG Adds SspI site182AB CGAAAAATAAATATTGCAAATAATAAATCAAACAACGCTTTAAC Adds SspI site182AC GTTAAAGCGTTGTTTGATTTATTATTTGCAATATTTATTTTTCG Adds SspI site183AB CGAAAAATAAATATTGCAAATAATAAATCAAACAACGATGCAAC Adds SspI site183AC GTTGCATCGTTGTTTGATTTATTATTTGCAATATTTATTTTTCG Adds SspI site184AB TAAATATTGCAAATAATAAATCAAACAACGATTTAGCAAAAAG Adds SspI site184AC CTTTTTGCTAAATCGTTGTTTGATTTATTATTTGC -----------185AB ATATTGCAAATAATAAATCAAACAACGATTTAACCGCAAGAG Adds SspI site185AC CTCTTGCGGTTAAATCGTTGTTTGATTTATTATTTGC -----------186A CAAAGCAGAAAAAGAATGTTTAGCGTGGGCATGTG Loses SphI site187A CAAAAGAGCAAAAGAATGTTTAGCGTGGGCATGTG Loses SphI site
188AB CAAAAGAGAAGCAGAATGTTTAGCGTGGGCATGTGAAG Loses SphI site188AC CTTCACATGCCCACGCTAAACATTCTGCTTCTCTTTTG Loses SphI site189A AAAGCATGTTTAGCGTGGGCATGTG Loses SphI site206E GGGATATTTCGAAAGAATTAGGCTGCAGTGAG Adds BstBI site
a. Bold indicates changes leading to incorporation of alanine (or glutamate for 206E), underline indicatesrestriction site changes
21
22
Table 2: Amplification primers for luxR
XBA200 5'-CGTATAATGTGTGGAATTGTGAGCGPVU200 5'-GAAGTGGTCCTGCAACTTTATCC
Table 3: Sequencing Primers for luxR
SEQINT2 5'-ATGTAATTAAAGAAGCGAAAACSEQINT 5'-GTTGTCTTTTTCTGAATGTGCSEQPRO 5'-GTATGGCTGTGCAGGTCGTAAATCSEQVEC 5'-GCTGAAAATCTTCTCTCATCC
Table 4: Sequencing Primers for rpoA
RLG1412 5'-CATTGCGTTCACGTCGTTGCTCMAF1486 5'-CTAATAGACGCGTTCTCATCGGTCMAF1487 5'-GTCGAAATCGTCAAGCCGCAGCACGRLG1489 5'-CGTCGTGCGGCAACCATTCTGMAF1490 5'-GGCTGACGTACATCACGTAAGTCAAG
23
0.2 mM dNTPs (Promega, Madison, WI), 2.5 units Taq2000 Polymerase (Stratagene, La
Jolla, CA), 0.7 X Taq2000 reaction buffer (Stratagene), 40 units Taq DNA Ligase (New
England Biolabs), 2 mM MgSO4 (Fisher, Springfield, NJ), and 100 ng of linearized
pSC300 template (Figure 7) (Choi and Greenberg, 1991). The template DNA, pSC300,
was prepared from E. coli using the QIAprep miniprep kit (Qiagen, Valencia, CA) or by
the alkaline-lysis miniprep procedure (Sambrook et al., 1989). Purified template was
linearized with the restriction endonuclease PvuII according to the manufacturer’s
directions (New England Biolabs). A Sprint thermal cycler (Hybaid, Middlesex, UK)
program was used. The program for all PCR reactions was one cycle at 94°C for 2
minutes; 30 cycles: 94°C for one minute, 45°C for one minute, and 72°C for 2 minutes;
one cycle at 72°C for 10 minutes.
PCR-Four Primer Method:
The technique of Overlap-PCR (Higuchi et al., 1988; Ho et al., 1989) was used in the
mutagenesis of LuxR residues F180A, F181A, D182A, L183A, T184A, K185A, and
K188A. This procedure proved to be much more useful and reliable than the previously
described three-primer method. Two overlapping mutagenic primers were synthesized
(Sigma Genosys) for each residue (Table 1). Each mutagenic primer encoded the alanine
substitution, but only one required the addition or deletion of the new restriction site for
screening purposes. The external primers used and the technique of purifying the
template for the PCR reaction remained unchanged from the three primer method.
24
Figure 7: Map of expression vector pSC300Relevant characteristics of pSC300 are depicted. Restriction endonucleasesites for alanine scanning site directed mutagenesis and cloning purposesare included.
PvuII 1945
ScaI
PvuI
PvuII 1945
PstI 4560
SmaI 4577
PstI 4709
XbaI 5159
EcoRI 5333
Ptac
Tet sensitive
Amp
luxR
pSC300
5336 bp
0
534
1068
1602
2136
2670
3204
3738
4272
4806
25
After the template was linearized using either PvuII or NdeI (New England Biolabs),
two separate PCR reactions were set up each containing one external and one mutagenic
primer for each residue to be mutated. The thermal cycler was programmed as follows:
94°C for 2 minutes; 30 cycles: 94°C for 30 seconds, 45°C, for one minute, and 72°C for 2
minutes; one cycle at 72°C for 10 minutes. The reaction was purified using the
QIAquick PCR purification kit (Qiagen) and the concentrations determined before the
second PCR reaction was set up. In the second reaction, the products from the first
reactions were used as both the template and primer at a 1:1 ratio. The concentrations of
the PCR products used were estimated by visualization after running the products in a
0.8% agarose gel. External primers at a concentration of 2 µM were included to gain
even more full-length product. The final PCR products were again purified using a
Qiagen purification kit.
Cloning:
Purified PCR products were digested with SmaI or PvuI, depending on the
primers used, at room temperature for 2-4 hours, and XbaI (New England Biolabs) at
37°C for 2-4 hours. The expression vector, pSC300 (Choi and Greenberg, 1991) (Figure
7), was also digested with either SmaI or PvuI, and XbaI using the same protocol.
Digested products were analyzed by electrophoresis in a 0.8% agarose gel (BioRad,
Hercules, CA). The pSC300 vector and the insert, containing the mutated DNA were
individually extracted from the gel matrix and purified using the QIAquick gel extraction
kit (Qiagen). Ligation reactions using T4 DNA Ligase (New England Biolabs) were
26
carried out at 16°C overnight as per the manufacturer's directions. Transformation into E.
coli JM109 was achieved by heat shock treatment of the competent cells/hybrid DNA
molecules in 0.1M CaCl2 (J.T. Baker Chemical Co., Phillipsburg, NJ) at 37°C for 2
minutes. After incubation on ice for 5 minutes, the cells were grown in Luria-Bertani
(LB) broth for one hour at 37°C and plated on LB agar medium containing 100 µg/mL
ampicillin.
Transformed strains were subcultured in Luria-Bertani broth plus ampicillin
(100 µg/mL), and grown overnight. Plasmid preparation was performed using the
alkaline-lysis miniprep procedure. Depending on the restriction site change in the DNA
sequence, the plasmids were digested, and compared to that of wild-type pSC300 cut
with the same restriction endonuclease. A change in banding pattern after gel
electrophoresis was taken as an indicator that the alanine mutation or in the case of
I206E, the glutamate mutation, was present. Plasmid DNA from the correct constructs
was prepared using the QIAprep miniprep kit (Qiagen), eluting the DNA from the
column with dH2O, followed by nucleotide sequencing at the Core DNA Sequencing
Facility at Virginia’s Bioinformatics Institute, Virginia Tech, Blacksburg, VA (CSF-
VBI). Sequencing of the luxR gene and most of the promoter region of the constructs
was performed to confirm the presence of the alanine or glutamate mutation and rule out
any second site mutations that may have occurred during construction of the desired
plasmid. The sequencing primers used in these reactions were: SEQINT2, SEQINT,
SEQVEC, SEQPRO (Table 3). LuxR variants 180A-189A having the correct alanine
substitutions were subsequently called the pMAF series.
27
Cloning LuxR Positive Control Variants 201A and 206A into Expression Vector
pSC300:
Plasmids containing the LuxR positive control residues 201A and 206A (Egland
and Greenberg, 2001) were digested with XbaI and PvuI as per the manufacturer's
directions. The expression vector pSC300 was digested in the same manner. Products
from the restriction digests were run in a 0.8% agarose gel and the luxR insert band and
the vector band from pSC300 were extracted, and purified using the QIAquick Gel
Extraction Kit (Qiagen). Purified DNA was then ligated and transformed into E. coli
JM109. Transformants were selected on LB agar medium containing ampicillin
(100 µg/mL).
Luminescence Assays:
Luminescence production was measured from strains of E. coli JM109 (Yannisch-
Perron et al., 1985) transformed with pJR551 (Dunlap and Ray, 1989). Conferring
chloramphenicol resistance of 30 µg/mL, plasmid pJR551 encoded the lux operon. A
second plasmid present in the strains was pSC300, that encoded the alanine substitution
variants of LuxR and conferred resistance to ampicillin at 100 µg/mL resistance gene.
The racemic mixture of 3-oxohexanoyl-DL-HSL, needed for full transcriptional
activation of the operon, was suspended in acidified ethyl acetate (10 µg/mL). The
correct amount needed for the assays was added to an empty flask and the ethyl acetate
was allowed to evaporate in the hood, leaving the dried autoinducer behind. The
autoinducer was then resuspended at 200 nM in Luria-Bertani (LB) broth containing the
28
appropriate antibiotics. Strains were grown overnight at 30°C to an OD600 of 0.2-1.0,
subcultured to an OD600 of 0.025, and subsequently grown to a final OD600 of 0.5 ± 0.02
(mid-exponential log phase growth). Luminescence was measured in relative light units,
using a Turner 20/20 luminometer (Turner Designs, Sunnyvale, CA), over a 4-second
integration period using 10 µL of culture. The luminescence assay was performed on
cultures grown in duplicate with assays from each sample performed in triplicate. Cell
aliquots of 0.5 mL were also pelleted from each strain; the supernatant was carefully
removed and the relatively dry pellet was frozen at -80°C for use in luciferase assays and
western immunoblotting.
Luminescence assays were also conducted in the absence of exogenous
autoinducer to conclude if any of the alanine substitution mutations resulted in a form of
LuxR that was capable of activating transcription of the lux operon independent of
autoinducer (data not shown). The autoinducer synthase gene, luxI, of the lux operon
encoded on plasmid pJR551, contains a temperature sensitive mutation rendering the
enzyme nonfunctional at 31°C, therefore that was the growth temperature used for these
experiments.
Luciferase Assays:
A procedure based on that of Dunlap and Greenberg (1985) was used to measure
luciferase levels in cell extracts. Frozen cell pellets obtained during luminescence assays
as described above were resuspended in 1mL of lysis buffer (prepared fresh) containing
10 mM KPO4 pH 7.0, 10 mM ethylenediaminetetraacetic acid pH 8.0 (EDTA), 1 mM
29
dithiothreitol (DTT), 0.1% bovine serum albumin (BSA), H2O, and 50 µg/mL lyzozyme.
The resuspended pellet was frozen for one hour at -80°C, allowed to thaw at room
temperature, briefly vortexed again, and then kept on ice until needed. An assay buffer
was prepared at the same time as the lysis buffer, and contained identical ingredients
except no EDTA or lyzozyme was added. The substrate for the luciferase assay was
prepared by sonicating a 1:1000 dilution of the n-decyl aldehyde (decanal) (Sigma-
Aldrich, St. Louis, Missouri) for 3 minutes, with resting periods every 30 seconds; the
tube was stored on ice throughout the assay. The reduced coenzyme FMNH2, was
prepared from stocks of 0.5 mL (5 mM) flavin mononucleotide (FMN) that were added to
49.5 mL H2O in an anaerobic bottle. Approximately 10 pellets of platinum-coated
alumina were added to the bottle, which was then sealed with a rubber stopper. The
bottle was purged of oxygen, pressurized with hydrogen gas, and shaken rapidly until the
FMN was reduced, leaving the solution almost clear in color. For each reaction, 90 µL of
assay buffer, 10 µL decanal, 100 µL FMNH2, and 10 µL cell extract was added to a
luminometer tube; luminescence was measured over a 30 second integration period with
triplicate readings measured for each sample in relative light units.
DNA Binding/Repression Assays:
The effect of alanine substitutions in LuxR on DNA binding and repression at an
artificial promoter construct containing the lux box was measured from E. coli JM109
strains containing p35LB10 (Egland and Greenberg, 2000) and plasmids encoding each
of the pMAF encoded LuxR variants individually. The p35LB10 reporter construct
30
consists of a lacZ gene under its own promoter, however, the lux box has been inserted
between and partially overlapping the -10 and -35 consensus sequences. If a LuxR
variant binds at the lux box, lacZ expression is down-regulated. RNA polymerase has the
ability to bind and initiate transcription of the lacZ gene only when LuxR or a variant of
LuxR is not present at the lux box.
Strains were grown overnight at 30°C in LB broth containing the appropriate
antibiotics to an OD600 of 0.2-1.0. The strains were subcultured into two sets (one with
200 nM 3-oxohexanoyl-DL-HSL and the other with none to an OD600 of 0.025 in LB
broth containing the same antibiotics as the overnight cultures, and subsequently grown
to a final OD600 of 0.5 ± 0.02 (mid-exponential log-phase growth). At this point, the cells
were stored on ice. When all samples had reached an OD600 of 0.5, 5 µL of cells were
diluted with 995 µL Z Buffer (60 mM Na2HPO4, 40 mM NaH2PO4, 10 mM KCl, 1 mM
MgSO4) with dithiothreitol (DTT) added at a concentration of 400 µM. Chloroform (50
µL) was added to the diluted cells and then the suspension was briefly vortexed to cause
lysis. After lysis, 10 µL of the cell extract was added to luminometer tubes and incubated
for one hour with 100 µL of room temperature reaction buffer and substrate from the
chemiluminescent reporter assay kit (Tropix, Bedford, MA) mixed at a ratio of 100:1,
respectively. After the one-hour incubation, 150 µL of room temperature accelerator was
added to each tube with the same timing used to add the substrate. Light output was
measured in the Turner 20/20 luminometer over a 4 second integration period. Strains
with each variant were grown up in duplicate and assays were performed in triplicate,
with light output measured in relative light units.
31
SDS-PAGE and Western Immunoblotting:
To confirm that the dark phenotypes of LuxR variants 183A, 184A, 186A, and
187A were due to a defect in recognition/binding of the lux box, and not due to the cells'
inability to express the variant LuxR proteins, western immunoblotting and sodium
dodecyl-sulfate polyacrylamide gel electrophoresis (SDS-PAGE) was performed. Cell
pellets (from the 0.5 mL luminescence assay aliquots) were removed from the -80°C
freezer and allowed to thaw on the benchtop. The thawed pellets were resuspended in
100 µL of 5X sample buffer (1M Tris pH 6.8, 0.2 g SDS, 0.625 g glycerol, 0.5 mL β-
mercaptoethanol, trace bromphenol blue (BPB), and boiled for three minutes prior to
loading 20 µL of sample in to the 12% polyacrylamide gels. Two gels were run at the
same time; one was stained for protein expression using GelCode™ Blue Stain Reagent
(Pierce, Rockford, IL), while the proteins from the other polyacrylamide gel were
transferred to a nitrocellulose membrane for 1 hour at 150V using The BanditTM Tank
Electroblotter (Owl Scientific, Inc., Portsmouth, NH; Model VEP-III). The nitrocellulose
membrane was then treated with 1X NET buffer (150 mM NaCl, 5 mM EDTA, 54.6 mM
Tris-HCl, 8 mM Tris-Base, 500 µL Triton X-100 per liter, containing 0.025% gelatin
(Sigma 300 bloom) as the blocking agent, and incubated with anti-LuxR antibody (Babco
1) (Slock et al., 1990) at a working dilution of 1:1500 then incubated for one hour with
gentle rocking. The 1� antibody was removed, the blot washed in fresh 1X NET buffer
containing 0.025% gelatin and the horseradish peroxidase (HRP)-conjugated goat IgG
fraction to rabbit IgG (ICN, Inc., Aurora, OH) was added at a 1:2000 dilution. After a
two-hour incubation, the 2� antibody solution was discarded and the blot was rinsed in
32
excess 50 mM Tris, pH 7.5, for 15 minutes. The color development reagents (4-chloro-1-
naphthol dissolved in 20 mL MeOH, along with 83 µL 3% hydrogen peroxide diluted in
50 mM Tris, pH 7.5) were then prepared fresh, mixed, and poured over the blot. The
color development of the membrane was complete within 20 minutes, and a picture of the
blot was captured using the Alphaimager 2000 (Alpha Innotech Corp., San Leandro, CA).
Intergenic Suppression Analysis:
Detection of intergenic suppressor mutations in E. coli between the α subunit of
RNAP and the luxR variant I206E required the construction of three-plasmid strains.
Competent E. coli JM109 cells were transformed through heat shock with pAMS129
(Stevens, et al., 1999), encoding the lux operon; the resulting strain was then made
competent. Each strain containing the lux operon on pAMS129 was subsequently
transformed with either the wild-type LuxR encoded on pAMS121 (Stevens, et al., 1999)
or the I206E variant encoded on pSUP102 (Simon, et al., 1989), and the wild-type alpha
encoded on pREIIα (Blatter et al., 1994) or the randomly, chemically mutated form of
pREIIα.
The negative control strain (dark phenotype) therefore possessed genes encoding
the lux operon (pAMS129) conferring kanamycin resistance at 100 µg/mL (Kn100), the
wild-type α subunit of RNAP on pREIIα conferring ampicillin resistance at 100 µg/mL
(Ap100), and the luxR variant I206E, resistant to chloramphenicol at 20 µg/mL (Cm20).
The positive control strain (bright phenotype) on the other hand, encodes the lux operon,
the wild-type α subunit of RNAP, and the wild-type luxR gene. Test strains were
33
constructed by transforming the E. coli JM109 strain containing pAMS129 with the luxR
variant I206E on the pSUP102 expression vector. This resulting strain was then made
competent in order for the chemically mutated plasmid DNA (encoding pREIIα) to then
be transformed, and subsequently tested for a renewed bright phenotype through
luminescence readings.
The random, chemical mutagenesis of pREIIα was accomplished using
hydroxylamine (Sigma-Aldrich). Hydroxylamine causes GC to AT transitions in the
DNA and therefore, there should not be any frameshifts or large deletions as would be
seen with other mutagenesis protocols. This protocol (Slock et al. 1990) needed to be
optimized in order to determine the correct exposure time of the plasmid DNA to the
hydroxylamine solution. Excessive exposure would be deleterious to plasmids, while an
insignificant exposure time would only leave wild-type plasmids intact prohibiting any
results. The optimization was accomplished by adding 35 µL of the mutagenic solution
(5 mM Tris pH 6.0, 0.5 mM EDTA pH 8, and 0.5 M hydroxylamine), having a final pH
of approximately 3.3, to 5 µg of pREIIα in a 35µL suspension (for a total volume of 70
µL), and incubating at 37°C.
At predetermined time points, aliquots of 5 µL were taken and added to 95 µL of
100 mM CaCl2 in order to stop the reaction. After 24 hours, all of the aliquots were
transformed into the experimental strain described previously and grown overnight at
37°C. A decrease in transformation efficiency from the aliquot taken at zero hours (when
plasmid DNA is not mutated) up until the 24 hour time-point indicated that the
mutagenesis was working properly. Plasmids mutated in the ampicillin resistance gene
34
or in the origin of replication would not be able to produce viable transformants.
Colonies were subsequently picked and transferred to 96 well plates; each well was filled
with 250 µL of LB agar containing Kn100Cm20Ap100 and 1 mM IPTG
(isopropylthiogalactosidase), for induction of the pTAC promoter present on the
plasmid(s) encoding LuxR, and allowed to grow at 30°C for 24 hours. Luminescent
readings over a 1 second integration time were taken using a Lucy microtiter dish
luminometer (Anthos, Wals, Austria) after 12, 18, and 24 hours of growth. Maximum
luminescence from the positive control strain was produced at 12 hours and was
approximately 50,000 relative light units (RLU) as compared to the negative control,
usually generating about 70 RLU.
After this optimization period, pREIIα DNA was exposed to the hydroxylamine
solution for 18-24 hours at 37°C. Transformation into the experimental strain followed,
the resulting colonies were picked, and then transferred to the 96 well plates.
Luminescent readings were always taken after 12 hours of growth at 30°C.
Once possible suppressor mutants were discovered, quantitative luminescence assays,
as previously described for testing the pMAF series of LuxR variants, were conducted,
but in the presence of 200 nM 3-oxohexanoyl-DL-HSL and 1 mM IPTG for induction.
Luminescent readings were recorded using a Turner 20/20 luminometer over a 4 second
integration period. Positive results (luminescent phenotypes) compared to the wild-type
strain containing wild-type luxR, pREIIα, and the lux operon, confirmed the
luminescence readings exhibited during the high through-put screening process using the
96 well plates.
35
The hydroxylamine-treated pREIIα plasmids were then isolated from the three
plasmid strains also containing pAMS129 and luxR variant 206E in pSUP102. Plasmid
minipreps were performed using the QIAprep miniprep kit (Qiagen). The plasmid DNA
was then serially diluted, transformed into E. coli JM109 competent cells, and selected
for on Ap100 plates. Cells containing only the hydroxylamine treated pREIIα plasmids
were Ap100 resistant but Kn100 and Cm20 sensitive. The rpoA sequence in the pREIIα
plasmids were then sequenced at the CSF-VBI sequencing facility at Virginia Tech using
primers RLG 1412, 1486, 1487, 1489, and 1490 (Table 4).
The hydroxylamine treated pREIIα plasmids, exhibiting a bright phenotype, were
then transformed into E. coli JM109 competent cells containing pAMS121(encoding the
wild-type luxR gene) and pAMS129 (encoding the lux operon) to confirm that the
mutations, by themselves, would decrease light output when in the presence of wild-type
LuxR. These luminescence assays were conducted as previously described using the
Turner 20/20 luminometer.
36
RESULTS AND DISCUSSION
Identifying positive control variants involved in LuxR-dependent transcriptional
activation of the lux operon
The effects of single alanine substitutions in LuxR were assessed by performing
bioluminescence assays. These in vivo luminescence experiments were conducted using
strains containing the plasmid reporter pJR551 with the pMAF series of LuxR variants.
Assays were performed twice with triplicate readings for each sample. LuxR variants
L183A, T184A, R186A, and E187A exhibited dark phenotypes indicating that
transcriptional activation of the lux operon was not initiated (Figure 8). These variants
may be defective in binding the lux box DNA. In the absence of exogenous autoinducer,
LuxR variants 180A-189A did not produce any light (data not shown) and therefore none
of the variants can activate transcription independent of 3-oxohexanoyl HSL.
By performing luciferase assays, it was quantitatively possible to more directly
measure the enzyme production/expression from the lux operon. Luciferase assays were
conducted in duplicate, with each sample tested in triplicate. The results from the
luciferase assays confirmed those found in the luminescence assays. Variants L183A,
T184A, R186A, and E187A were not able to activate the lux operon, and so therefore
virtually no detectable luciferase enzyme was being produced (Figure 9). Although it
37
Figure 8: Luminescence Assays for LuxR Variants The effect of alanine substitution on LuxR-dependent cellular luminescence determined in recombinant Escherichia coli in the presence of 3-oxohexanoyl HSL. Average value for 100%= 3950 RLU.
0
20
40
60
80
100
120
140
160
180
200
Wild-type F180A F181A D182A L183A T184A K185A R186A E187A K188A E189A
Position of Alanine Substitution in LuxR
%R
LU
38
Figure 9: Luciferase Assays for LuxR Variants The effect of alanine substitution on luciferase levels in extracts of recombinant Escherichia coli determined in the presence of 3-oxohexanoyl HSL. Average value for 100% = 1225 RLU.
0
50
100
150
200
250
300
Wild-type F180A F181A D182A L183A T184A K185A R186A E187A K188A E189A
Position of Alanine Substitution in LuxR
&R
LU
39
was proven that LuxR variants 180A-189A were unable to activate transcription from the
lux operon, it was unclear as to the nature of the defect providing this dark phenotype.
To determine if the problem was in DNA recognition/binding the lux box DNA or in
making the appropriate connections with RNAP, DNA binding/repression assays were
conducted.
Determining the ability of LuxR alanine substitution variants to recognize/bind to
the lux box DNA
The effects of alanine substitutions on DNA binding and repression were
determined through in vivo experiments using strains containing the plasmid reporter
p35LB10 in conjunction with the pMAF series of LuxR variants. Out of the 10 LuxR
variants analyzed, 8 were defective in recognizing/binding the lux box DNA (Figure 10).
Variants F181A and D182A exhibited wild-type phenotypes. Variants L183A, T184A,
R186A, and E187A, exhibiting dark phenotypes in the luminescence and luciferase
assays, but proved to be unable to recognize/bind the lux box and so did not repress
transcription of the reporter, as did the wild-type strain. The other four variants, being
bright in the luminescence and luciferase assays, were unable to repress transcription of
the reporter, and so were only able to bind/activate at the promoter of the lux operon in
the presence of E. coli RNAP. In the absence of an appropriately positioned RNAP
binding site, these variants (F180A, K185A, K188A, and E189A) are unable to bind
presumably due to lack of protein-protein contacts with RNAP.
40
Figure 10: DNA Binding/Repression Assays for LuxR Variants The effects of alanine substitution on DNA binding and repression at an artificial promoter construct containing the lux box was measured (Egland and Greenberg, 2000). Average value for 100% = 400 RLU.
0
20
40
60
80
100
120
140
Wild-type pKK223-3 F180A F181A D182A L183A T184A K185A R186A E187A K188A E189A
Position of Alanine Substitution in LuxR
% R
epre
ssio
n o
f W
ild-t
ype
41
Verification of variant LuxR protein production
SDS-PAGE and western immunoblotting experiments were performed to confirm
that the variant forms of LuxR were being produced from the host strain, E. coli JM109.
The western immunoblots confirmed production of variant LuxR (Figure 11). An equal
amount of cellular extract was loaded on the gel, subsequently transferred to the
nitrocellulose membrane and then treated with primary and secondary antibodies as
described in the Materials and Methods, Chapter 2. An altered mobility was seen with
variant E187A. The faster mobility may indicate a truncated protein but the DNA
sequence of this variant, along with the other nine LuxR alanine substitution variants
produced, was analyzed and proven to be of the correct size and nucleotide sequence.
Determination of intergenic suppression between amino acid residues of the αα
subunit of RNAP and LuxR positive control residue I206E
To investigate which residue(s) of the RNAP α subunit are associating with the
LuxR positive control residue 206, an E. coli strain was transformed with three separate
plasmids encoding the lux operon (pAMS129), the 206E variant of luxR (p206E), and a
randomly, chemically mutated form of the RNAP α subunit (pREIIα). Light should be
produced and detected from these cells with the occurrence of a compensatory mutation
in the α subunit. Elucidation of the amino acid residue responsible for the interaction
may be concluded after isolation of the variant pREIIα plasmid followed by sequencing
of rpoA. Out of 2500 transformants screened via high throughput luminescence assays,
two showed a possible revertant phenotype in that they produced luminescence at a level
42
Figure 11: Western Immunoblot of LuxR Alanine Substitution VariantsCell extracts from E. coli strains expressing the individual variants were exposedto LuxR antiserum to confirm LuxR protein production. The LuxR band ishighlighted with an asterisk.
30.5
kDa - + 180 181 182 183 184 185 186 187 188 189
*
43
intermediate between the negative and positive controls (data not shown). These two
possible intergenic suppressor mutants and were called IGS1 and IGS2 (intergenic
suppressor 1 and 2).
Luminescence assays were conducted in the presence of 200 nM 3-oxohexanoyl
HSL and 1 mM IPTG for induction to quantitate the level of luminescence produced from
IGS1 and IGS2. These assays confirmed the high throughput assays conducted in the 96
well plates. Bioluminescence levels exhibited from IGS1 and IGS2 were in fact stronger
than the wild-type levels (Figure 12). This finding indicated that a compensatory
mutation had occurred in the alpha subunit of RNAP and had suppressed the effect from
the mutation produced in amino acid residue 206 of LuxR.
To verify that IGS1 and IGS2 actually are intergenic suppressors, the
hydroxylamine treated plasmids encoding them were transformed into E. coli strains
containing the wild-type luxR gene, and the lux operon. Luminescence assays were again
conducted and the results showed a significant decrease in light production as compared
to the wild-type strain (Figure 13). Based on this information and the preliminary
nucleotide sequence analysis of these plasmids encoding the hydroxylamine mutagenized
DNA of the RNAP α subunit, it appears that amino acid residue 206 in LuxR is not
interacting with the α CTD. Over 70% of rpoA has been sequenced in IGS1 and IGS2.
Results from the sequencing indicate that no mutations were incorporated into the
CTD of rpoA; both IGS1 and IGS2 appear to have the wild-type sequence. Further
investigation and sequencing of the NTD of rpoA should reveal the amino acid(s)
responsible for the suppression of I206E in LuxR.
44
Figure 12: Intergenic Suppression Results for IGS1 and IGS2All strains contain pAMS129 encoding the lux operon.
Neg. Control: p206E + pREIIαPositive Control: pAMS121 + pREIIαIGS1 (Suppressor #1): p206E + hydroxylamine treated pREIIαIGS2 (Suppressor #2): p206E + hydroxylamine treated pREIIα
Average value for 100% = 1800 RLU.
0
50
100
150
200
250
300
Neg. Control Positive Control IGS1 IGS2
Intergenic Suppressor Strains
% R
LU
45
Figure 13: Complementation Analysis for Intergenic SuppressorsAll strains contain pAMS129 encoding the lux operon.
Neg. Control: p206E + pREIIαPositive Control: pAMS121 + pREIIαIGS1 (Suppressor #1): pAMS121 + hydroxylamine treated pREIIαIGS2 (Suppressor #2): pAMS121 + hydroxylamine treated pREIIα
Average value for 100% = 1800 RLU.
0
20
40
60
80
100
120
Neg. Control Positive Control IGS1 IGS2
Intergenic Suppressor Strains
% R
LU
46
CONCLUSIONS:
No additional positive control variants were identified through the experimental
analysis of the pMAF encoded LuxR variants. Though eight out of the ten were defective
in binding the lux box DNA, these alanine substitutions could not be clearly shown to
have any effect on making protein-protein interactions with RNAP and hence
transcriptional activation of the lux operon. Based on these data, the previously identified
positive control variants of LuxR (198A, 201A, and 206A), are the only single amino
acid residues known to be critical for making these contacts and interacting with RNAP
for transcription initiation. The two potential intergenic suppressor mutants discovered in
this study, IGS1 and IGS2, contain amino acid substitution(s) responsible for suppressing
the effect of 206E in LuxR. Interesting preliminary sequence analysis of IGS1 and IGS2
indicates that these mutations are not in the α CTD. Ongoing sequence analysis of the α
NTD is underway, and should indicate the amino acid residue(s) responsible for
suppression of the phenotype conferred by the 206E LuxR variant.
47
CHAPTER 3
Ability of EsaR and ExpR, two LuxR Homologues, to Bind to the luxBox and Activate the lux Operon
INTRODUCTION
LuxR homologue, ExpR, found in Erwinia carotovora, appears to be involved in
negatively regulating the expression of extracellular products required for virulence
determinants in this plant pathogen (Andersson et al., 2000). Interestingly, EsaR is a
transcriptional repressor found in Pantoea stewartii, another plant pathogen that controls
the production of extracellular polysaccharide (EPS) capsule that hinders the passage of
water through the xylem (von Bodman et al., 1995). The goal of this study was to
determine the ability of EsaR and ExpR to bind to the lux box and activate the lux operon.
Molecular cloning techniques were employed to clone luxR, esaR, and expR into the
expression vector pBAD22. β-galactosidase assays were used to determine the ability of
EsaR and ExpR to activate the lux operon using two new lambda reporter constructs. The
Top10λlux-lacZ Escherichia coli strain tests whether or not EsaR and ExpR activated
transcription from the lux operon like the positive control LuxR. The Top10λ35LB10 E.
coli strain was used as a reporter to measure the ability of EsaR and ExpR to bind to the
lux box. In this strain, the lux box is placed in between the -35 and -10 sites, so if the
protein bound to the lux box it will repress transcription. If a difference in expression is
observed in the activation assay, this second assay demonstrates if the defect was at the
level of DNA recognition versus the ability of the EsaR and ExpR to communicate with
the RNA polymerase when bound to the lux box.
48
MATERIALS AND METHODS
Cloning luxR into the expression vector pBAD22:
The plasmid, pJE202 (Engebracht, 1983) encoding the luxR gene, was isolated
using the QIAprep Spin Miniprep Kit (Qiagen) from an overnight culture of E. coli
JM109. After isolating the template DNA, the polymerase chain reaction (PCR) was
used to amplify the luxR gene. The PCR ‘master mix’ contained the following final
concentrations of reagents: 3 pmol/µL NLB primer (Table 5), 3 pmol/µL CLB primer
(Table 5), 0.2 mM dNTP’s (Promega), 2.5 units Taq2000 Polymerase (Stratagene), 1X
Taq2000 reaction buffer (Stratagene), 1.3 mM MgSO4 (Fisher, Springfield, NJ), and 100
ng of pJE202 template. The program for the PCR reaction was one cycle at 95°C for 2
minutes; 30 cycles: 94°C for 30 seconds, 45°C, for 30 seconds, and 72°C for 2 minutes;
one cycle at 72°C for 10 minutes. The formation of the PCR products was confirmed by
electrophoresis in a 0.8% agarose gel. The QIAquick PCR Purification Kit (Qiagen) was
used to purify the luxR insert.
The purified luxR insert was then ligated into pGEM using the pGEM-T easy
vector system (Promega) allowing for blue-white screening after transformation.
Ligation contents were introduced into DH5α competent cells and transformants selected
on plates containing 0.2 mM IPTG, 40 µg/mL X-Gal, and 100 µg/mL ampicillin. White
colonies from the overnight 37°C incubation were subcultured into LB broth containing
49
Table 5: Primers for luxR amplification
NLB 5’-CCGGAATTCACCATGAAAAACATAAATGCCGACGACCLB 5’-TCCCCCGGGCTATTAATTTTTAAAGTATGGGCAXBA200 5’-CGTATAATGTGTGGAATTGTGAGCGPVU200 5’-GAAGTGGTCCTGCAACTTTATCC
Table 6: Sequencing primers for pBAD-LuxR, EsaR, and ExpR
BADF 5’-TCGCAACTCTCTACTGTTCBADR 5’-CTTCTCTCATCCGCCAAAAC
Table 7: Primers for esaR amplification
EsaRF2 5’-GGAATTCACCATGTTTTCTTTTTTCCTTGEsaRR2 5’-CTCTAGATCACTACCTGGCCGCTGAC
Table 8: Primers for expR amplification
ExpRF2 5’-GGAATTCACCATGTCGCAGTTATTCTACAACExpRR2 5’-CTCTAGATCACTATGACTGAACCGGTCGG
Table 9: Mutagenic primers for expR
FixExpR1 5'-CCATCTCTCTGTACAGAGAGATGFixExpR2 5'-CATCTCTCTGTACAGAGAGATGGBold indicates silent mutation to incorporate an RsaI site for screeningUnderline indicates base change to incorporate original wild-type base
50
100 µg/mL ampicillin. Sequencing reactions using primers T7 and SP6 (Promega),
specific for the pGEM-T (Promega), were performed at the CSF-VBI at Virginia Tech
and confirmed the luxR insert was of the correct nucleotide sequence and was devoid of
any second site mutations.
Purified pGEM plasmid DNA containing the luxR insert was then subjected to a
sequential digest using EcoRI followed by an ethanol precipitation and addition of SmaI.
After incubation at 37°C for 2.5 hours, the digested products were run in a 0.8% gel, the
luxR insert was extracted and purified using the QIAquick Extraction Kit (Qiagen). The
expression vector pBAD22 was isolated in the same manner as pJE202, described
previously, and a sequential restriction digest was carried out using EcoRI and SmaI. The
resulting bands were extracted from a 0.8% agarose gel after electrophoresis and purified
using the QIAquick Extraction Kit (Qiagen). The luxR insert along with the vector from
pBAD22 were ligated using T4 DNA Ligase (New England Biolabs) overnight at 16°C.
Transformation into E. coli DH5α (Hanahan, D., 1983) was achieved by heat shocking
the competent cells/hybrid DNA molecules in 0.1 M CaCl2 (J.T. Baker Chemical Co.,
Phillipsburg, NJ) at 37°C for 2 minutes. After incubation on ice for 5 minutes, the cells
were grown in LB broth for one hour at 37°C and spread on plates containing 100 µg/mL
ampicillin. Subsequent colonies were picked and subcultured into LB broth containing
100 µg/mL ampicillin. Purification of the plasmids via the alkaline-lysis method followed
overnight growth at 37°C.
The purified plasmid DNA was confirmed to carry the luxR insert based on the
banding pattern present in the agarose gel when the DNA was cut with EcoRI and SmaI
51
as compared to the expression vector, pBAD22, without insert present. After this
confirmation, the plasmids were sequenced to ensure that no second site mutations had
arisen during the PCR or cloning steps. Sequencing was performed by CSF-VBI at
Virginia Tech using sequencing primers BADF and BADR (Table 6). The resulting
pBAD22-luxR plasmid, of correct sequence, was named pBAD-LuxR (pJKB1-1.5)
(Figure 14).
Cloning esaR into pBAD22 :
The E. coli DH5α strain containing pSVB5-18 (von Bodman, 1995) which
encodes EsaR was obtained from Susanne B. von Bodman. PCR was used to amplify the
esaR gene in the same manner as that used for the luxR gene previously described, but
primers EsaRF2 and EsaRR2 (Table 7) were employed for the formation of PCR product.
The PCR products were again purified using the QIAquick PCR Purification Kit (Qiagen)
and ligated into the pGEM T-easy vector (Promega). After transformation into DH5α,
colonies containing the insert were isolated. The plasmid DNA was purified via the
alkaline lysis method and subjected to restriction digestion with EcoRI and XbaI for
subsequent cloning into pBAD22. Due to the inefficiency of XbaI digestion, EcoRI was
exclusively used for extracting esaR from the pGEM T-easy vector since two EcoRI sites
were present flanking the esaR gene. The expression vector pBAD22 was linearized
using EcoRI, and the esaR gene with approximately 15 base pairs of the multiple cloning
site from the pGEM T-easy vector was ligated into it. The extra base pairs at the end of
the esaR gene are thought to not interfere with transcription of the gene since they are
52
Figure 14: Plasmid Map of pBAD-LuxR (pJKB1-1.5)Constructed by J. K. Ball
EcoRI
NheI
SmaI
BamHI
XbaI
AccI
PstI
SphI
HindIII
NheI
EcoRI
SmaI
BamHI
XbaI
AccI
PstI
SphI
HindIII
araC
PBAD
LuxR
rrnBbla
M13
pBR322 ori
pJKB1-1.5
5363 bp
pBAD�
luxR��
terminatorÇ
53
located after the translation termination site. To ensure that the esaR gene was correctly
oriented in the expression vector, restriction digestion was carried out at the conveniently
located KpnI sites. The correct construct was named pBAD-EsaR (pJKB2-11.11) (Figure
15).
Correcting the Nucleotide Sequence of expR and Subsequent Cloning into pBAD22:
Initial cloning of expR followed the same protocol as that for esaR as described
above. After PCR amplification, purification, ligation, and transformation of the gene
into the pGEM T-easy vector, the expR insert was sequenced at the CSF-VBI and the
PCR product, as well as the original plasmid template pSA018 (Andersson et al., 2000),
were found to contain a stop codon approximately three quarters of the way into the
coding sequence. Site directed mutagenesis was employed to change the amino acid
residue back to its original codon. Primers were designed for the amplification (Table 8)
and mutagenesis (Table 9) of expR using overlap PCR (Chapter 2) for incorporating the
amino acid residue change as well as the addition of a RsaI site for screening purposes.
After PCR, the plasmid DNA was purified and ligated into the pGEM T-easy vector as
described above. After EcoRI digestion of the pGEM T-easy vector and pBAD22, the
expR insert was ligated into the expression vector and transformed into E. coli DH5α.
Since there were not any convenient restriction sites in expR for determining the
orientation of the gene orientation of the gene in the vector, PCR was again employed.
Primers BADF and ExpRR2 (Tables 6 & 8) were used to amplify the gene and check the
size of the resulting PCR product. Clones having the correct insert were sent to CLF-VBI
54
KpnI
Figure 15: Plasmid Map of pBAD-EsaR (pJKB2-11.11)Relevant characteristics shown; see text for details.Constructed by J. K. Ball
EcoRI
NheI
XbaI
EcoRI
NcoI
SmaI
KpnI
BamHI
XbaI
AccI
PstI
SphI
HindIII
NheI
EcoRI
XbaI
EcoRI
NcoI
SmaI
KpnI
BamHI
XbaI
AccI
PstI
SphI
HindIII
araC
PBAD
EsaR
rrnBbla
M13
pBR322 ori
pJKB2-11.11
5389 bp
esaR�
terminatorÇ
pBAD
55
for sequencing with BADF and BADR primers (Table 6) to ensure the correct sequence.
The correct construct was subsequently named pBAD-ExpR (pJKB3-1.2) (Figure 16).
ββ-galactosidase Assays:
The E. coli Top10 activation (λlux-lacZ) and repression (λ35LB10) strains (Grant
et al., 1990; M. Urbanowski, personal communication) used for the assays were
genotypically araBAD-, and therefore did not have the ability to metabolize arabinose.
Strains were grown overnight and subcultured into media without arabinose to prevent
leaky expression of the pBAD promoter. The strains containing pBAD22, pBAD-LuxR,
pBAD-EsaR, and pBAD-ExpR were grown overnight at 30°C in RM minimal media
(2% casamino acids, 1X M9 salts (Na2HPO4, KH2PO4, NaCl, NH4Cl), 0.4% glucose, and
0.1 M MgCl2) containing 100 µg/mL ampicillin to an OD600 of 0.2-1.0. Strains were then
subcultured into four sets of RM minimal media (2% casamino acids, 1X M9 salts
(Na2HPO4, KH2PO4, NaCl, NH4Cl), 0.4% glucose, and 0.1 M MgCl2 with ampicillin
(100 µg/mL) broth containing: (1) no addition (2) 0.2% arabinose (3) 1 µM 3-
oxohexanoyl-DL-HSL, (4) 1 µM 3-oxohexanoyl-DL-HSL and 0.2% arabinose to an
OD600 of 0.025, and subsequently grown to a final OD600 of 0.5 (mid-exponential log-
phase growth). At this point, the cells were stored on ice. When all samples had reached
an OD600 of 0.5, 5 µL of cells were diluted with 995 µL Z Buffer (60 mM Na2HPO4, 40
mM NaH2PO4, 10 mM KCl, 1 mM MgSO4) with added DTT at a concentration of
400 µM. Chloroform (50 µL) was added to the cells and then the suspension was briefly
56
Figure 16: Plasmid Map of pBAD-ExpR (pJKB3-1.2)Construction was assisted by J.K. Ball
EcoRI
NheI
XbaI
EcoRI
NcoI
KpnI
SmaI
BamHI
XbaI
AccI
PstI
SphI
HindIII
NheI
EcoRI
XbaI
EcoRI
NcoI
KpnI
SmaI
BamHI
XbaI
AccI
PstI
SphI
HindIII
araC
PBAD
ExpR
rrnBbla
M13
pBR322 ori
pJKB3-1.2
5374 bp
terminatorÇ
expR�
pBAD
57
vortexed to cause lysis. After lysis, 10 µL of the cell extract was added to wells of a
Lucy microtiter dish plate and incubated for one hour with 100 µL of room temperature
reaction buffer and substrate from the chemiluminescent reporter assay kit (Tropix,
Bedford, MA) mixed at a ratio of 100:1, respectively. After the one-hour incubation, all
of the samples were tested in the same order they were set up with reaction buffer mixed
with substrate. The accelerator was brought to room temperature and 150 µL was added
to each tube prior to being placed in the Lucy 1 measured for light output over a 20
second integration period. Each sample was tested in triplicate, and light output was
measured in relative light units.
58
RESULTS AND DISCUSSION
The activation assay results (Table 10) using the reporter strain E. coli
Top10λlux-lacZ revealed that EsaR is capable of activating transcription from the lux
operon promoter. EsaR activated transcription of the reporter roughly 5 fold while the
positive control activated transcription at a higher rate (roughly 15 fold). In the presence
of autoinducer, activation from EsaR was blocked. The test strain expressing ExpR
produced low levels of β-galactosidase, less than two fold above background and
therefore, the ExpR protein is barely able to activate transcription from the lux operon
promoter.
Using the reporter strain E. coli Top10λ35LB10, the repression assay results
(Table 11) demonstrate that EsaR can weakly repress transcription of the lacZ gene
though not at the level of the control strain (roughly six fold repression) expressing LuxR
from the pBAD-LuxR plasmid. The strain containing pBAD-ExpR, did not have the
ability to repress transcription; the level of β-galactosidase produced from this strain was
actually higher than that of the negative control strain containing the expression vector,
pBAD22.
59
Table 10: Activation Assays for LuxR, EsaR and ExpR
Plasmid + Inducer Relative Light UnitspBAD 1.70pBAD + Ara 1.77pBAD + VAI 1.77pBAD + VAI + Ara 1.81
pBAD-LuxR 1.83pBAD-LuxR + Ara 1.86pBAD-LuxR+ VAI 3.31pBAD-LuxR + VAI + Ara 33.5
pBAD-EsaR 2.17pBAD-EsaR + Ara 9.70pBAD-EsaR + VAI 2.01pBAD-EsaR + VAI + Ara 2.96
pBAD-ExpR 2.07pBAD-ExpR + Ara 3.59pBAD-ExpR + VAI 2.08pBAD-ExpR + VAI + Ara 3.32
Ara = arabinose at 0.2%
VAI = Vibrio fischeri autoinducer at 1µM
60
Table 11: Repression Assays for LuxR, EsaR and ExpR
Plasmid + Inducer Relative Light UnitspBAD 115pBAD + Ara 107pBAD + VAI 114pBAD + VAI + Ara 106
pBAD-LuxR 138pBAD-LuxR + Ara 120pBAD-LuxR+ VAI 125pBAD-LuxR + VAI + Ara 26.1
pBAD-EsaR 123pBAD-EsaR + Ara 71.7pBAD-EsaR + VAI 133pBAD-EsaR + VAI + Ara 97.9
pBAD-ExpR 152pBAD-ExpR + Ara 146pBAD-ExpR + VAI 147pBAD-ExpR + VAI + Ara 146
Ara = arabinose at 0.2%
VAI = Vibrio fischeri autoinducer at 1µM
61
CONCLUSIONS:
It has been demonstrated that the LuxR homologue EsaR, previously shown to
function as a repressor, has retained an ability to function as an activator of transcription
by RNAP. Furthermore, it can bind and recognize the lux box but at a lower affinity than
LuxR. On the other hand, ExpR activates transcription at rates just a little higher than
background and seems to be unable to recognize the lux box. Interestingly, as previously
proposed, EsaR is inactivated by the presence of 3-oxohexanoyl HSL (von Bodman et al.,
1998). Addition of the VAI at 1 µM did not fully inactivate EsaR hence further
experiments at a higher concentration of 3-oxohexanoyl HSL (100 µM as per Minogue et
al., 2002) are warranted.
By performing the assays again under this set of conditions, it is possible that the
background activity levels from the repression assays would be lowered, allowing for
clearer results. Also, by subculturing the test strains at a much lower optical density, the
amount of LacZ produced within the cells during the overnight culturing would be
considerably diluted with a few extra generations. This would also lower the background
of LacZ seen in the assays.
62
CHAPTER 4
Annotating the Vibrio fischeri Genome
FIAT TEAM
In conjunction with the Chicago-based company Integrated Genomics, Inc. (IG),
work has been performed as part of a multi-lab team of researchers known as the FIAT
(Fischeri Intrinsic Annotation Team) to help annotate the Vibrio fischeri genome. This
company provides full genomic services including high throughput DNA sequencing,
assembly, annotation, and metabolic reconstruction for industrial and academic clients.
Originally the company focused on bacterial genomes, gathering and analyzing enough
information to produce a database encompassing over 280 genomes and more than 3,500
biochemical pathways.
Within the IG website, the system termed ERGO is based on and allows for
cross-genome analysis. By appointing different contigs to separate labs, it is possible for
the analysis and cross referencing that is needed for assigning functions to these stretches
of DNA, i.e., annotating the genome. The new gene assignments permitted by using the
ERGO suite are reevaluated by the ‘master’ computer and may ultimately be tested as
well in a biochemical lab, leading to the identification of potential targets for new
antibiotics or for strain engineering for improved industrial fermentation, crop
production, and drug discovery.
63
OVERALL CONTRIBUTIONS
To date, 326 open reading frames of the V. fischeri IG30 strain have been
annotated through Ann Stevens' Lab; I have personally annotated 216 open reading
frames. The annotation is conducted through homology searches, BLAST searches,
comparing preserved operons among different organisms, investigating protein
denaturation temperatures, membrane spanning helices and domains, as well as other
relevant characteristic features of the amino acid sequences and/or operons. It was
possible to determine the function of many of the open reading frames and submit the
suggestion to the databank. As the project started, the DNA contigs were separated and
disorganized. Through work from a number of labs around the country, the contigs
should soon be fully merged. Annotations will proceed until all of the open reading
frames of V. fischeri have been assigned by IG, Inc. and annotated. The anticipated
completion date falls late this year or next. By completing the annotation of the genome,
it will be possible to better understand the quorum sensing systems in V. fischeri, and
possibly discover new regulons within the genome.
64
CHAPTER 5
REFERENCES
Andersson, R. A., Eriksson, A. R. B., Heikinheimo, R., Mäe A., Pirhonen, M., Koiv V., Hyytiainen, H., Tuikkata, A., and Palva, E. T. (2000). Quorum Sensing in Plant Pathogen Erwinia carotovora subsp. carotovora: The Role of expRECC. Molecular Plant-Microbe Interactions 13: 384-393.
Baikalov, I., Schroder, I., Kaczor-Grzeskowiak, M., Grzeskowiak, K., Gunsalus, and R.P., Dickerson, R.E. (1996). Structure of the Escherichia coli response regulator NarL. Biochemistry 35:11053-11061.
Beatson, S.A., Whitchurch, C.B., Sargent, J.L, Levesque, R.C., and Mattick, J.S. (2002). Differential Regulation of Twitching Motility and Elastase Production by Vfr in Pseudomonas aeruginosa. J. Bacteriol. 184: 3605-3613.
Beck von Bodman, S., and Farrand, S.K. (1995). Capsular polysaccharide biosynthesis and pathogenicity in Erwinia stewartii require induction by an N- acylhomoserine lactone autoinducer. J. Bacteriol. 177:5000-5008.
Beck von Bodman, S., Majerczak, D.R., and Coplin, D. L. (1998). A negative regulator mediates quorum sensing control of exopolysaccharide production in Pantoea stewartii subsp. stewartii. Proc. Natl. Acad. Sci. USA 95:7687-7692.
Blatter, E.E., Ross, W., Tang, H., Gourse, R.L., and Ebright, R.H. (1994). Domain organization of RNA polymerase α subunit: C-terminal 85 amino acids constitute an independently folded domain capable of dimerization and DNA binding. Cell 78:889-896.
Choi, S.H. and Greenberg, E.P. (1991). The C-terminal region of the Vibrio fischeri protein contains an autoinducer-independent lux gene activating domain. Proc. Natl. Acad. Sci. USA 88:11115-11119.
Choi, S.H. and Greenberg, E.P. (1992). Genetic disection of DNA binding and luminescence gene activation by the Vibrio fischeri LuxR protein. J. Bacteriol. 174: 4064-4069.
Dunlap, P.V., and Greenberg, E.P. (1985). Control of Vibrio fischeri luminescence gene expression in Escherichia coli by cyclic AMP receptor protein. J. Bacteriol. 164: 45-50.
65
Dunlap, P.V., and Ray, J.M. (1989). Requirement for autoinducer in transcriptional negative autoregulation of the Vibrio fischeri luxR gene in Escherichia coli. J. Bacteriol. 171:3549-3552.
Eberl, L. (1999). N-acyl homoserine lactone-mediated gene regulation in Gram negative bacteria. System. Appl. Microbiol. 22: 493-506.
Egland, K.A. and Greenberg, E.P. (2000). Conversion of the Vibrio fischeri Transcriptional Activator, LuxR, to a Repressor. J. Bacteriol. 182: 805-811.
Egland, K.A. and Greenberg, E.P. (2001). Quorum sensing in Vibrio fischeri: analysis of the LuxR DNA binding region by alanine-scanning mutagenesis. J. Bacteriol. 183: 382-386.
Engebrecht, J., Nealson, K., and Silverman, M. (1983). Bacterial Bioluminescence: Isolation and Genetic Analysis of Functions from Vibrio fischeri. Cell 32:773-781.
Finney, A.H., Blick,R.J., Murakami, K., Ishihama, A., and Stevens, A.M. (2000). Role of C terminal Domain of the Alpha Subunit of RNA Polymerase in LuxR- Dependent Transcriptional Activation of the lux Operon during Quorum Sensing. J. Bacteriol. 184:4520-4528.
Fuqua, C., Winans, S.C., and Greenberg, E. P. (1994). Quorum Sensing in bacteria: The LuxR-LuxI family of cell density-responsive transcriptional regulators. J. Bacteriol. 176: 269-275.
Fuqua, C., Winans, S.C., and Greenberg, E. P. (1996). Census and consensus in bacterial ecosystems: The LuxR-LuxI family of quorum-sensing transcriptional regulators. Annu. Rev. Microbiol. 50: 727-751.
Fuqua, C., Parsek, M. R., and Greenberg, E. P. (2001). Regulation of gene expression by cell-to-cell communication: acyl-homoserine lactone quorum sensing. Annu. Rev. Genet. 35: 439–468.
Grant, S.G., Jessee, J., Bloom, F.R., and Hanahan, D., (1990). Differential plasmid rescue from transgenic mouse DNAs into Escherichia coli methylation-restriction mutants. Proc. Natl. Acad. Sci. USA 87: 4645-4649
Gray, K. M., Passador, L., Iglewski, B. H., and Greenberg, E. P. (1994). Interchangeability and specificity of components from the quorum- sensing regulatory systems of Vibrio fischeri and Pseudomonas aeruginosa. J. Bacteriol. 176: 3076- 3080.
66
Greenberg, E.P. (1997). Quorum Sensing in Gram-negative bacteria. ASM News 63: 371-377.
Hanahan, D. (1983). Studies on transformation of Escherichia coli with plasmids. J.Mol.Biol. 166:557-580.
Higuchi, R., Krummel, B., and Saiki R.K. (1988). A general method of in vitro preparation and specific mutagenesis of DNA fragments: study of protein and DNA interactions. Nucl. Acids. Res. 16: 7351-7367.
Ho, S.N., Hunt, H. D., Horton, R. M., Pullen, J. K., and Pease, L. R. (1989). Site- directed mutagenesis by overlap extension using the polymerase chain reaction. Gene 77: 51.
Kaplan, H.B. and Greenberg, E.P. (1985). Diffusion of autoinducer is involved in the regulation of the Vibrio fischeri luminescence system. J. Bacteriol. 163:1210.
Koiv V. and Mäe A. (2001). Quorum sensing controls the synthesis of virulence factors by modulating rsmA gene expression in Erwinia carotovora subsp carotovora. Molecular Genetics and Genomics 265: 287-292.
Jones, S., Yu, B., Bainton, N.J., Birdsall, M., Bycroft, B.W., Chhabra, K., Salmond, G.P.C., Stewart, G.S.A.B., and Williams, P. (1993). The lux autoinducer regulates the production of exoenzyme virulence determinants in Erwinia carotovora and Pseudomonas aeruginosa. EMBO J. 12: 2477-2482.
Luo, Z. Q. and Farrand, S. K. (1999). Signal-dependent DNA binding and functional domains of the quorum-sensing activator TraR as identified by repressor activity. Proc. Natl. Acad. Sci. USA. 96: 9009-9014.
Mäe, A., Montesano, M., Koiv, V., and Palva, E.T. (2001). Transgenic plants producing the bacterial pheromone N-acyl-homoserine lactone exhibit enhanced resistance to the bacterial phytopathogen Erwinia carotovora. Molecular Plant- Microbe Interactions 14: 1035-1042.
McFall-Ngai, M. J., and Ruby, E. G. (1991). Symbiont recognition and subsequent morphogenesis as early events in an animal-bacterial mutualism. Science 254: 1491- 1494.
Michael, S. F. (1994). Mutagenesis by incorporation of a phosphorylated oligo during PCR amplification. BioTechniques 16:410-412.
Miller, M.B. and Bassler, B.L. (2001). Quorum sensing in bacteria. Annu. Rev. Microbiol. 55: 169-199.
67
Minogue, T. M., Wehland-von Trebra, M., Bernhard, F., and von Bodman, S. B. (2002). The autoregulatory role of EsaR, A quorum sensing regulator in Pantoea stewartii subsp. stewartii: evidence for a repressor function. Molecular Microbiology 44:1625-1635.
Nealson, K.H., Platt, T., and Hastings, J.W. (1970) Cellular control of the synthesisand activity of the bacterial luminescence system. J. Bacteriol. 104: 313-322.
Nyholm, S.V. and McFall-Ngai, M.J. (1998). Sampling the light-organ microenvironment of Euprymna scolopes: description of a population of host cells in association with the bacterial symbiont Vibrio fischeri. Biol. Bull. 195:89–97.
Parsek, M. R. and Greenberg, E. P. (2000). Acyl-homoserine lactone quorum sensing in Gram-negative bacteria: A signaling mechanism involved in associations with higher organisms. Proc. Natl. Acad. Sci. USA. 97: 8789-8793.
Pataky, J. K., Michener, P. M., Freeman, N. D., Weinzierl, R. A., and Teyker, R. H. (2000). Control of Stewart's wilt in sweet corn with seed treatment insecticides. Plant Dis. 84:1104-1108.
Pearson, J.P., Gray, K.M., Passador, L., Tucker, K.D., Eberhard, A., Iglewski, B.H., and Greenberg, E.P. (1994). Structure of the autoinducer required for expression of Pseudomonas aeruginosa virulence genes. Proc. Natl. Acad. Sci. USA. 91: 197-201.
Pirhonen, M., Flego, D., Heikinheimo, R., and Palva, E.T. (1993). A small diffusable signal molecule is responsible for the global control of virulence and exoenzyme production in the plant pathogen Erwinia cartovora. EMBO J. 12: 2467-2476.
Ruby E.G. and McFall-Ngai, M.J. (1992). A squid that glows in the night: Development of an animal-bacteria mutualism. J. Bacteriol. 174: 4865-4870.
Sambrook, J., Fritsch, E.F., and Maniatis, T. (1989). Molecular Cloning: A Laboratory Manual. Cold Spring Harbor Laboratory Press.
Simon, R., Quandt, J., and Klipp, W. (1989). New derivatives of transposon Tn5 suitable for mobilization of replicons, generation of operon fusions and induction of genes in Gram-negative bactetria. Gene 80: 131-169.
Slock, J., VanRiet, D., Kolibachuk, D., and Greenberg, E.P. (1990). Critical regions of the Vibrio fischeri LuxR protein defined by mutational analysis. J. Bacteriol. 172: 3974-3979.
68
Stevens, A.M., Dolan, K.M., and Greenberg, E.P. (1994). Synergistic binding of the Vibrio fischeri LuxR transcriptional activator domain and RNA polymerase to the lux promoter region. Proc. Natl. Acad. Sci. USA 91: 12619-12623.
Stevens, A.M., Fujita, N., Ishihama, A., and Greenberg, E.P. (1999). Involvement of the α subunit of RNA polymerase in LuxR-dependent activation of the luminescence genes during quorum sensing. J. Bacteriol. 181:4704-4707.
Trott, A.E. and Stevens, A.M. (2001). Amino acid residues in LuxR critical for its mechanism of transcriptional activation during quorum sensing in Vibrio fischeri. J. Bacteriol. 183: 387-392.
Vannini, A., Volpari, C., Gargiolo, C., Muraglia, E., Cortese, R., and DeFranco, R. (2002). The crystal structure of the quorum sensing protein TraR bound to its autoinducer and target DNA. EMBO J. 21: 4393-4401.
Visick, K. L., Foster, J., Doino, J., McFall-Ngai, M., and Ruby. E. G. (2000). Vibrio fischeri lux genes play an important role in colonization and development of the host light organ. J. Bacteriol. 182: 4578-4586.
Welch, M., Todd, D. E., Whitehead, N. A., Mc-Gowan, S. J., Bycroft, B. W., and Salmond, G. P. (2000). N-acyl homoserine lacton binding to the CarR receptor determines quorum sensing specificity in Erwinia. EMBO. J. 19: 631-641.
Whitehead, N.A., Barnard, A.M.L., Slater, H., Simpson, N.J.L., and Salmond, G.P.C. (2001). Quorum sensing in Gram negative bacteria. FEMS Micro. Reviews 25: 365-404.
Williams, P.W., Camara, M., Hartman, A., Swift, S., Milton, D., Hope, V.J., Winzer, K., Middleton, B., Pritchard D.I., and Bycroft B. W. (2000). Quorum sensing and the population-dependent control of virulence. Phil. Trans. R. Soc. London B pp667- 680.
Withers, H., Swift, S., and Williams, P. (2001). Quorum Sensing as an integral component of gene regulatory networks in Gram-negative bacteria. Curr. Opin. Micro. 4: 186-193.
Yanich-Perron, C., Viera, J., and Messing, J. (1985). Improved M13 phage cloning vectors and host strains: nucleotide sequences of the M13mp18 and pUC19 vectors. Gene 33: 103-119.
69
Zhang, R.G., Pappas, T., Brace, J.L., Miller, P.C., Oulmassov, T., Molyneaux, J.M.,Anderson, J.C., Bashkin, J.K., Winans, S.C., and Joachimiak, A. (2002).Structure of a bacterial quorum-sensing transcription factor complexed withpheromone and DNA. Nature 417: 971-974.
70
Marie A. FainiHome address: Ph. (540) 443-11901201 Progress St. 7500G Email: mfaini@vt.eduBlacksburg,VA 24060
Education:M.S. in Microbiology, Virginia Polytechnic Institute & State University
Expected Completion Date: May 2003B.S. in Biochemistry, Virginia Polytechnic Institute & State University, 1999Assoc. in Chemistry, Raritan Valley Community College, 1997
Employment History:1/01-6/03 Graduate Assistantship at Virginia Tech., Blacksburg, VA
Performed alanine-scanning site directed mutagenesis via overlap-PCR on the quorum sensing activator protein, LuxR, of Vibrio fischeri Research included luciferase, luminescence, DNA binding/repression assays, western
immunoblotting and intergenic suppression studies involving Escherichia coliRNAP
Member of the Vibrio fischeri genome annotation team; annotated 216 ORF's Mentored Lauren Senty, an undergraduate research student 8/01-12/02 Participated in microbiology departmental lab meetings and journal club
10/99-1/00 Quality Control technician at Jacobus Pharmaceuticals Inc., Plainsboro, NJ 6/00-8/00 Sampled and tested bulk/finished drug products; approved or denied products
Performed dissolution, thin-layer chromatography, titrations, chemical tests
12/98-1/99 Lab Technician at Biotechnology Training Institute, Lebanon, NJ Performed experiments in manual peptide synthesis
8/99 Cell culture experiments: growing, splitting, freezing mammalian cell lines
6/98-8/98, Research Assistant of Dr. Stanley Katz at Rutgers University, NJ Assisted in the design of experiments on antibiotic incidence in NJ milk supply Performed zone of inhibition assays; publication waiting
Teaching Experience:Graduate Teaching Assistant: General Biology Laboratory, Spring 2001 (BIOL 1016, 1116)
Presentations:10/3/01 Microbiology Departmental Seminar, Virginia Tech, “Bacteria-host Interactions
Involving Quorum Sensing”8/20-8/25/02 Poster Presentation: Cold Spring Harbor Laboratory Phage & Genetics Meeting, Cold Spring Harbor, NY, “Amino Acid Residues Involved in Protein-Protein Interactions
Between RNA Polymerase and the Quorum Sensing Activator LuxR”5/18-5/23/03 Poster Presentation: ASM 103rd General Meeting, Washington D.C,
"The Amino Acid Residues Involved in Protein-Protein Interactions between RNAPolymerase and the Quorum Sensing Activator LuxR"