Post on 15-Oct-2021
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) AdministrationSession ID 11306
Kevin Hudson Senior DirectorElke Phelps Product Management DirectorApplications TechnologyE-Business Suite DevelopmentOracle
April 2019
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Safe Harbor Statement
The preceding is intended to outline our general product direction It is intended for information purposes only and may not be incorporated into any contract It is not acommitment to deliver any material code or functionality and should not be relied upon in making purchasing decisions The development release timing and pricing of any features or functionality described for Oraclersquos products may change and remains at the sole discretion of Oracle Corporation
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 3
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
4
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
5
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureClient
JDB
CSQ
L Ne
t
HTTP
S
Application Database
RAC amp ASM
Global Single Data Model
Edition-Based Redefinition
WebLogic JSP
Forms
BI Publisher
BC4J
Web
Lis
ten
er
UIX 11g
WebLogic Server
6
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull In a nutshell E-Business Suite 122 feels like
ndash A handful of web applicationshellip
ndash Deployed to Clusters of Managed Servershellip
ndash Supervised by an Admin Serverhellip
ndash Deployed to a WebLogic Server Domain
7
Oracle E-Business Suite 122 ArchitectureWhat is E-Business Suite from a WebLogic Perspective
WLS DomainAdmin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureOracle WebLogic Server Domain
bull oacore Core functionality in EBS middle tier Java code including OAF based functionality for EBS products
bull forms Serves all Oracle forms functionality
bull oafm Web services Secure Search and Oracle Transport Agent (OXTA)
oacore_server
forms_server
oafm_server
forms-c4ws_serverNote As of AD-TXK Delta 6 forms-c4ws is disabled
8
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Online Patching Cycle - Overview
Understanding the Online Patching Cycle
bull The Basics
bull Remove obsolete objects
Cleanup
bull Restart application on
Patch Edition
Cutover
bull Compile invalid Objects
bull Wait for a good downtime window
Finalize
bull Apply one or more patches to the Patch Edition
Apply
bull Copy the production application code
bull Create a new Patch Edition in the database
Prepare
Users Online Users OnlineUsers Offline
bull Online Patching is used to apply all EBS patches in EBS 122bull Online Patching cycle includes 5 major phasesbull New patching tool ldquoadoprdquo orchestrates the patching cycle
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Run file system
ndash Used by online users
ndash Stores a complete copy of all Applications and Middle Tier code
ndash Logically mapped to either fs1 or fs2
bull Patch file system
ndash Used by patching tools
ndash Stores a complete copy of all Applications and Middle Tier code
ndash Logically mapped to either fs1 or fs2
bull Non-Editioned file system
ndash Used for data fileseg data importexport files log files report output files
ndash Only stores data files
Online Patching uses a Dual File System
fs1 and fs2 switch Run and Patch designation during the cutover phase of an Online Patching cycle
fs1
Run
Cutoverfs1fs2
PatchPatch
fs2
Run
10
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition
11
Synchronization Managed by Patching Tools
Edition-Based Redefinition
Non-Editioned File System
Run File System
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Patch File System
PATCH_TOP
APPL_TOP_NE
LOGS
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
MOS Note 15839021
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview
Install base
fs_nefs2 EBSappsenvfs1
New file to set the environmentEBSappsenv RUN|PATCH
EBSapps instFMW_HOME EBSapps instFMW_HOME
12
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
$IAS_ORACLE_HOME
$FMW_HOME
EBS WLS Domain
ConfigurationFiles
WLSBinaries
WLSBinaries
Java Required Files for EBS
$EBS_ORACLE_HOME
Oracle HTTP Server
13
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
14
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 comnappl
Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology
EBSapps
15
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 Oracle Home
bull All major services are started out of the Fusion Middleware ORACLE_HOME
ndash formsappear is deployed out of the 1012 ORACLE_HOME
ndash frmweb executable is also invoked out of 1012 ORACLE_HOME
Used for Oracle forms technology
16
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
File System 1
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
File System 2
17
Synchronization Managed by Patching Tools
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
18
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
19
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS
Description Context File VariableUnique Across
Dual File SystemsExample
File System 1Example
File System 2
Port Pool s_port_pool No 0 10
Web Listener Port s_webport No 8000 8000
Web SSL Port s_webssl_port No 4443 4443
Active Web Port s_active_webport No 80004443 80004443
OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009
Node Manager Port s_nmport Yes 5556 5566
WLS Admin Server Port s_wls_adminport Yes 7001 7011
WLS oacore Application port s_wls_oacoreport Yes 7201 7211
WLS Forms Application Port s_wls_formsport Yes 7401 7411
WLS oafm Application Port s_wls_oafmport Yes 7601 7611
20
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Safe Harbor Statement
The preceding is intended to outline our general product direction It is intended for information purposes only and may not be incorporated into any contract It is not acommitment to deliver any material code or functionality and should not be relied upon in making purchasing decisions The development release timing and pricing of any features or functionality described for Oraclersquos products may change and remains at the sole discretion of Oracle Corporation
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 3
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
4
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
5
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureClient
JDB
CSQ
L Ne
t
HTTP
S
Application Database
RAC amp ASM
Global Single Data Model
Edition-Based Redefinition
WebLogic JSP
Forms
BI Publisher
BC4J
Web
Lis
ten
er
UIX 11g
WebLogic Server
6
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull In a nutshell E-Business Suite 122 feels like
ndash A handful of web applicationshellip
ndash Deployed to Clusters of Managed Servershellip
ndash Supervised by an Admin Serverhellip
ndash Deployed to a WebLogic Server Domain
7
Oracle E-Business Suite 122 ArchitectureWhat is E-Business Suite from a WebLogic Perspective
WLS DomainAdmin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureOracle WebLogic Server Domain
bull oacore Core functionality in EBS middle tier Java code including OAF based functionality for EBS products
bull forms Serves all Oracle forms functionality
bull oafm Web services Secure Search and Oracle Transport Agent (OXTA)
oacore_server
forms_server
oafm_server
forms-c4ws_serverNote As of AD-TXK Delta 6 forms-c4ws is disabled
8
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Online Patching Cycle - Overview
Understanding the Online Patching Cycle
bull The Basics
bull Remove obsolete objects
Cleanup
bull Restart application on
Patch Edition
Cutover
bull Compile invalid Objects
bull Wait for a good downtime window
Finalize
bull Apply one or more patches to the Patch Edition
Apply
bull Copy the production application code
bull Create a new Patch Edition in the database
Prepare
Users Online Users OnlineUsers Offline
bull Online Patching is used to apply all EBS patches in EBS 122bull Online Patching cycle includes 5 major phasesbull New patching tool ldquoadoprdquo orchestrates the patching cycle
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Run file system
ndash Used by online users
ndash Stores a complete copy of all Applications and Middle Tier code
ndash Logically mapped to either fs1 or fs2
bull Patch file system
ndash Used by patching tools
ndash Stores a complete copy of all Applications and Middle Tier code
ndash Logically mapped to either fs1 or fs2
bull Non-Editioned file system
ndash Used for data fileseg data importexport files log files report output files
ndash Only stores data files
Online Patching uses a Dual File System
fs1 and fs2 switch Run and Patch designation during the cutover phase of an Online Patching cycle
fs1
Run
Cutoverfs1fs2
PatchPatch
fs2
Run
10
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition
11
Synchronization Managed by Patching Tools
Edition-Based Redefinition
Non-Editioned File System
Run File System
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Patch File System
PATCH_TOP
APPL_TOP_NE
LOGS
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
MOS Note 15839021
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview
Install base
fs_nefs2 EBSappsenvfs1
New file to set the environmentEBSappsenv RUN|PATCH
EBSapps instFMW_HOME EBSapps instFMW_HOME
12
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
$IAS_ORACLE_HOME
$FMW_HOME
EBS WLS Domain
ConfigurationFiles
WLSBinaries
WLSBinaries
Java Required Files for EBS
$EBS_ORACLE_HOME
Oracle HTTP Server
13
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
14
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 comnappl
Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology
EBSapps
15
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 Oracle Home
bull All major services are started out of the Fusion Middleware ORACLE_HOME
ndash formsappear is deployed out of the 1012 ORACLE_HOME
ndash frmweb executable is also invoked out of 1012 ORACLE_HOME
Used for Oracle forms technology
16
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
File System 1
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
File System 2
17
Synchronization Managed by Patching Tools
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
18
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
19
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS
Description Context File VariableUnique Across
Dual File SystemsExample
File System 1Example
File System 2
Port Pool s_port_pool No 0 10
Web Listener Port s_webport No 8000 8000
Web SSL Port s_webssl_port No 4443 4443
Active Web Port s_active_webport No 80004443 80004443
OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009
Node Manager Port s_nmport Yes 5556 5566
WLS Admin Server Port s_wls_adminport Yes 7001 7011
WLS oacore Application port s_wls_oacoreport Yes 7201 7211
WLS Forms Application Port s_wls_formsport Yes 7401 7411
WLS oafm Application Port s_wls_oafmport Yes 7601 7611
20
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
4
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
5
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureClient
JDB
CSQ
L Ne
t
HTTP
S
Application Database
RAC amp ASM
Global Single Data Model
Edition-Based Redefinition
WebLogic JSP
Forms
BI Publisher
BC4J
Web
Lis
ten
er
UIX 11g
WebLogic Server
6
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull In a nutshell E-Business Suite 122 feels like
ndash A handful of web applicationshellip
ndash Deployed to Clusters of Managed Servershellip
ndash Supervised by an Admin Serverhellip
ndash Deployed to a WebLogic Server Domain
7
Oracle E-Business Suite 122 ArchitectureWhat is E-Business Suite from a WebLogic Perspective
WLS DomainAdmin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureOracle WebLogic Server Domain
bull oacore Core functionality in EBS middle tier Java code including OAF based functionality for EBS products
bull forms Serves all Oracle forms functionality
bull oafm Web services Secure Search and Oracle Transport Agent (OXTA)
oacore_server
forms_server
oafm_server
forms-c4ws_serverNote As of AD-TXK Delta 6 forms-c4ws is disabled
8
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Online Patching Cycle - Overview
Understanding the Online Patching Cycle
bull The Basics
bull Remove obsolete objects
Cleanup
bull Restart application on
Patch Edition
Cutover
bull Compile invalid Objects
bull Wait for a good downtime window
Finalize
bull Apply one or more patches to the Patch Edition
Apply
bull Copy the production application code
bull Create a new Patch Edition in the database
Prepare
Users Online Users OnlineUsers Offline
bull Online Patching is used to apply all EBS patches in EBS 122bull Online Patching cycle includes 5 major phasesbull New patching tool ldquoadoprdquo orchestrates the patching cycle
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Run file system
ndash Used by online users
ndash Stores a complete copy of all Applications and Middle Tier code
ndash Logically mapped to either fs1 or fs2
bull Patch file system
ndash Used by patching tools
ndash Stores a complete copy of all Applications and Middle Tier code
ndash Logically mapped to either fs1 or fs2
bull Non-Editioned file system
ndash Used for data fileseg data importexport files log files report output files
ndash Only stores data files
Online Patching uses a Dual File System
fs1 and fs2 switch Run and Patch designation during the cutover phase of an Online Patching cycle
fs1
Run
Cutoverfs1fs2
PatchPatch
fs2
Run
10
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition
11
Synchronization Managed by Patching Tools
Edition-Based Redefinition
Non-Editioned File System
Run File System
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Patch File System
PATCH_TOP
APPL_TOP_NE
LOGS
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
MOS Note 15839021
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview
Install base
fs_nefs2 EBSappsenvfs1
New file to set the environmentEBSappsenv RUN|PATCH
EBSapps instFMW_HOME EBSapps instFMW_HOME
12
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
$IAS_ORACLE_HOME
$FMW_HOME
EBS WLS Domain
ConfigurationFiles
WLSBinaries
WLSBinaries
Java Required Files for EBS
$EBS_ORACLE_HOME
Oracle HTTP Server
13
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
14
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 comnappl
Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology
EBSapps
15
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 Oracle Home
bull All major services are started out of the Fusion Middleware ORACLE_HOME
ndash formsappear is deployed out of the 1012 ORACLE_HOME
ndash frmweb executable is also invoked out of 1012 ORACLE_HOME
Used for Oracle forms technology
16
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
File System 1
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
File System 2
17
Synchronization Managed by Patching Tools
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
18
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
19
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS
Description Context File VariableUnique Across
Dual File SystemsExample
File System 1Example
File System 2
Port Pool s_port_pool No 0 10
Web Listener Port s_webport No 8000 8000
Web SSL Port s_webssl_port No 4443 4443
Active Web Port s_active_webport No 80004443 80004443
OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009
Node Manager Port s_nmport Yes 5556 5566
WLS Admin Server Port s_wls_adminport Yes 7001 7011
WLS oacore Application port s_wls_oacoreport Yes 7201 7211
WLS Forms Application Port s_wls_formsport Yes 7401 7411
WLS oafm Application Port s_wls_oafmport Yes 7601 7611
20
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
5
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureClient
JDB
CSQ
L Ne
t
HTTP
S
Application Database
RAC amp ASM
Global Single Data Model
Edition-Based Redefinition
WebLogic JSP
Forms
BI Publisher
BC4J
Web
Lis
ten
er
UIX 11g
WebLogic Server
6
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull In a nutshell E-Business Suite 122 feels like
ndash A handful of web applicationshellip
ndash Deployed to Clusters of Managed Servershellip
ndash Supervised by an Admin Serverhellip
ndash Deployed to a WebLogic Server Domain
7
Oracle E-Business Suite 122 ArchitectureWhat is E-Business Suite from a WebLogic Perspective
WLS DomainAdmin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureOracle WebLogic Server Domain
bull oacore Core functionality in EBS middle tier Java code including OAF based functionality for EBS products
bull forms Serves all Oracle forms functionality
bull oafm Web services Secure Search and Oracle Transport Agent (OXTA)
oacore_server
forms_server
oafm_server
forms-c4ws_serverNote As of AD-TXK Delta 6 forms-c4ws is disabled
8
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Online Patching Cycle - Overview
Understanding the Online Patching Cycle
bull The Basics
bull Remove obsolete objects
Cleanup
bull Restart application on
Patch Edition
Cutover
bull Compile invalid Objects
bull Wait for a good downtime window
Finalize
bull Apply one or more patches to the Patch Edition
Apply
bull Copy the production application code
bull Create a new Patch Edition in the database
Prepare
Users Online Users OnlineUsers Offline
bull Online Patching is used to apply all EBS patches in EBS 122bull Online Patching cycle includes 5 major phasesbull New patching tool ldquoadoprdquo orchestrates the patching cycle
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Run file system
ndash Used by online users
ndash Stores a complete copy of all Applications and Middle Tier code
ndash Logically mapped to either fs1 or fs2
bull Patch file system
ndash Used by patching tools
ndash Stores a complete copy of all Applications and Middle Tier code
ndash Logically mapped to either fs1 or fs2
bull Non-Editioned file system
ndash Used for data fileseg data importexport files log files report output files
ndash Only stores data files
Online Patching uses a Dual File System
fs1 and fs2 switch Run and Patch designation during the cutover phase of an Online Patching cycle
fs1
Run
Cutoverfs1fs2
PatchPatch
fs2
Run
10
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition
11
Synchronization Managed by Patching Tools
Edition-Based Redefinition
Non-Editioned File System
Run File System
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Patch File System
PATCH_TOP
APPL_TOP_NE
LOGS
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
MOS Note 15839021
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview
Install base
fs_nefs2 EBSappsenvfs1
New file to set the environmentEBSappsenv RUN|PATCH
EBSapps instFMW_HOME EBSapps instFMW_HOME
12
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
$IAS_ORACLE_HOME
$FMW_HOME
EBS WLS Domain
ConfigurationFiles
WLSBinaries
WLSBinaries
Java Required Files for EBS
$EBS_ORACLE_HOME
Oracle HTTP Server
13
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
14
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 comnappl
Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology
EBSapps
15
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 Oracle Home
bull All major services are started out of the Fusion Middleware ORACLE_HOME
ndash formsappear is deployed out of the 1012 ORACLE_HOME
ndash frmweb executable is also invoked out of 1012 ORACLE_HOME
Used for Oracle forms technology
16
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
File System 1
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
File System 2
17
Synchronization Managed by Patching Tools
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
18
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
19
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS
Description Context File VariableUnique Across
Dual File SystemsExample
File System 1Example
File System 2
Port Pool s_port_pool No 0 10
Web Listener Port s_webport No 8000 8000
Web SSL Port s_webssl_port No 4443 4443
Active Web Port s_active_webport No 80004443 80004443
OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009
Node Manager Port s_nmport Yes 5556 5566
WLS Admin Server Port s_wls_adminport Yes 7001 7011
WLS oacore Application port s_wls_oacoreport Yes 7201 7211
WLS Forms Application Port s_wls_formsport Yes 7401 7411
WLS oafm Application Port s_wls_oafmport Yes 7601 7611
20
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureClient
JDB
CSQ
L Ne
t
HTTP
S
Application Database
RAC amp ASM
Global Single Data Model
Edition-Based Redefinition
WebLogic JSP
Forms
BI Publisher
BC4J
Web
Lis
ten
er
UIX 11g
WebLogic Server
6
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull In a nutshell E-Business Suite 122 feels like
ndash A handful of web applicationshellip
ndash Deployed to Clusters of Managed Servershellip
ndash Supervised by an Admin Serverhellip
ndash Deployed to a WebLogic Server Domain
7
Oracle E-Business Suite 122 ArchitectureWhat is E-Business Suite from a WebLogic Perspective
WLS DomainAdmin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureOracle WebLogic Server Domain
bull oacore Core functionality in EBS middle tier Java code including OAF based functionality for EBS products
bull forms Serves all Oracle forms functionality
bull oafm Web services Secure Search and Oracle Transport Agent (OXTA)
oacore_server
forms_server
oafm_server
forms-c4ws_serverNote As of AD-TXK Delta 6 forms-c4ws is disabled
8
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Online Patching Cycle - Overview
Understanding the Online Patching Cycle
bull The Basics
bull Remove obsolete objects
Cleanup
bull Restart application on
Patch Edition
Cutover
bull Compile invalid Objects
bull Wait for a good downtime window
Finalize
bull Apply one or more patches to the Patch Edition
Apply
bull Copy the production application code
bull Create a new Patch Edition in the database
Prepare
Users Online Users OnlineUsers Offline
bull Online Patching is used to apply all EBS patches in EBS 122bull Online Patching cycle includes 5 major phasesbull New patching tool ldquoadoprdquo orchestrates the patching cycle
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Run file system
ndash Used by online users
ndash Stores a complete copy of all Applications and Middle Tier code
ndash Logically mapped to either fs1 or fs2
bull Patch file system
ndash Used by patching tools
ndash Stores a complete copy of all Applications and Middle Tier code
ndash Logically mapped to either fs1 or fs2
bull Non-Editioned file system
ndash Used for data fileseg data importexport files log files report output files
ndash Only stores data files
Online Patching uses a Dual File System
fs1 and fs2 switch Run and Patch designation during the cutover phase of an Online Patching cycle
fs1
Run
Cutoverfs1fs2
PatchPatch
fs2
Run
10
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition
11
Synchronization Managed by Patching Tools
Edition-Based Redefinition
Non-Editioned File System
Run File System
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Patch File System
PATCH_TOP
APPL_TOP_NE
LOGS
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
MOS Note 15839021
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview
Install base
fs_nefs2 EBSappsenvfs1
New file to set the environmentEBSappsenv RUN|PATCH
EBSapps instFMW_HOME EBSapps instFMW_HOME
12
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
$IAS_ORACLE_HOME
$FMW_HOME
EBS WLS Domain
ConfigurationFiles
WLSBinaries
WLSBinaries
Java Required Files for EBS
$EBS_ORACLE_HOME
Oracle HTTP Server
13
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
14
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 comnappl
Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology
EBSapps
15
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 Oracle Home
bull All major services are started out of the Fusion Middleware ORACLE_HOME
ndash formsappear is deployed out of the 1012 ORACLE_HOME
ndash frmweb executable is also invoked out of 1012 ORACLE_HOME
Used for Oracle forms technology
16
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
File System 1
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
File System 2
17
Synchronization Managed by Patching Tools
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
18
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
19
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS
Description Context File VariableUnique Across
Dual File SystemsExample
File System 1Example
File System 2
Port Pool s_port_pool No 0 10
Web Listener Port s_webport No 8000 8000
Web SSL Port s_webssl_port No 4443 4443
Active Web Port s_active_webport No 80004443 80004443
OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009
Node Manager Port s_nmport Yes 5556 5566
WLS Admin Server Port s_wls_adminport Yes 7001 7011
WLS oacore Application port s_wls_oacoreport Yes 7201 7211
WLS Forms Application Port s_wls_formsport Yes 7401 7411
WLS oafm Application Port s_wls_oafmport Yes 7601 7611
20
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull In a nutshell E-Business Suite 122 feels like
ndash A handful of web applicationshellip
ndash Deployed to Clusters of Managed Servershellip
ndash Supervised by an Admin Serverhellip
ndash Deployed to a WebLogic Server Domain
7
Oracle E-Business Suite 122 ArchitectureWhat is E-Business Suite from a WebLogic Perspective
WLS DomainAdmin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureOracle WebLogic Server Domain
bull oacore Core functionality in EBS middle tier Java code including OAF based functionality for EBS products
bull forms Serves all Oracle forms functionality
bull oafm Web services Secure Search and Oracle Transport Agent (OXTA)
oacore_server
forms_server
oafm_server
forms-c4ws_serverNote As of AD-TXK Delta 6 forms-c4ws is disabled
8
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Online Patching Cycle - Overview
Understanding the Online Patching Cycle
bull The Basics
bull Remove obsolete objects
Cleanup
bull Restart application on
Patch Edition
Cutover
bull Compile invalid Objects
bull Wait for a good downtime window
Finalize
bull Apply one or more patches to the Patch Edition
Apply
bull Copy the production application code
bull Create a new Patch Edition in the database
Prepare
Users Online Users OnlineUsers Offline
bull Online Patching is used to apply all EBS patches in EBS 122bull Online Patching cycle includes 5 major phasesbull New patching tool ldquoadoprdquo orchestrates the patching cycle
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Run file system
ndash Used by online users
ndash Stores a complete copy of all Applications and Middle Tier code
ndash Logically mapped to either fs1 or fs2
bull Patch file system
ndash Used by patching tools
ndash Stores a complete copy of all Applications and Middle Tier code
ndash Logically mapped to either fs1 or fs2
bull Non-Editioned file system
ndash Used for data fileseg data importexport files log files report output files
ndash Only stores data files
Online Patching uses a Dual File System
fs1 and fs2 switch Run and Patch designation during the cutover phase of an Online Patching cycle
fs1
Run
Cutoverfs1fs2
PatchPatch
fs2
Run
10
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition
11
Synchronization Managed by Patching Tools
Edition-Based Redefinition
Non-Editioned File System
Run File System
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Patch File System
PATCH_TOP
APPL_TOP_NE
LOGS
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
MOS Note 15839021
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview
Install base
fs_nefs2 EBSappsenvfs1
New file to set the environmentEBSappsenv RUN|PATCH
EBSapps instFMW_HOME EBSapps instFMW_HOME
12
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
$IAS_ORACLE_HOME
$FMW_HOME
EBS WLS Domain
ConfigurationFiles
WLSBinaries
WLSBinaries
Java Required Files for EBS
$EBS_ORACLE_HOME
Oracle HTTP Server
13
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
14
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 comnappl
Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology
EBSapps
15
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 Oracle Home
bull All major services are started out of the Fusion Middleware ORACLE_HOME
ndash formsappear is deployed out of the 1012 ORACLE_HOME
ndash frmweb executable is also invoked out of 1012 ORACLE_HOME
Used for Oracle forms technology
16
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
File System 1
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
File System 2
17
Synchronization Managed by Patching Tools
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
18
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
19
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS
Description Context File VariableUnique Across
Dual File SystemsExample
File System 1Example
File System 2
Port Pool s_port_pool No 0 10
Web Listener Port s_webport No 8000 8000
Web SSL Port s_webssl_port No 4443 4443
Active Web Port s_active_webport No 80004443 80004443
OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009
Node Manager Port s_nmport Yes 5556 5566
WLS Admin Server Port s_wls_adminport Yes 7001 7011
WLS oacore Application port s_wls_oacoreport Yes 7201 7211
WLS Forms Application Port s_wls_formsport Yes 7401 7411
WLS oafm Application Port s_wls_oafmport Yes 7601 7611
20
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureOracle WebLogic Server Domain
bull oacore Core functionality in EBS middle tier Java code including OAF based functionality for EBS products
bull forms Serves all Oracle forms functionality
bull oafm Web services Secure Search and Oracle Transport Agent (OXTA)
oacore_server
forms_server
oafm_server
forms-c4ws_serverNote As of AD-TXK Delta 6 forms-c4ws is disabled
8
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Online Patching Cycle - Overview
Understanding the Online Patching Cycle
bull The Basics
bull Remove obsolete objects
Cleanup
bull Restart application on
Patch Edition
Cutover
bull Compile invalid Objects
bull Wait for a good downtime window
Finalize
bull Apply one or more patches to the Patch Edition
Apply
bull Copy the production application code
bull Create a new Patch Edition in the database
Prepare
Users Online Users OnlineUsers Offline
bull Online Patching is used to apply all EBS patches in EBS 122bull Online Patching cycle includes 5 major phasesbull New patching tool ldquoadoprdquo orchestrates the patching cycle
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Run file system
ndash Used by online users
ndash Stores a complete copy of all Applications and Middle Tier code
ndash Logically mapped to either fs1 or fs2
bull Patch file system
ndash Used by patching tools
ndash Stores a complete copy of all Applications and Middle Tier code
ndash Logically mapped to either fs1 or fs2
bull Non-Editioned file system
ndash Used for data fileseg data importexport files log files report output files
ndash Only stores data files
Online Patching uses a Dual File System
fs1 and fs2 switch Run and Patch designation during the cutover phase of an Online Patching cycle
fs1
Run
Cutoverfs1fs2
PatchPatch
fs2
Run
10
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition
11
Synchronization Managed by Patching Tools
Edition-Based Redefinition
Non-Editioned File System
Run File System
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Patch File System
PATCH_TOP
APPL_TOP_NE
LOGS
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
MOS Note 15839021
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview
Install base
fs_nefs2 EBSappsenvfs1
New file to set the environmentEBSappsenv RUN|PATCH
EBSapps instFMW_HOME EBSapps instFMW_HOME
12
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
$IAS_ORACLE_HOME
$FMW_HOME
EBS WLS Domain
ConfigurationFiles
WLSBinaries
WLSBinaries
Java Required Files for EBS
$EBS_ORACLE_HOME
Oracle HTTP Server
13
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
14
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 comnappl
Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology
EBSapps
15
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 Oracle Home
bull All major services are started out of the Fusion Middleware ORACLE_HOME
ndash formsappear is deployed out of the 1012 ORACLE_HOME
ndash frmweb executable is also invoked out of 1012 ORACLE_HOME
Used for Oracle forms technology
16
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
File System 1
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
File System 2
17
Synchronization Managed by Patching Tools
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
18
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
19
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS
Description Context File VariableUnique Across
Dual File SystemsExample
File System 1Example
File System 2
Port Pool s_port_pool No 0 10
Web Listener Port s_webport No 8000 8000
Web SSL Port s_webssl_port No 4443 4443
Active Web Port s_active_webport No 80004443 80004443
OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009
Node Manager Port s_nmport Yes 5556 5566
WLS Admin Server Port s_wls_adminport Yes 7001 7011
WLS oacore Application port s_wls_oacoreport Yes 7201 7211
WLS Forms Application Port s_wls_formsport Yes 7401 7411
WLS oafm Application Port s_wls_oafmport Yes 7601 7611
20
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Online Patching Cycle - Overview
Understanding the Online Patching Cycle
bull The Basics
bull Remove obsolete objects
Cleanup
bull Restart application on
Patch Edition
Cutover
bull Compile invalid Objects
bull Wait for a good downtime window
Finalize
bull Apply one or more patches to the Patch Edition
Apply
bull Copy the production application code
bull Create a new Patch Edition in the database
Prepare
Users Online Users OnlineUsers Offline
bull Online Patching is used to apply all EBS patches in EBS 122bull Online Patching cycle includes 5 major phasesbull New patching tool ldquoadoprdquo orchestrates the patching cycle
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Run file system
ndash Used by online users
ndash Stores a complete copy of all Applications and Middle Tier code
ndash Logically mapped to either fs1 or fs2
bull Patch file system
ndash Used by patching tools
ndash Stores a complete copy of all Applications and Middle Tier code
ndash Logically mapped to either fs1 or fs2
bull Non-Editioned file system
ndash Used for data fileseg data importexport files log files report output files
ndash Only stores data files
Online Patching uses a Dual File System
fs1 and fs2 switch Run and Patch designation during the cutover phase of an Online Patching cycle
fs1
Run
Cutoverfs1fs2
PatchPatch
fs2
Run
10
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition
11
Synchronization Managed by Patching Tools
Edition-Based Redefinition
Non-Editioned File System
Run File System
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Patch File System
PATCH_TOP
APPL_TOP_NE
LOGS
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
MOS Note 15839021
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview
Install base
fs_nefs2 EBSappsenvfs1
New file to set the environmentEBSappsenv RUN|PATCH
EBSapps instFMW_HOME EBSapps instFMW_HOME
12
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
$IAS_ORACLE_HOME
$FMW_HOME
EBS WLS Domain
ConfigurationFiles
WLSBinaries
WLSBinaries
Java Required Files for EBS
$EBS_ORACLE_HOME
Oracle HTTP Server
13
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
14
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 comnappl
Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology
EBSapps
15
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 Oracle Home
bull All major services are started out of the Fusion Middleware ORACLE_HOME
ndash formsappear is deployed out of the 1012 ORACLE_HOME
ndash frmweb executable is also invoked out of 1012 ORACLE_HOME
Used for Oracle forms technology
16
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
File System 1
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
File System 2
17
Synchronization Managed by Patching Tools
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
18
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
19
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS
Description Context File VariableUnique Across
Dual File SystemsExample
File System 1Example
File System 2
Port Pool s_port_pool No 0 10
Web Listener Port s_webport No 8000 8000
Web SSL Port s_webssl_port No 4443 4443
Active Web Port s_active_webport No 80004443 80004443
OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009
Node Manager Port s_nmport Yes 5556 5566
WLS Admin Server Port s_wls_adminport Yes 7001 7011
WLS oacore Application port s_wls_oacoreport Yes 7201 7211
WLS Forms Application Port s_wls_formsport Yes 7401 7411
WLS oafm Application Port s_wls_oafmport Yes 7601 7611
20
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Run file system
ndash Used by online users
ndash Stores a complete copy of all Applications and Middle Tier code
ndash Logically mapped to either fs1 or fs2
bull Patch file system
ndash Used by patching tools
ndash Stores a complete copy of all Applications and Middle Tier code
ndash Logically mapped to either fs1 or fs2
bull Non-Editioned file system
ndash Used for data fileseg data importexport files log files report output files
ndash Only stores data files
Online Patching uses a Dual File System
fs1 and fs2 switch Run and Patch designation during the cutover phase of an Online Patching cycle
fs1
Run
Cutoverfs1fs2
PatchPatch
fs2
Run
10
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition
11
Synchronization Managed by Patching Tools
Edition-Based Redefinition
Non-Editioned File System
Run File System
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Patch File System
PATCH_TOP
APPL_TOP_NE
LOGS
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
MOS Note 15839021
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview
Install base
fs_nefs2 EBSappsenvfs1
New file to set the environmentEBSappsenv RUN|PATCH
EBSapps instFMW_HOME EBSapps instFMW_HOME
12
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
$IAS_ORACLE_HOME
$FMW_HOME
EBS WLS Domain
ConfigurationFiles
WLSBinaries
WLSBinaries
Java Required Files for EBS
$EBS_ORACLE_HOME
Oracle HTTP Server
13
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
14
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 comnappl
Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology
EBSapps
15
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 Oracle Home
bull All major services are started out of the Fusion Middleware ORACLE_HOME
ndash formsappear is deployed out of the 1012 ORACLE_HOME
ndash frmweb executable is also invoked out of 1012 ORACLE_HOME
Used for Oracle forms technology
16
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
File System 1
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
File System 2
17
Synchronization Managed by Patching Tools
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
18
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
19
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS
Description Context File VariableUnique Across
Dual File SystemsExample
File System 1Example
File System 2
Port Pool s_port_pool No 0 10
Web Listener Port s_webport No 8000 8000
Web SSL Port s_webssl_port No 4443 4443
Active Web Port s_active_webport No 80004443 80004443
OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009
Node Manager Port s_nmport Yes 5556 5566
WLS Admin Server Port s_wls_adminport Yes 7001 7011
WLS oacore Application port s_wls_oacoreport Yes 7201 7211
WLS Forms Application Port s_wls_formsport Yes 7401 7411
WLS oafm Application Port s_wls_oafmport Yes 7601 7611
20
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition
11
Synchronization Managed by Patching Tools
Edition-Based Redefinition
Non-Editioned File System
Run File System
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Patch File System
PATCH_TOP
APPL_TOP_NE
LOGS
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
MOS Note 15839021
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview
Install base
fs_nefs2 EBSappsenvfs1
New file to set the environmentEBSappsenv RUN|PATCH
EBSapps instFMW_HOME EBSapps instFMW_HOME
12
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
$IAS_ORACLE_HOME
$FMW_HOME
EBS WLS Domain
ConfigurationFiles
WLSBinaries
WLSBinaries
Java Required Files for EBS
$EBS_ORACLE_HOME
Oracle HTTP Server
13
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
14
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 comnappl
Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology
EBSapps
15
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 Oracle Home
bull All major services are started out of the Fusion Middleware ORACLE_HOME
ndash formsappear is deployed out of the 1012 ORACLE_HOME
ndash frmweb executable is also invoked out of 1012 ORACLE_HOME
Used for Oracle forms technology
16
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
File System 1
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
File System 2
17
Synchronization Managed by Patching Tools
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
18
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
19
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS
Description Context File VariableUnique Across
Dual File SystemsExample
File System 1Example
File System 2
Port Pool s_port_pool No 0 10
Web Listener Port s_webport No 8000 8000
Web SSL Port s_webssl_port No 4443 4443
Active Web Port s_active_webport No 80004443 80004443
OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009
Node Manager Port s_nmport Yes 5556 5566
WLS Admin Server Port s_wls_adminport Yes 7001 7011
WLS oacore Application port s_wls_oacoreport Yes 7201 7211
WLS Forms Application Port s_wls_formsport Yes 7401 7411
WLS oafm Application Port s_wls_oafmport Yes 7601 7611
20
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview
Install base
fs_nefs2 EBSappsenvfs1
New file to set the environmentEBSappsenv RUN|PATCH
EBSapps instFMW_HOME EBSapps instFMW_HOME
12
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
$IAS_ORACLE_HOME
$FMW_HOME
EBS WLS Domain
ConfigurationFiles
WLSBinaries
WLSBinaries
Java Required Files for EBS
$EBS_ORACLE_HOME
Oracle HTTP Server
13
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
14
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 comnappl
Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology
EBSapps
15
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 Oracle Home
bull All major services are started out of the Fusion Middleware ORACLE_HOME
ndash formsappear is deployed out of the 1012 ORACLE_HOME
ndash frmweb executable is also invoked out of 1012 ORACLE_HOME
Used for Oracle forms technology
16
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
File System 1
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
File System 2
17
Synchronization Managed by Patching Tools
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
18
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
19
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS
Description Context File VariableUnique Across
Dual File SystemsExample
File System 1Example
File System 2
Port Pool s_port_pool No 0 10
Web Listener Port s_webport No 8000 8000
Web SSL Port s_webssl_port No 4443 4443
Active Web Port s_active_webport No 80004443 80004443
OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009
Node Manager Port s_nmport Yes 5556 5566
WLS Admin Server Port s_wls_adminport Yes 7001 7011
WLS oacore Application port s_wls_oacoreport Yes 7201 7211
WLS Forms Application Port s_wls_formsport Yes 7401 7411
WLS oafm Application Port s_wls_oafmport Yes 7601 7611
20
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
$IAS_ORACLE_HOME
$FMW_HOME
EBS WLS Domain
ConfigurationFiles
WLSBinaries
WLSBinaries
Java Required Files for EBS
$EBS_ORACLE_HOME
Oracle HTTP Server
13
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
14
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 comnappl
Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology
EBSapps
15
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 Oracle Home
bull All major services are started out of the Fusion Middleware ORACLE_HOME
ndash formsappear is deployed out of the 1012 ORACLE_HOME
ndash frmweb executable is also invoked out of 1012 ORACLE_HOME
Used for Oracle forms technology
16
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
File System 1
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
File System 2
17
Synchronization Managed by Patching Tools
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
18
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
19
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS
Description Context File VariableUnique Across
Dual File SystemsExample
File System 1Example
File System 2
Port Pool s_port_pool No 0 10
Web Listener Port s_webport No 8000 8000
Web SSL Port s_webssl_port No 4443 4443
Active Web Port s_active_webport No 80004443 80004443
OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009
Node Manager Port s_nmport Yes 5556 5566
WLS Admin Server Port s_wls_adminport Yes 7001 7011
WLS oacore Application port s_wls_oacoreport Yes 7201 7211
WLS Forms Application Port s_wls_formsport Yes 7401 7411
WLS oafm Application Port s_wls_oafmport Yes 7601 7611
20
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
14
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 comnappl
Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology
EBSapps
15
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 Oracle Home
bull All major services are started out of the Fusion Middleware ORACLE_HOME
ndash formsappear is deployed out of the 1012 ORACLE_HOME
ndash frmweb executable is also invoked out of 1012 ORACLE_HOME
Used for Oracle forms technology
16
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
File System 1
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
File System 2
17
Synchronization Managed by Patching Tools
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
18
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
19
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS
Description Context File VariableUnique Across
Dual File SystemsExample
File System 1Example
File System 2
Port Pool s_port_pool No 0 10
Web Listener Port s_webport No 8000 8000
Web SSL Port s_webssl_port No 4443 4443
Active Web Port s_active_webport No 80004443 80004443
OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009
Node Manager Port s_nmport Yes 5556 5566
WLS Admin Server Port s_wls_adminport Yes 7001 7011
WLS oacore Application port s_wls_oacoreport Yes 7201 7211
WLS Forms Application Port s_wls_formsport Yes 7401 7411
WLS oafm Application Port s_wls_oafmport Yes 7601 7611
20
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 comnappl
Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology
EBSapps
15
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 Oracle Home
bull All major services are started out of the Fusion Middleware ORACLE_HOME
ndash formsappear is deployed out of the 1012 ORACLE_HOME
ndash frmweb executable is also invoked out of 1012 ORACLE_HOME
Used for Oracle forms technology
16
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
File System 1
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
File System 2
17
Synchronization Managed by Patching Tools
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
18
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
19
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS
Description Context File VariableUnique Across
Dual File SystemsExample
File System 1Example
File System 2
Port Pool s_port_pool No 0 10
Web Listener Port s_webport No 8000 8000
Web SSL Port s_webssl_port No 4443 4443
Active Web Port s_active_webport No 80004443 80004443
OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009
Node Manager Port s_nmport Yes 5556 5566
WLS Admin Server Port s_wls_adminport Yes 7001 7011
WLS oacore Application port s_wls_oacoreport Yes 7201 7211
WLS Forms Application Port s_wls_formsport Yes 7401 7411
WLS oafm Application Port s_wls_oafmport Yes 7601 7611
20
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
1012 Oracle Home
bull All major services are started out of the Fusion Middleware ORACLE_HOME
ndash formsappear is deployed out of the 1012 ORACLE_HOME
ndash frmweb executable is also invoked out of 1012 ORACLE_HOME
Used for Oracle forms technology
16
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
File System 1
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
File System 2
17
Synchronization Managed by Patching Tools
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
18
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
19
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS
Description Context File VariableUnique Across
Dual File SystemsExample
File System 1Example
File System 2
Port Pool s_port_pool No 0 10
Web Listener Port s_webport No 8000 8000
Web SSL Port s_webssl_port No 4443 4443
Active Web Port s_active_webport No 80004443 80004443
OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009
Node Manager Port s_nmport Yes 5556 5566
WLS Admin Server Port s_wls_adminport Yes 7001 7011
WLS oacore Application port s_wls_oacoreport Yes 7201 7211
WLS Forms Application Port s_wls_formsport Yes 7401 7411
WLS oafm Application Port s_wls_oafmport Yes 7601 7611
20
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
File System 1
EBS WLS Domain Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server
WebLogic Server
File System 2
17
Synchronization Managed by Patching Tools
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
18
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
19
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS
Description Context File VariableUnique Across
Dual File SystemsExample
File System 1Example
File System 2
Port Pool s_port_pool No 0 10
Web Listener Port s_webport No 8000 8000
Web SSL Port s_webssl_port No 4443 4443
Active Web Port s_active_webport No 80004443 80004443
OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009
Node Manager Port s_nmport Yes 5556 5566
WLS Admin Server Port s_wls_adminport Yes 7001 7011
WLS oacore Application port s_wls_oacoreport Yes 7201 7211
WLS Forms Application Port s_wls_formsport Yes 7401 7411
WLS oafm Application Port s_wls_oafmport Yes 7601 7611
20
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
18
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
19
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS
Description Context File VariableUnique Across
Dual File SystemsExample
File System 1Example
File System 2
Port Pool s_port_pool No 0 10
Web Listener Port s_webport No 8000 8000
Web SSL Port s_webssl_port No 4443 4443
Active Web Port s_active_webport No 80004443 80004443
OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009
Node Manager Port s_nmport Yes 5556 5566
WLS Admin Server Port s_wls_adminport Yes 7001 7011
WLS oacore Application port s_wls_oacoreport Yes 7201 7211
WLS Forms Application Port s_wls_formsport Yes 7401 7411
WLS oafm Application Port s_wls_oafmport Yes 7601 7611
20
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull One Port Pool for each file system (fs1 fs2)
bull All ports must be free on the node
bull Recommend assigning Port Pools for one environment a minimum 10 pools apart
For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2
bull Port Pools must be unique for each EBS environment on a same server
For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3
bull Most ports are unique to each file system
19
Oracle E-Business Suite 122 Architecture Dual File System
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS
Description Context File VariableUnique Across
Dual File SystemsExample
File System 1Example
File System 2
Port Pool s_port_pool No 0 10
Web Listener Port s_webport No 8000 8000
Web SSL Port s_webssl_port No 4443 4443
Active Web Port s_active_webport No 80004443 80004443
OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009
Node Manager Port s_nmport Yes 5556 5566
WLS Admin Server Port s_wls_adminport Yes 7001 7011
WLS oacore Application port s_wls_oacoreport Yes 7201 7211
WLS Forms Application Port s_wls_formsport Yes 7401 7411
WLS oafm Application Port s_wls_oafmport Yes 7601 7611
20
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS
Description Context File VariableUnique Across
Dual File SystemsExample
File System 1Example
File System 2
Port Pool s_port_pool No 0 10
Web Listener Port s_webport No 8000 8000
Web SSL Port s_webssl_port No 4443 4443
Active Web Port s_active_webport No 80004443 80004443
OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009
Node Manager Port s_nmport Yes 5556 5566
WLS Admin Server Port s_wls_adminport Yes 7001 7011
WLS oacore Application port s_wls_oacoreport Yes 7201 7211
WLS Forms Application Port s_wls_formsport Yes 7401 7411
WLS oafm Application Port s_wls_oafmport Yes 7601 7611
20
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
RUN PATCH
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
21
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate
Oracle HTTP Server
WebLogic Server
File System 1
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
RUN PATCH
E Business Suite
Web Logic Admin Console
22
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
7201
7401
7601
8000
Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point
Oracle HTTP Server
WebLogic Server
File System 1
PATCH RUN
7001
oacore_server1
forms_server1
oafm_server1
Admin Server
7211
7411
7611
8000 Oracle HTTP Server
WebLogic Server
File System 2
7011
oacore_server1
forms_server1
oafm_server1
Admin Server
E Business Suite
Web Logic Admin Console
23
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WLS Domain
Why add managed servers
bull Meet load and user concurrency requirements~100-150 concurrent users per JVM
oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs
N = total number of concurrent Self-Service users
Use one JVM per 1-2 CPUs (dependent on the CPU speed)
bull Provide redundancy
bull Add services to an existing node
Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
24
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server
What to Know
bull Syntax for adProvisionEBSpl
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=ltMANAGED_SERVER_NAMEgt
-servicetype=ltSERVICE_TYPEgt
-managedsrvport=ltMANAGED_SERVER_PORTgt
-logfile=ltLOGFILEgt
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
25
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers
bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms
bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl
bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle
bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt
bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node
bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server
What to Know
bull Example add lsquooacore_server2rsquo of type oacore with port 7203
perl
$AD_TOPpatch115binadProvisionEBSpl
ebs-create-managedserver
-contextfile=ltCONTEXT_FILEgt
-managedsrvname=oacore_server2
-servicetype=oacore
-managedsrvport=7203
-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log
What to Do
Section 441 Adding a New Managed Server MOS Doc ID 19055931
26
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers
Node 1
WLS DomainAdmin Server
Node 2
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server2
forms_server2
oafm_server2
27
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared
FilesystemConfiguration
Distributed
Shared
Section 53 Adding a New Application Tier Node to an Existing System
MOS Doc ID 13836211
Overview of Stepsbull Configure shared filesystem for
sharingbull Mount filesystem on new nodebull Perform configuration steps to
add the new node
Section 4 Adding a Node to the Shared Application Tier File System
MOS Doc ID 13757691
Overview of Stepsbull Prepare the PATCH and RUN
filesystemsbull Copy the RUN filesystems to the
new nodebull Configure the PATCH and RUN
filesystemsbull Register the new topologybull Finalize service configuration
Start Here
28
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin
$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt
bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands
bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0
patch_s_port_pool=10
Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated
Pairs File Configuration for Distributed and Shared File Systems
29
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Instance Specific]
Please provide values for the context variables listed below On the source
instance they are instantiated as shown in the comment section below
These values should only be used as reference to fill out the instance
values for the new node
s_temp=[temp_directory]
s_contextname=[context_name_for_new_node]
s_hostname=[new_node_name]
s_domainname=usexampledomaincom
s_cphost=[new_node_name]
s_webhost=[new_node_name]
s_config_home=[INST_TOP]
s_inst_base=[install_base]
s_display=[new_node_name]00
s_forms-c4ws_display=[new_node_name]00
s_ohs_instance=EBS_web_ltSIDgt_OHS[n]
s_webport=8000
s_http_listen_parameter=8000
s_https_listen_parameter=4443
Pairs File Configuration for Distributed and Shared File Systems ndash Instance
30
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Add Oracle E-Business Suite 122 Application Nodes
[Services]
Please provide values for the context variables listed below
Enter enabled without the quotes to enable the service on the new node
Enter disabled without the quotes to disable the service on the new node
The Root service include the Node Manager
The Web Application Services include the Node Manager Admin Server
Managed Servers ( oacore forms oafm formsc4-ws)
s_web_applications_status=enabled
s_web_entry_status=enabled
s_apcstatus=enabled
s_root_status=enabled
s_batch_status=enabled
s_other_service_group_status=disabled
s_adminserverstatus=disabled
s_web_admin_status=disabled`
Pairs File Configuration for Distributed and Shared File Systems - Services
31
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
Set s_shared_file_system=false
Set s_atName to the hostname of the node being added
Shared Application Tier File System
Set s_shared_file_system=true
Set s_atName to the primary node across all nodes
Set user id and group id the same across all nodes
Set absolute path of the shared file system mount point the same across all nodes
32
Add Oracle E-Business Suite 122 Application NodesPairs File Configuration
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Distributed File System
bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)
$perl adcfgclonepl
component=appsTier
pairsfile=ltPAIRSFILEgt addnode=yes
dualfs=yes
Shared Application Tier File System
bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)
$export PATH=
$IAS_ORACLE_HOMEperlbin$PATH
$perl adclonectxpl addnode
contextfile=$CONTEXT_FILE
pairsfile=install_basemypairsfiletxt
dualfs=yes
33
Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node
dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)
MOS Doc ID 16174611
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out
Node 1
Admin Server
oacore_server1oacore_cluster 1
forms_server1forms_cluster 1
oafm_server1oafm_cluster 1
oacore_server3
forms_server3
oafm_server3
Node 2
WLS Domain
oacore_server2
forms_server2
oafm_server2
oacore_server4
forms_server4
oafm_server4
34
Node Manager Node Manager
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Delete an Oracle E-Business Suite Application Tier Node
bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -
contextfile=$CONTEXT_FILE -logfile=dellog
bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node
$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node
-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt
-logfile=ltLOG_FILEgt
35
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
36
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalsh ndashmode=allnodes
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
RUN Filesystem
37
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Starting and Stopping Services
Service Group Service(s) Service Control Script
NAAll Application Tier Services
on All Nodesadstrtalshndashmode=allnodes forcepatchfs
NAAll Application Tier Services
on All Nodesadstpallsh ndashmode=allnodes forcepatchfs
Web Entry Point ServicesOracle HTTP Server
Oracle Process Manageradapcctlsh [start | stop] |
adopmnctlsh [start | stop | status]
Root Service Node Manager adnodemgrctlsh [start | stop ]
Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |
abort forcepatchfs|]
Web Application Servicesoacoreoafmforms
admanagedsrvctlsh [stop| start] ltmanaged_server_namegt
PATCH Filesystem
38
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the WebLogic Admin Password
bull Use the EBS defined process for changing the WLS Administration User password
bull Changing the WebLogic Admin password requires downtime
bull Change the password from the RUN file system when there is NO active Online Patching Cycle
bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password
What to Know
Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin
Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)
$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh
Step 3 On the Admin Server run the following
$perl FND_TOPpatch115bintxkUpdateEBSDomainpl
-action=updateAdminPassword
Step 4 Restart all services on all nodes with the following
$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password
39
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Changing the APPS Password
bull Use the EBS defined process for changing the APPSpassword
bull Changing the APPS password requires downtime
bull You can use either AFPASSWD (recommended) or FNDCPASS
bull The command used will change the APPS APPLSYS and APPS_NE
bull After you change the password you MUST update the WLS Data Source
bull The final step is to run AutoConfig and then restart the applications
What to Know
Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run
$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes
Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS
Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh
$ perl
$FND_TOPpatch115bintxkManageDBConnectionPoolpl
Note When prompted select updateDSPassword
Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh
Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes
What to Do
Oracle E-Business Suite Maintenance Guide
40
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code level Checker (ETCC)
Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment
Database Code Level Checker
Identifies database tier technology stack patches required by EBS 122
Application Tier Code Level Checker
Identifies application tier technology stack patches required by EBS 122
Application Tier
Forms 1012
OHS
Oracle Common
WebLogic
fs1 fs2
Application TOPs
Forms 1012
OHS
Oracle Common
WebLogic
Application TOPs
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
EBS Technology Code Level Checker (ETCC)
bull ETCC can be downloaded via Patch 17537119 from My Oracle Support
bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed
bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh
bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh
42
MOS Doc ID 15942741
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Webtier amp Utilities (OHS)FMW Common
Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2
FMW_Home
logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1
WLS
43
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetCommonenv
Patch Inventory Command
$ opatch lsinventory
Change Directory
$cd $FMW_HOMEutilsbsu
Patch Inventory Report
$ bsush -report
-bea_home=$FMW_HOME
-output_format=texWeb Tier amp Utilities (OHS)
Set Environment (ORACLE_HOME amp Path)
$ $FMW_HOMESetWebtierenv
Patch Inventory Command
$ opatch lsinventory
Set Environment (ORACLE_HOME amp Path)
$ source EBSappsenv PATCH
Patch Inventory Command
$ opatch lsinventory
EBS FMW 11g Environment amp Patch Inventory Commands
FMW Common WebLogic Server
Web Tier amp Utilities (OHS) Forms and Reports Server
44
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
45
Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Know
bull Prepare the PATCH file system
bull Apply technology stack patches to PATCH file system
bull Apply EBS patches (optional)
bull Coordinate time for CUTOVER and complete the online patching cycle
bull Synchronize the technology stack patches between the RUN and PATCH file systems
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
FS Clone
Finalize
46
Application Tier ndash Dual File System
Applying Application Tier Technology Stack Updates
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Online PatchingCycle
Apply
Cutover
Cleanup
PatchPrepare
Apply
Finalize
Cutover
Cleanup
Prepare$FMW_HOMESetCommonenv
$ opatch apply
fs1 fs2
Oracle E-Business Suite Release 122
FMW HomeOracle CommonWebtier (OHS)Web Logic Server
1012
Oracle Common $FMW_HOMESetCommonenv
$ opatch applyWebtier (OHS)
$ cd $FMW_HOMEutilsbsu
$ bsush
Web Logic Server
$EBSappsenv
$ opatch apply1012
Synchronize
$adop phase=fs_clone
Synchronize
Prepare
Apply
Finalize
Cutover
Cleanup
FS CloneFS Clone
Run
Oracle CommonWebtier (OHS)Web Logic Server
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
47
Oracle FMW Common for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching and set the ORACLE_HOME
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
48
Webtier amp Utilities (OHS) for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv
$ cd [patch_directory]
$ opatch apply
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches between the RUN and PATCH file systems
$ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
source ltEBS_ROOTgtEBSappsenv3 run
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Applying Application Tier Technology Stack Updates
49
WebLogic Server for Oracle E-Business Suite 122
bull Application tier technology stack updates can be
ndash Applied to the PATCH file system while EBS is online
ndash Applied in conjunction with an EBS Online Patching cycle
or
ndash Applied as a separate Online Patching exercise
bull You should follow the instructions in the Patch README
bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems
What to Knowbull Prepare the instance for patching
$ source EBSappsenv PATCH
$ adop phase=prepare
bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu
$ bsush
-prod_dir=$FMW_HOMEwlserver_103
-patchlist=ltpatchID1gt -verbose -install
bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile
bull Complete the Online Patching cycle$ adop phase=finalize
$ adop phase=cutover
$ source EBSappsenv RUN
$ adop phase=cleanup
bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone
What to Do
Confidential ndash Oracle Internal
MOS Doc ID 13550681
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
50
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes
Oracle Application Manager amp Autoconfig
Fusion Middleware Controlhttphostnamedomainadmin_portem
WLS Administration Consolehttphostnameadmin_portconsole
Oracle HTTP Server
Performance directives log configuration ports mod_perl mod_wl_ohs etc
WLS Admin Server
Initialization parameters All other parameters
WLS Managed Server
All parameters for oacore oafm and forms services
MOS Doc ID 19055931
51
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes
bull If a Patching Cycle is not open
ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching
bull If a Patching Cycle is open
ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after
Cutover otherwise changes done will be lost
bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover
Developer 1012
COMMON_TOP
APPL_TOP
INST_TOP
Oracle HTTP Server (OHS)
WebLogic Server (WLS)
Run File System
52
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Update limited set of configuration files with AutoConfig
bull Update all other seeded configurations using Fusion Middleware Control
httphostnamedomainadmin_portem
bull Edit the relevant file and parameters
bull Synchronize the changes with adSyncContextpl
bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)
53
Oracle HTTP Server Configuration
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments
bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server
bull To update edit the following context variablesndash s_adminserver_classpath
ndash s_nm_jvm_startup_properties
54
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments
bull Go to WebLogic server Administration Console
bull Select Configuration Server Start
bull Click Lock amp Edit
bull Edit parameters
bull Click Release Configuration
bull Next Online Patching cycle will update Patch file system
55
MOS Doc ID 19055931
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Architecture
Administration and Maintenance
Configure
Monitor and Troubleshoot
1
2
3
4
56
Program Agenda
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Log File Locations
bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt
bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs
ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs
Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]
Oracle E-Business Suite 122
57
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Access Log
bull Default log file name access_log
bull All requests processed by OHS
bull Location and content are controlled by CustomLog directive in httpconf
bull Example from access_log
1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search
HTTP10 200 1197
Oracle E-Business Suite 122
58
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Oracle HTTP Server Error Log
bull Default log file name EBS_web_ltSIDgtlog
bull Key log file for the Oracle HTTP Server (OHS)
bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here
bull ModSecurity will log whenever it denies a request
bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]
mod_security Access denied with code 400 Pattern match at THE_REQUEST
[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]
Oracle E-Business Suite 122
59
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
Service(s) Service Control Script
Oracle HTTP ServerOracle Process Manager
adapcctlsh status
adopmnctlsh status
Node Manager adnodemgrctlsh status
WebLogic Admin Server adadminsrvctlsh status
oacoreoafmforms
admanagedsrvctlsh status ltmanaged_server_namegt
Oracle E-Business Suite 122
60
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service Status
61
Execute Configuration Check Utility
bull Review the status of services on a node
bull HTML file is generated by the Check Config Utility
What to Know
bull For example
AD_TOPbinadchkcfgsh
bull Review the HTML output generated in the following
cfgcheckhtml
What to Do
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Check Service StatusExecute Configuration Check Utility
62
MOS Doc ID 3878591
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Monitor WLS Admin Server and Port
$ps ndashef | grep java
oracle 24386 24289 0 Feb28 000306
u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -
DweblogicName=AdminServer -Djavasecuritypolicy=
$ss ndashl ndashp ndashn | grep 24386
0 0 ffff10210441107001
users((java24386792))
Note WLS Admin Server Port is also located in the context variable s_wls_adminport
Command Line
63
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Use WebLogic Console to monitor JDBC connections
ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)
bull Turn on Diagnostics
ndash Level 1 ndash minimally invasive
ndash Level 2 - increased memory requirements and may affect performance
64
Data Source Connection Pool Diagnostics
MOS Doc ID 19409961
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Provides features designed to aid in detecting diagnosing and resolving problems
bull Enabled by default with EBS 122
bull Automatically captures set of diagnostics and creates an incident
bull Incidents can be packaged with ADR Command Interpreter (ADCRI)
65
Oracle Fusion Middleware Diagnostic Framework
MOS Doc ID 14280561
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS
66
Oracle Support WLS (WebLogic Server) Utility
MOS Doc ID 22302251
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Developed and maintained by Oracle Support
bull Documentation to aid troubleshooting connections issues for EBS 122
67
Oracle Support Summary of EBS Login
MOS Doc ID 19847101
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Same blog new URL
Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech
bull News about EBS Technology
bull Certification announcements
bull Quarterly upgrade recommendations
bull Primers FAQs tips
bull Statements of Direction
bull Desupport reminders
Subscribe via RSS or email
68
Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New
URL
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Questions
69Copyright copy 2016 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Chronological Order
70
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71
Related SessionsSunday April 7 2019
1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72
Related SessionsSunday April 7 2019
300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73
Related SessionsMonday April 8 2019
915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A
1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon A
1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74
Related SessionsMonday April 8 2019
315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75
Related SessionsTuesday April 9 2019
1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76
Related SessionsWednesday April 10 2019
800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77
Related SessionsWednesday April 10 2019
200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 3 -
Booth 900
430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78
Related SessionsThursday April 11 2019
800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
915 am
Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Related Sessions - Ordered by Theme
79
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80
Related SessionsStrategy and Roadmap
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81
Related SessionsCloud
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
SundayApril 7
145 pm
Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
SundayApril 7
300 pm
Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle
GH 4TH FL Texas Salon C
MondayApril 8
915 am
Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle
GH 4TH FL Texas Salon A amp C
MondayApril 8
1030 am
Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82
Related SessionsCloud
MondayApril 8
430 pm
What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10
1245 pm
Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
WednesdayApril 10330 pm
Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle
CC STREET FL Exhibit Hall 34
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83
Related SessionsCloud
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84
Related SessionsInstallation and Architecture
WednesdayApril 10915 am
Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85
Related SessionsIntegration
SundayApril 7
1230 pm
Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86
Related SessionsPatching and Customizations
TuesdayApril 9
200 pm
Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
TuesdayApril 9
430 pm
Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87
Related SessionsPerformance
SundayApril 7
145 pm
Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88
Related SessionsSystem Management
ThursdayApril 11800 am
11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89
Related SessionsTesting
SundayApril 7
1230 pm
Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90
Related SessionsUpgrade
WednesdayApril 10915 am
Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon A
ThursdayApril 11800 am
Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91
Related SessionsUsability and Mobility
WednesdayApril 10800 am
Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle
GH 4TH FL Texas Salon C
ThursdayApril 11800 am
Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92
Related SessionsHands-On-Lab
SundayApril 7
145 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
MondayApril 8
315 pm
HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle
CC 1ST FL 007D
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93
Related SessionsMeet the Experts
MondayApril 8
315 pm
MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle
GH 4TH FL Texas Salon B
TuesdayApril 9
1030 am
MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
WednesdayApril 10430 pm
MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon B
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94
Related SessionsPanel
MondayApril 8
430 pm
Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
WednesdayApril 10200 pm
Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle
GH 4TH FL Texas Salon C
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95
Related SessionsSIGs
SundayApril 7
1230 pm
Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix
GH 4TH FL Republic A
SundayApril 7
145 pm
APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC
Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc
GH 4TH FL Republic A
SundayApril 7
300 pm
OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc
GH 4TH FL Republic A
MondayApril 8
1030 am
Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96
Related SessionsSIGs
MondayApril 8
315 pm
OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
TuesdayApril 9
1030 am
OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc
GH 4TH FL Republic A
TuesdayApril 9
1245 pm
OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix
Mark Lee Sr Vice President of Services Solix Technologies Inc
GH 4TH FL Republic A
TuesdayApril 9
200 pm
OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97
Related SessionsSIGs
TuesdayApril 9
200 pm
ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC
GH 4TH FL Crockett D
TuesdayApril 9
430 pm
OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence
GH 4TH FL Republic A
WednesdayApril 10915 am
EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc
GH 4TH FL Republic A
WednesdayApril 10
1030 am
OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98
Related SessionsSIGs
ThursdayApril 11915 am
OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California
GH 4TH FL Republic A
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Meet the Experts Demos
99
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100
11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices
Monday April 8 2019315 PM
GH 4TH FL Texas Salon B
J Anne Carlson Senior Director Product Strategy
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101
11371 - Meet the Experts Oracle E-Business Suite Technology Stack
Tuesday April 9 20191030 AM
GH 4TH FL Texas Salon B
Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102
11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure
Wednesday April 10 2019430 PM
GH 4TH FL Texas Salon B
Terri Noyes Senior Director Product Management Oracle E-Business Suite Development
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |
bull Advanced Architecture
bull Configuration
bull Lift and Shift Cloning
bull Mobile Applications
bull Online Patching
bull One-Click Provision Installation
bull Patching the Technology Stack
bull Performance
bull System Administration
bull Applications Management Pack
bull Upgrades
bull User Interface
103
DemoGroundsOracle E-Business Suite Tools and Technology
for Cloud and On-Premises
Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM
Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM
Copyright copy 2019 Oracle andor its affiliates All rights reserved |
Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105