Oracle E-Business Suite 12.2

Post on 15-Oct-2021

7 views 0 download

Transcript of Oracle E-Business Suite 12.2

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) AdministrationSession ID 11306

Kevin Hudson Senior DirectorElke Phelps Product Management DirectorApplications TechnologyE-Business Suite DevelopmentOracle

April 2019

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Safe Harbor Statement

The preceding is intended to outline our general product direction It is intended for information purposes only and may not be incorporated into any contract It is not acommitment to deliver any material code or functionality and should not be relied upon in making purchasing decisions The development release timing and pricing of any features or functionality described for Oraclersquos products may change and remains at the sole discretion of Oracle Corporation

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 3

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

4

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

5

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureClient

JDB

CSQ

L Ne

t

HTTP

S

Application Database

RAC amp ASM

Global Single Data Model

Edition-Based Redefinition

WebLogic JSP

Forms

BI Publisher

BC4J

Web

Lis

ten

er

UIX 11g

WebLogic Server

6

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull In a nutshell E-Business Suite 122 feels like

ndash A handful of web applicationshellip

ndash Deployed to Clusters of Managed Servershellip

ndash Supervised by an Admin Serverhellip

ndash Deployed to a WebLogic Server Domain

7

Oracle E-Business Suite 122 ArchitectureWhat is E-Business Suite from a WebLogic Perspective

WLS DomainAdmin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureOracle WebLogic Server Domain

bull oacore Core functionality in EBS middle tier Java code including OAF based functionality for EBS products

bull forms Serves all Oracle forms functionality

bull oafm Web services Secure Search and Oracle Transport Agent (OXTA)

oacore_server

forms_server

oafm_server

forms-c4ws_serverNote As of AD-TXK Delta 6 forms-c4ws is disabled

8

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Online Patching Cycle - Overview

Understanding the Online Patching Cycle

bull The Basics

bull Remove obsolete objects

Cleanup

bull Restart application on

Patch Edition

Cutover

bull Compile invalid Objects

bull Wait for a good downtime window

Finalize

bull Apply one or more patches to the Patch Edition

Apply

bull Copy the production application code

bull Create a new Patch Edition in the database

Prepare

Users Online Users OnlineUsers Offline

bull Online Patching is used to apply all EBS patches in EBS 122bull Online Patching cycle includes 5 major phasesbull New patching tool ldquoadoprdquo orchestrates the patching cycle

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Run file system

ndash Used by online users

ndash Stores a complete copy of all Applications and Middle Tier code

ndash Logically mapped to either fs1 or fs2

bull Patch file system

ndash Used by patching tools

ndash Stores a complete copy of all Applications and Middle Tier code

ndash Logically mapped to either fs1 or fs2

bull Non-Editioned file system

ndash Used for data fileseg data importexport files log files report output files

ndash Only stores data files

Online Patching uses a Dual File System

fs1 and fs2 switch Run and Patch designation during the cutover phase of an Online Patching cycle

fs1

Run

Cutoverfs1fs2

PatchPatch

fs2

Run

10

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition

11

Synchronization Managed by Patching Tools

Edition-Based Redefinition

Non-Editioned File System

Run File System

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Patch File System

PATCH_TOP

APPL_TOP_NE

LOGS

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

MOS Note 15839021

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview

Install base

fs_nefs2 EBSappsenvfs1

New file to set the environmentEBSappsenv RUN|PATCH

EBSapps instFMW_HOME EBSapps instFMW_HOME

12

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

$IAS_ORACLE_HOME

$FMW_HOME

EBS WLS Domain

ConfigurationFiles

WLSBinaries

WLSBinaries

Java Required Files for EBS

$EBS_ORACLE_HOME

Oracle HTTP Server

13

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

14

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 comnappl

Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology

EBSapps

15

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 Oracle Home

bull All major services are started out of the Fusion Middleware ORACLE_HOME

ndash formsappear is deployed out of the 1012 ORACLE_HOME

ndash frmweb executable is also invoked out of 1012 ORACLE_HOME

Used for Oracle forms technology

16

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

File System 1

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

File System 2

17

Synchronization Managed by Patching Tools

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

18

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

19

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS

Description Context File VariableUnique Across

Dual File SystemsExample

File System 1Example

File System 2

Port Pool s_port_pool No 0 10

Web Listener Port s_webport No 8000 8000

Web SSL Port s_webssl_port No 4443 4443

Active Web Port s_active_webport No 80004443 80004443

OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009

Node Manager Port s_nmport Yes 5556 5566

WLS Admin Server Port s_wls_adminport Yes 7001 7011

WLS oacore Application port s_wls_oacoreport Yes 7201 7211

WLS Forms Application Port s_wls_formsport Yes 7401 7411

WLS oafm Application Port s_wls_oafmport Yes 7601 7611

20

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Safe Harbor Statement

The preceding is intended to outline our general product direction It is intended for information purposes only and may not be incorporated into any contract It is not acommitment to deliver any material code or functionality and should not be relied upon in making purchasing decisions The development release timing and pricing of any features or functionality described for Oraclersquos products may change and remains at the sole discretion of Oracle Corporation

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 3

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

4

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

5

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureClient

JDB

CSQ

L Ne

t

HTTP

S

Application Database

RAC amp ASM

Global Single Data Model

Edition-Based Redefinition

WebLogic JSP

Forms

BI Publisher

BC4J

Web

Lis

ten

er

UIX 11g

WebLogic Server

6

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull In a nutshell E-Business Suite 122 feels like

ndash A handful of web applicationshellip

ndash Deployed to Clusters of Managed Servershellip

ndash Supervised by an Admin Serverhellip

ndash Deployed to a WebLogic Server Domain

7

Oracle E-Business Suite 122 ArchitectureWhat is E-Business Suite from a WebLogic Perspective

WLS DomainAdmin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureOracle WebLogic Server Domain

bull oacore Core functionality in EBS middle tier Java code including OAF based functionality for EBS products

bull forms Serves all Oracle forms functionality

bull oafm Web services Secure Search and Oracle Transport Agent (OXTA)

oacore_server

forms_server

oafm_server

forms-c4ws_serverNote As of AD-TXK Delta 6 forms-c4ws is disabled

8

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Online Patching Cycle - Overview

Understanding the Online Patching Cycle

bull The Basics

bull Remove obsolete objects

Cleanup

bull Restart application on

Patch Edition

Cutover

bull Compile invalid Objects

bull Wait for a good downtime window

Finalize

bull Apply one or more patches to the Patch Edition

Apply

bull Copy the production application code

bull Create a new Patch Edition in the database

Prepare

Users Online Users OnlineUsers Offline

bull Online Patching is used to apply all EBS patches in EBS 122bull Online Patching cycle includes 5 major phasesbull New patching tool ldquoadoprdquo orchestrates the patching cycle

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Run file system

ndash Used by online users

ndash Stores a complete copy of all Applications and Middle Tier code

ndash Logically mapped to either fs1 or fs2

bull Patch file system

ndash Used by patching tools

ndash Stores a complete copy of all Applications and Middle Tier code

ndash Logically mapped to either fs1 or fs2

bull Non-Editioned file system

ndash Used for data fileseg data importexport files log files report output files

ndash Only stores data files

Online Patching uses a Dual File System

fs1 and fs2 switch Run and Patch designation during the cutover phase of an Online Patching cycle

fs1

Run

Cutoverfs1fs2

PatchPatch

fs2

Run

10

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition

11

Synchronization Managed by Patching Tools

Edition-Based Redefinition

Non-Editioned File System

Run File System

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Patch File System

PATCH_TOP

APPL_TOP_NE

LOGS

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

MOS Note 15839021

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview

Install base

fs_nefs2 EBSappsenvfs1

New file to set the environmentEBSappsenv RUN|PATCH

EBSapps instFMW_HOME EBSapps instFMW_HOME

12

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

$IAS_ORACLE_HOME

$FMW_HOME

EBS WLS Domain

ConfigurationFiles

WLSBinaries

WLSBinaries

Java Required Files for EBS

$EBS_ORACLE_HOME

Oracle HTTP Server

13

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

14

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 comnappl

Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology

EBSapps

15

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 Oracle Home

bull All major services are started out of the Fusion Middleware ORACLE_HOME

ndash formsappear is deployed out of the 1012 ORACLE_HOME

ndash frmweb executable is also invoked out of 1012 ORACLE_HOME

Used for Oracle forms technology

16

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

File System 1

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

File System 2

17

Synchronization Managed by Patching Tools

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

18

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

19

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS

Description Context File VariableUnique Across

Dual File SystemsExample

File System 1Example

File System 2

Port Pool s_port_pool No 0 10

Web Listener Port s_webport No 8000 8000

Web SSL Port s_webssl_port No 4443 4443

Active Web Port s_active_webport No 80004443 80004443

OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009

Node Manager Port s_nmport Yes 5556 5566

WLS Admin Server Port s_wls_adminport Yes 7001 7011

WLS oacore Application port s_wls_oacoreport Yes 7201 7211

WLS Forms Application Port s_wls_formsport Yes 7401 7411

WLS oafm Application Port s_wls_oafmport Yes 7601 7611

20

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

4

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

5

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureClient

JDB

CSQ

L Ne

t

HTTP

S

Application Database

RAC amp ASM

Global Single Data Model

Edition-Based Redefinition

WebLogic JSP

Forms

BI Publisher

BC4J

Web

Lis

ten

er

UIX 11g

WebLogic Server

6

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull In a nutshell E-Business Suite 122 feels like

ndash A handful of web applicationshellip

ndash Deployed to Clusters of Managed Servershellip

ndash Supervised by an Admin Serverhellip

ndash Deployed to a WebLogic Server Domain

7

Oracle E-Business Suite 122 ArchitectureWhat is E-Business Suite from a WebLogic Perspective

WLS DomainAdmin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureOracle WebLogic Server Domain

bull oacore Core functionality in EBS middle tier Java code including OAF based functionality for EBS products

bull forms Serves all Oracle forms functionality

bull oafm Web services Secure Search and Oracle Transport Agent (OXTA)

oacore_server

forms_server

oafm_server

forms-c4ws_serverNote As of AD-TXK Delta 6 forms-c4ws is disabled

8

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Online Patching Cycle - Overview

Understanding the Online Patching Cycle

bull The Basics

bull Remove obsolete objects

Cleanup

bull Restart application on

Patch Edition

Cutover

bull Compile invalid Objects

bull Wait for a good downtime window

Finalize

bull Apply one or more patches to the Patch Edition

Apply

bull Copy the production application code

bull Create a new Patch Edition in the database

Prepare

Users Online Users OnlineUsers Offline

bull Online Patching is used to apply all EBS patches in EBS 122bull Online Patching cycle includes 5 major phasesbull New patching tool ldquoadoprdquo orchestrates the patching cycle

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Run file system

ndash Used by online users

ndash Stores a complete copy of all Applications and Middle Tier code

ndash Logically mapped to either fs1 or fs2

bull Patch file system

ndash Used by patching tools

ndash Stores a complete copy of all Applications and Middle Tier code

ndash Logically mapped to either fs1 or fs2

bull Non-Editioned file system

ndash Used for data fileseg data importexport files log files report output files

ndash Only stores data files

Online Patching uses a Dual File System

fs1 and fs2 switch Run and Patch designation during the cutover phase of an Online Patching cycle

fs1

Run

Cutoverfs1fs2

PatchPatch

fs2

Run

10

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition

11

Synchronization Managed by Patching Tools

Edition-Based Redefinition

Non-Editioned File System

Run File System

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Patch File System

PATCH_TOP

APPL_TOP_NE

LOGS

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

MOS Note 15839021

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview

Install base

fs_nefs2 EBSappsenvfs1

New file to set the environmentEBSappsenv RUN|PATCH

EBSapps instFMW_HOME EBSapps instFMW_HOME

12

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

$IAS_ORACLE_HOME

$FMW_HOME

EBS WLS Domain

ConfigurationFiles

WLSBinaries

WLSBinaries

Java Required Files for EBS

$EBS_ORACLE_HOME

Oracle HTTP Server

13

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

14

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 comnappl

Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology

EBSapps

15

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 Oracle Home

bull All major services are started out of the Fusion Middleware ORACLE_HOME

ndash formsappear is deployed out of the 1012 ORACLE_HOME

ndash frmweb executable is also invoked out of 1012 ORACLE_HOME

Used for Oracle forms technology

16

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

File System 1

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

File System 2

17

Synchronization Managed by Patching Tools

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

18

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

19

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS

Description Context File VariableUnique Across

Dual File SystemsExample

File System 1Example

File System 2

Port Pool s_port_pool No 0 10

Web Listener Port s_webport No 8000 8000

Web SSL Port s_webssl_port No 4443 4443

Active Web Port s_active_webport No 80004443 80004443

OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009

Node Manager Port s_nmport Yes 5556 5566

WLS Admin Server Port s_wls_adminport Yes 7001 7011

WLS oacore Application port s_wls_oacoreport Yes 7201 7211

WLS Forms Application Port s_wls_formsport Yes 7401 7411

WLS oafm Application Port s_wls_oafmport Yes 7601 7611

20

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

5

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureClient

JDB

CSQ

L Ne

t

HTTP

S

Application Database

RAC amp ASM

Global Single Data Model

Edition-Based Redefinition

WebLogic JSP

Forms

BI Publisher

BC4J

Web

Lis

ten

er

UIX 11g

WebLogic Server

6

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull In a nutshell E-Business Suite 122 feels like

ndash A handful of web applicationshellip

ndash Deployed to Clusters of Managed Servershellip

ndash Supervised by an Admin Serverhellip

ndash Deployed to a WebLogic Server Domain

7

Oracle E-Business Suite 122 ArchitectureWhat is E-Business Suite from a WebLogic Perspective

WLS DomainAdmin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureOracle WebLogic Server Domain

bull oacore Core functionality in EBS middle tier Java code including OAF based functionality for EBS products

bull forms Serves all Oracle forms functionality

bull oafm Web services Secure Search and Oracle Transport Agent (OXTA)

oacore_server

forms_server

oafm_server

forms-c4ws_serverNote As of AD-TXK Delta 6 forms-c4ws is disabled

8

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Online Patching Cycle - Overview

Understanding the Online Patching Cycle

bull The Basics

bull Remove obsolete objects

Cleanup

bull Restart application on

Patch Edition

Cutover

bull Compile invalid Objects

bull Wait for a good downtime window

Finalize

bull Apply one or more patches to the Patch Edition

Apply

bull Copy the production application code

bull Create a new Patch Edition in the database

Prepare

Users Online Users OnlineUsers Offline

bull Online Patching is used to apply all EBS patches in EBS 122bull Online Patching cycle includes 5 major phasesbull New patching tool ldquoadoprdquo orchestrates the patching cycle

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Run file system

ndash Used by online users

ndash Stores a complete copy of all Applications and Middle Tier code

ndash Logically mapped to either fs1 or fs2

bull Patch file system

ndash Used by patching tools

ndash Stores a complete copy of all Applications and Middle Tier code

ndash Logically mapped to either fs1 or fs2

bull Non-Editioned file system

ndash Used for data fileseg data importexport files log files report output files

ndash Only stores data files

Online Patching uses a Dual File System

fs1 and fs2 switch Run and Patch designation during the cutover phase of an Online Patching cycle

fs1

Run

Cutoverfs1fs2

PatchPatch

fs2

Run

10

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition

11

Synchronization Managed by Patching Tools

Edition-Based Redefinition

Non-Editioned File System

Run File System

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Patch File System

PATCH_TOP

APPL_TOP_NE

LOGS

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

MOS Note 15839021

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview

Install base

fs_nefs2 EBSappsenvfs1

New file to set the environmentEBSappsenv RUN|PATCH

EBSapps instFMW_HOME EBSapps instFMW_HOME

12

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

$IAS_ORACLE_HOME

$FMW_HOME

EBS WLS Domain

ConfigurationFiles

WLSBinaries

WLSBinaries

Java Required Files for EBS

$EBS_ORACLE_HOME

Oracle HTTP Server

13

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

14

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 comnappl

Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology

EBSapps

15

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 Oracle Home

bull All major services are started out of the Fusion Middleware ORACLE_HOME

ndash formsappear is deployed out of the 1012 ORACLE_HOME

ndash frmweb executable is also invoked out of 1012 ORACLE_HOME

Used for Oracle forms technology

16

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

File System 1

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

File System 2

17

Synchronization Managed by Patching Tools

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

18

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

19

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS

Description Context File VariableUnique Across

Dual File SystemsExample

File System 1Example

File System 2

Port Pool s_port_pool No 0 10

Web Listener Port s_webport No 8000 8000

Web SSL Port s_webssl_port No 4443 4443

Active Web Port s_active_webport No 80004443 80004443

OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009

Node Manager Port s_nmport Yes 5556 5566

WLS Admin Server Port s_wls_adminport Yes 7001 7011

WLS oacore Application port s_wls_oacoreport Yes 7201 7211

WLS Forms Application Port s_wls_formsport Yes 7401 7411

WLS oafm Application Port s_wls_oafmport Yes 7601 7611

20

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureClient

JDB

CSQ

L Ne

t

HTTP

S

Application Database

RAC amp ASM

Global Single Data Model

Edition-Based Redefinition

WebLogic JSP

Forms

BI Publisher

BC4J

Web

Lis

ten

er

UIX 11g

WebLogic Server

6

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull In a nutshell E-Business Suite 122 feels like

ndash A handful of web applicationshellip

ndash Deployed to Clusters of Managed Servershellip

ndash Supervised by an Admin Serverhellip

ndash Deployed to a WebLogic Server Domain

7

Oracle E-Business Suite 122 ArchitectureWhat is E-Business Suite from a WebLogic Perspective

WLS DomainAdmin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureOracle WebLogic Server Domain

bull oacore Core functionality in EBS middle tier Java code including OAF based functionality for EBS products

bull forms Serves all Oracle forms functionality

bull oafm Web services Secure Search and Oracle Transport Agent (OXTA)

oacore_server

forms_server

oafm_server

forms-c4ws_serverNote As of AD-TXK Delta 6 forms-c4ws is disabled

8

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Online Patching Cycle - Overview

Understanding the Online Patching Cycle

bull The Basics

bull Remove obsolete objects

Cleanup

bull Restart application on

Patch Edition

Cutover

bull Compile invalid Objects

bull Wait for a good downtime window

Finalize

bull Apply one or more patches to the Patch Edition

Apply

bull Copy the production application code

bull Create a new Patch Edition in the database

Prepare

Users Online Users OnlineUsers Offline

bull Online Patching is used to apply all EBS patches in EBS 122bull Online Patching cycle includes 5 major phasesbull New patching tool ldquoadoprdquo orchestrates the patching cycle

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Run file system

ndash Used by online users

ndash Stores a complete copy of all Applications and Middle Tier code

ndash Logically mapped to either fs1 or fs2

bull Patch file system

ndash Used by patching tools

ndash Stores a complete copy of all Applications and Middle Tier code

ndash Logically mapped to either fs1 or fs2

bull Non-Editioned file system

ndash Used for data fileseg data importexport files log files report output files

ndash Only stores data files

Online Patching uses a Dual File System

fs1 and fs2 switch Run and Patch designation during the cutover phase of an Online Patching cycle

fs1

Run

Cutoverfs1fs2

PatchPatch

fs2

Run

10

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition

11

Synchronization Managed by Patching Tools

Edition-Based Redefinition

Non-Editioned File System

Run File System

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Patch File System

PATCH_TOP

APPL_TOP_NE

LOGS

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

MOS Note 15839021

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview

Install base

fs_nefs2 EBSappsenvfs1

New file to set the environmentEBSappsenv RUN|PATCH

EBSapps instFMW_HOME EBSapps instFMW_HOME

12

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

$IAS_ORACLE_HOME

$FMW_HOME

EBS WLS Domain

ConfigurationFiles

WLSBinaries

WLSBinaries

Java Required Files for EBS

$EBS_ORACLE_HOME

Oracle HTTP Server

13

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

14

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 comnappl

Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology

EBSapps

15

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 Oracle Home

bull All major services are started out of the Fusion Middleware ORACLE_HOME

ndash formsappear is deployed out of the 1012 ORACLE_HOME

ndash frmweb executable is also invoked out of 1012 ORACLE_HOME

Used for Oracle forms technology

16

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

File System 1

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

File System 2

17

Synchronization Managed by Patching Tools

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

18

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

19

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS

Description Context File VariableUnique Across

Dual File SystemsExample

File System 1Example

File System 2

Port Pool s_port_pool No 0 10

Web Listener Port s_webport No 8000 8000

Web SSL Port s_webssl_port No 4443 4443

Active Web Port s_active_webport No 80004443 80004443

OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009

Node Manager Port s_nmport Yes 5556 5566

WLS Admin Server Port s_wls_adminport Yes 7001 7011

WLS oacore Application port s_wls_oacoreport Yes 7201 7211

WLS Forms Application Port s_wls_formsport Yes 7401 7411

WLS oafm Application Port s_wls_oafmport Yes 7601 7611

20

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull In a nutshell E-Business Suite 122 feels like

ndash A handful of web applicationshellip

ndash Deployed to Clusters of Managed Servershellip

ndash Supervised by an Admin Serverhellip

ndash Deployed to a WebLogic Server Domain

7

Oracle E-Business Suite 122 ArchitectureWhat is E-Business Suite from a WebLogic Perspective

WLS DomainAdmin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureOracle WebLogic Server Domain

bull oacore Core functionality in EBS middle tier Java code including OAF based functionality for EBS products

bull forms Serves all Oracle forms functionality

bull oafm Web services Secure Search and Oracle Transport Agent (OXTA)

oacore_server

forms_server

oafm_server

forms-c4ws_serverNote As of AD-TXK Delta 6 forms-c4ws is disabled

8

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Online Patching Cycle - Overview

Understanding the Online Patching Cycle

bull The Basics

bull Remove obsolete objects

Cleanup

bull Restart application on

Patch Edition

Cutover

bull Compile invalid Objects

bull Wait for a good downtime window

Finalize

bull Apply one or more patches to the Patch Edition

Apply

bull Copy the production application code

bull Create a new Patch Edition in the database

Prepare

Users Online Users OnlineUsers Offline

bull Online Patching is used to apply all EBS patches in EBS 122bull Online Patching cycle includes 5 major phasesbull New patching tool ldquoadoprdquo orchestrates the patching cycle

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Run file system

ndash Used by online users

ndash Stores a complete copy of all Applications and Middle Tier code

ndash Logically mapped to either fs1 or fs2

bull Patch file system

ndash Used by patching tools

ndash Stores a complete copy of all Applications and Middle Tier code

ndash Logically mapped to either fs1 or fs2

bull Non-Editioned file system

ndash Used for data fileseg data importexport files log files report output files

ndash Only stores data files

Online Patching uses a Dual File System

fs1 and fs2 switch Run and Patch designation during the cutover phase of an Online Patching cycle

fs1

Run

Cutoverfs1fs2

PatchPatch

fs2

Run

10

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition

11

Synchronization Managed by Patching Tools

Edition-Based Redefinition

Non-Editioned File System

Run File System

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Patch File System

PATCH_TOP

APPL_TOP_NE

LOGS

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

MOS Note 15839021

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview

Install base

fs_nefs2 EBSappsenvfs1

New file to set the environmentEBSappsenv RUN|PATCH

EBSapps instFMW_HOME EBSapps instFMW_HOME

12

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

$IAS_ORACLE_HOME

$FMW_HOME

EBS WLS Domain

ConfigurationFiles

WLSBinaries

WLSBinaries

Java Required Files for EBS

$EBS_ORACLE_HOME

Oracle HTTP Server

13

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

14

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 comnappl

Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology

EBSapps

15

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 Oracle Home

bull All major services are started out of the Fusion Middleware ORACLE_HOME

ndash formsappear is deployed out of the 1012 ORACLE_HOME

ndash frmweb executable is also invoked out of 1012 ORACLE_HOME

Used for Oracle forms technology

16

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

File System 1

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

File System 2

17

Synchronization Managed by Patching Tools

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

18

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

19

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS

Description Context File VariableUnique Across

Dual File SystemsExample

File System 1Example

File System 2

Port Pool s_port_pool No 0 10

Web Listener Port s_webport No 8000 8000

Web SSL Port s_webssl_port No 4443 4443

Active Web Port s_active_webport No 80004443 80004443

OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009

Node Manager Port s_nmport Yes 5556 5566

WLS Admin Server Port s_wls_adminport Yes 7001 7011

WLS oacore Application port s_wls_oacoreport Yes 7201 7211

WLS Forms Application Port s_wls_formsport Yes 7401 7411

WLS oafm Application Port s_wls_oafmport Yes 7601 7611

20

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureOracle WebLogic Server Domain

bull oacore Core functionality in EBS middle tier Java code including OAF based functionality for EBS products

bull forms Serves all Oracle forms functionality

bull oafm Web services Secure Search and Oracle Transport Agent (OXTA)

oacore_server

forms_server

oafm_server

forms-c4ws_serverNote As of AD-TXK Delta 6 forms-c4ws is disabled

8

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Online Patching Cycle - Overview

Understanding the Online Patching Cycle

bull The Basics

bull Remove obsolete objects

Cleanup

bull Restart application on

Patch Edition

Cutover

bull Compile invalid Objects

bull Wait for a good downtime window

Finalize

bull Apply one or more patches to the Patch Edition

Apply

bull Copy the production application code

bull Create a new Patch Edition in the database

Prepare

Users Online Users OnlineUsers Offline

bull Online Patching is used to apply all EBS patches in EBS 122bull Online Patching cycle includes 5 major phasesbull New patching tool ldquoadoprdquo orchestrates the patching cycle

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Run file system

ndash Used by online users

ndash Stores a complete copy of all Applications and Middle Tier code

ndash Logically mapped to either fs1 or fs2

bull Patch file system

ndash Used by patching tools

ndash Stores a complete copy of all Applications and Middle Tier code

ndash Logically mapped to either fs1 or fs2

bull Non-Editioned file system

ndash Used for data fileseg data importexport files log files report output files

ndash Only stores data files

Online Patching uses a Dual File System

fs1 and fs2 switch Run and Patch designation during the cutover phase of an Online Patching cycle

fs1

Run

Cutoverfs1fs2

PatchPatch

fs2

Run

10

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition

11

Synchronization Managed by Patching Tools

Edition-Based Redefinition

Non-Editioned File System

Run File System

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Patch File System

PATCH_TOP

APPL_TOP_NE

LOGS

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

MOS Note 15839021

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview

Install base

fs_nefs2 EBSappsenvfs1

New file to set the environmentEBSappsenv RUN|PATCH

EBSapps instFMW_HOME EBSapps instFMW_HOME

12

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

$IAS_ORACLE_HOME

$FMW_HOME

EBS WLS Domain

ConfigurationFiles

WLSBinaries

WLSBinaries

Java Required Files for EBS

$EBS_ORACLE_HOME

Oracle HTTP Server

13

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

14

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 comnappl

Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology

EBSapps

15

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 Oracle Home

bull All major services are started out of the Fusion Middleware ORACLE_HOME

ndash formsappear is deployed out of the 1012 ORACLE_HOME

ndash frmweb executable is also invoked out of 1012 ORACLE_HOME

Used for Oracle forms technology

16

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

File System 1

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

File System 2

17

Synchronization Managed by Patching Tools

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

18

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

19

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS

Description Context File VariableUnique Across

Dual File SystemsExample

File System 1Example

File System 2

Port Pool s_port_pool No 0 10

Web Listener Port s_webport No 8000 8000

Web SSL Port s_webssl_port No 4443 4443

Active Web Port s_active_webport No 80004443 80004443

OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009

Node Manager Port s_nmport Yes 5556 5566

WLS Admin Server Port s_wls_adminport Yes 7001 7011

WLS oacore Application port s_wls_oacoreport Yes 7201 7211

WLS Forms Application Port s_wls_formsport Yes 7401 7411

WLS oafm Application Port s_wls_oafmport Yes 7601 7611

20

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Online Patching Cycle - Overview

Understanding the Online Patching Cycle

bull The Basics

bull Remove obsolete objects

Cleanup

bull Restart application on

Patch Edition

Cutover

bull Compile invalid Objects

bull Wait for a good downtime window

Finalize

bull Apply one or more patches to the Patch Edition

Apply

bull Copy the production application code

bull Create a new Patch Edition in the database

Prepare

Users Online Users OnlineUsers Offline

bull Online Patching is used to apply all EBS patches in EBS 122bull Online Patching cycle includes 5 major phasesbull New patching tool ldquoadoprdquo orchestrates the patching cycle

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Run file system

ndash Used by online users

ndash Stores a complete copy of all Applications and Middle Tier code

ndash Logically mapped to either fs1 or fs2

bull Patch file system

ndash Used by patching tools

ndash Stores a complete copy of all Applications and Middle Tier code

ndash Logically mapped to either fs1 or fs2

bull Non-Editioned file system

ndash Used for data fileseg data importexport files log files report output files

ndash Only stores data files

Online Patching uses a Dual File System

fs1 and fs2 switch Run and Patch designation during the cutover phase of an Online Patching cycle

fs1

Run

Cutoverfs1fs2

PatchPatch

fs2

Run

10

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition

11

Synchronization Managed by Patching Tools

Edition-Based Redefinition

Non-Editioned File System

Run File System

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Patch File System

PATCH_TOP

APPL_TOP_NE

LOGS

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

MOS Note 15839021

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview

Install base

fs_nefs2 EBSappsenvfs1

New file to set the environmentEBSappsenv RUN|PATCH

EBSapps instFMW_HOME EBSapps instFMW_HOME

12

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

$IAS_ORACLE_HOME

$FMW_HOME

EBS WLS Domain

ConfigurationFiles

WLSBinaries

WLSBinaries

Java Required Files for EBS

$EBS_ORACLE_HOME

Oracle HTTP Server

13

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

14

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 comnappl

Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology

EBSapps

15

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 Oracle Home

bull All major services are started out of the Fusion Middleware ORACLE_HOME

ndash formsappear is deployed out of the 1012 ORACLE_HOME

ndash frmweb executable is also invoked out of 1012 ORACLE_HOME

Used for Oracle forms technology

16

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

File System 1

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

File System 2

17

Synchronization Managed by Patching Tools

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

18

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

19

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS

Description Context File VariableUnique Across

Dual File SystemsExample

File System 1Example

File System 2

Port Pool s_port_pool No 0 10

Web Listener Port s_webport No 8000 8000

Web SSL Port s_webssl_port No 4443 4443

Active Web Port s_active_webport No 80004443 80004443

OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009

Node Manager Port s_nmport Yes 5556 5566

WLS Admin Server Port s_wls_adminport Yes 7001 7011

WLS oacore Application port s_wls_oacoreport Yes 7201 7211

WLS Forms Application Port s_wls_formsport Yes 7401 7411

WLS oafm Application Port s_wls_oafmport Yes 7601 7611

20

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Run file system

ndash Used by online users

ndash Stores a complete copy of all Applications and Middle Tier code

ndash Logically mapped to either fs1 or fs2

bull Patch file system

ndash Used by patching tools

ndash Stores a complete copy of all Applications and Middle Tier code

ndash Logically mapped to either fs1 or fs2

bull Non-Editioned file system

ndash Used for data fileseg data importexport files log files report output files

ndash Only stores data files

Online Patching uses a Dual File System

fs1 and fs2 switch Run and Patch designation during the cutover phase of an Online Patching cycle

fs1

Run

Cutoverfs1fs2

PatchPatch

fs2

Run

10

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition

11

Synchronization Managed by Patching Tools

Edition-Based Redefinition

Non-Editioned File System

Run File System

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Patch File System

PATCH_TOP

APPL_TOP_NE

LOGS

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

MOS Note 15839021

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview

Install base

fs_nefs2 EBSappsenvfs1

New file to set the environmentEBSappsenv RUN|PATCH

EBSapps instFMW_HOME EBSapps instFMW_HOME

12

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

$IAS_ORACLE_HOME

$FMW_HOME

EBS WLS Domain

ConfigurationFiles

WLSBinaries

WLSBinaries

Java Required Files for EBS

$EBS_ORACLE_HOME

Oracle HTTP Server

13

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

14

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 comnappl

Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology

EBSapps

15

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 Oracle Home

bull All major services are started out of the Fusion Middleware ORACLE_HOME

ndash formsappear is deployed out of the 1012 ORACLE_HOME

ndash frmweb executable is also invoked out of 1012 ORACLE_HOME

Used for Oracle forms technology

16

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

File System 1

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

File System 2

17

Synchronization Managed by Patching Tools

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

18

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

19

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS

Description Context File VariableUnique Across

Dual File SystemsExample

File System 1Example

File System 2

Port Pool s_port_pool No 0 10

Web Listener Port s_webport No 8000 8000

Web SSL Port s_webssl_port No 4443 4443

Active Web Port s_active_webport No 80004443 80004443

OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009

Node Manager Port s_nmport Yes 5556 5566

WLS Admin Server Port s_wls_adminport Yes 7001 7011

WLS oacore Application port s_wls_oacoreport Yes 7201 7211

WLS Forms Application Port s_wls_formsport Yes 7401 7411

WLS oafm Application Port s_wls_oafmport Yes 7601 7611

20

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureDual File System and Edition-Based Redefinition

11

Synchronization Managed by Patching Tools

Edition-Based Redefinition

Non-Editioned File System

Run File System

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Patch File System

PATCH_TOP

APPL_TOP_NE

LOGS

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

MOS Note 15839021

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview

Install base

fs_nefs2 EBSappsenvfs1

New file to set the environmentEBSappsenv RUN|PATCH

EBSapps instFMW_HOME EBSapps instFMW_HOME

12

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

$IAS_ORACLE_HOME

$FMW_HOME

EBS WLS Domain

ConfigurationFiles

WLSBinaries

WLSBinaries

Java Required Files for EBS

$EBS_ORACLE_HOME

Oracle HTTP Server

13

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

14

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 comnappl

Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology

EBSapps

15

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 Oracle Home

bull All major services are started out of the Fusion Middleware ORACLE_HOME

ndash formsappear is deployed out of the 1012 ORACLE_HOME

ndash frmweb executable is also invoked out of 1012 ORACLE_HOME

Used for Oracle forms technology

16

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

File System 1

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

File System 2

17

Synchronization Managed by Patching Tools

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

18

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

19

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS

Description Context File VariableUnique Across

Dual File SystemsExample

File System 1Example

File System 2

Port Pool s_port_pool No 0 10

Web Listener Port s_webport No 8000 8000

Web SSL Port s_webssl_port No 4443 4443

Active Web Port s_active_webport No 80004443 80004443

OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009

Node Manager Port s_nmport Yes 5556 5566

WLS Admin Server Port s_wls_adminport Yes 7001 7011

WLS oacore Application port s_wls_oacoreport Yes 7201 7211

WLS Forms Application Port s_wls_formsport Yes 7401 7411

WLS oafm Application Port s_wls_oafmport Yes 7601 7611

20

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Rapid Install File System LayoutHigh Level Overview

Install base

fs_nefs2 EBSappsenvfs1

New file to set the environmentEBSappsenv RUN|PATCH

EBSapps instFMW_HOME EBSapps instFMW_HOME

12

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

$IAS_ORACLE_HOME

$FMW_HOME

EBS WLS Domain

ConfigurationFiles

WLSBinaries

WLSBinaries

Java Required Files for EBS

$EBS_ORACLE_HOME

Oracle HTTP Server

13

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

14

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 comnappl

Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology

EBSapps

15

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 Oracle Home

bull All major services are started out of the Fusion Middleware ORACLE_HOME

ndash formsappear is deployed out of the 1012 ORACLE_HOME

ndash frmweb executable is also invoked out of 1012 ORACLE_HOME

Used for Oracle forms technology

16

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

File System 1

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

File System 2

17

Synchronization Managed by Patching Tools

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

18

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

19

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS

Description Context File VariableUnique Across

Dual File SystemsExample

File System 1Example

File System 2

Port Pool s_port_pool No 0 10

Web Listener Port s_webport No 8000 8000

Web SSL Port s_webssl_port No 4443 4443

Active Web Port s_active_webport No 80004443 80004443

OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009

Node Manager Port s_nmport Yes 5556 5566

WLS Admin Server Port s_wls_adminport Yes 7001 7011

WLS oacore Application port s_wls_oacoreport Yes 7201 7211

WLS Forms Application Port s_wls_formsport Yes 7401 7411

WLS oafm Application Port s_wls_oafmport Yes 7601 7611

20

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

$IAS_ORACLE_HOME

$FMW_HOME

EBS WLS Domain

ConfigurationFiles

WLSBinaries

WLSBinaries

Java Required Files for EBS

$EBS_ORACLE_HOME

Oracle HTTP Server

13

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

14

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 comnappl

Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology

EBSapps

15

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 Oracle Home

bull All major services are started out of the Fusion Middleware ORACLE_HOME

ndash formsappear is deployed out of the 1012 ORACLE_HOME

ndash frmweb executable is also invoked out of 1012 ORACLE_HOME

Used for Oracle forms technology

16

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

File System 1

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

File System 2

17

Synchronization Managed by Patching Tools

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

18

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

19

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS

Description Context File VariableUnique Across

Dual File SystemsExample

File System 1Example

File System 2

Port Pool s_port_pool No 0 10

Web Listener Port s_webport No 8000 8000

Web SSL Port s_webssl_port No 4443 4443

Active Web Port s_active_webport No 80004443 80004443

OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009

Node Manager Port s_nmport Yes 5556 5566

WLS Admin Server Port s_wls_adminport Yes 7001 7011

WLS oacore Application port s_wls_oacoreport Yes 7201 7211

WLS Forms Application Port s_wls_formsport Yes 7401 7411

WLS oafm Application Port s_wls_oafmport Yes 7601 7611

20

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

14

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 comnappl

Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology

EBSapps

15

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 Oracle Home

bull All major services are started out of the Fusion Middleware ORACLE_HOME

ndash formsappear is deployed out of the 1012 ORACLE_HOME

ndash frmweb executable is also invoked out of 1012 ORACLE_HOME

Used for Oracle forms technology

16

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

File System 1

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

File System 2

17

Synchronization Managed by Patching Tools

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

18

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

19

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS

Description Context File VariableUnique Across

Dual File SystemsExample

File System 1Example

File System 2

Port Pool s_port_pool No 0 10

Web Listener Port s_webport No 8000 8000

Web SSL Port s_webssl_port No 4443 4443

Active Web Port s_active_webport No 80004443 80004443

OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009

Node Manager Port s_nmport Yes 5556 5566

WLS Admin Server Port s_wls_adminport Yes 7001 7011

WLS oacore Application port s_wls_oacoreport Yes 7201 7211

WLS Forms Application Port s_wls_formsport Yes 7401 7411

WLS oafm Application Port s_wls_oafmport Yes 7601 7611

20

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 comnappl

Oracle E-Business Suite 1012 Oracle HomeUsed for Oracle Forms Technology

EBSapps

15

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 Oracle Home

bull All major services are started out of the Fusion Middleware ORACLE_HOME

ndash formsappear is deployed out of the 1012 ORACLE_HOME

ndash frmweb executable is also invoked out of 1012 ORACLE_HOME

Used for Oracle forms technology

16

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

File System 1

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

File System 2

17

Synchronization Managed by Patching Tools

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

18

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

19

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS

Description Context File VariableUnique Across

Dual File SystemsExample

File System 1Example

File System 2

Port Pool s_port_pool No 0 10

Web Listener Port s_webport No 8000 8000

Web SSL Port s_webssl_port No 4443 4443

Active Web Port s_active_webport No 80004443 80004443

OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009

Node Manager Port s_nmport Yes 5556 5566

WLS Admin Server Port s_wls_adminport Yes 7001 7011

WLS oacore Application port s_wls_oacoreport Yes 7201 7211

WLS Forms Application Port s_wls_formsport Yes 7401 7411

WLS oafm Application Port s_wls_oafmport Yes 7601 7611

20

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

1012 Oracle Home

bull All major services are started out of the Fusion Middleware ORACLE_HOME

ndash formsappear is deployed out of the 1012 ORACLE_HOME

ndash frmweb executable is also invoked out of 1012 ORACLE_HOME

Used for Oracle forms technology

16

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

File System 1

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

File System 2

17

Synchronization Managed by Patching Tools

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

18

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

19

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS

Description Context File VariableUnique Across

Dual File SystemsExample

File System 1Example

File System 2

Port Pool s_port_pool No 0 10

Web Listener Port s_webport No 8000 8000

Web SSL Port s_webssl_port No 4443 4443

Active Web Port s_active_webport No 80004443 80004443

OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009

Node Manager Port s_nmport Yes 5556 5566

WLS Admin Server Port s_wls_adminport Yes 7001 7011

WLS oacore Application port s_wls_oacoreport Yes 7201 7211

WLS Forms Application Port s_wls_formsport Yes 7401 7411

WLS oafm Application Port s_wls_oafmport Yes 7601 7611

20

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

Oracle E-Business Suite 122 Architecture Dual File SystemOne EBS WLS Domain and Managed Servers for Each File System

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

File System 1

EBS WLS Domain Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server

WebLogic Server

File System 2

17

Synchronization Managed by Patching Tools

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

18

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

19

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS

Description Context File VariableUnique Across

Dual File SystemsExample

File System 1Example

File System 2

Port Pool s_port_pool No 0 10

Web Listener Port s_webport No 8000 8000

Web SSL Port s_webssl_port No 4443 4443

Active Web Port s_active_webport No 80004443 80004443

OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009

Node Manager Port s_nmport Yes 5556 5566

WLS Admin Server Port s_wls_adminport Yes 7001 7011

WLS oacore Application port s_wls_oacoreport Yes 7201 7211

WLS Forms Application Port s_wls_formsport Yes 7401 7411

WLS oafm Application Port s_wls_oafmport Yes 7601 7611

20

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

18

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

19

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS

Description Context File VariableUnique Across

Dual File SystemsExample

File System 1Example

File System 2

Port Pool s_port_pool No 0 10

Web Listener Port s_webport No 8000 8000

Web SSL Port s_webssl_port No 4443 4443

Active Web Port s_active_webport No 80004443 80004443

OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009

Node Manager Port s_nmport Yes 5556 5566

WLS Admin Server Port s_wls_adminport Yes 7001 7011

WLS oacore Application port s_wls_oacoreport Yes 7201 7211

WLS Forms Application Port s_wls_formsport Yes 7401 7411

WLS oafm Application Port s_wls_oafmport Yes 7601 7611

20

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull One Port Pool for each file system (fs1 fs2)

bull All ports must be free on the node

bull Recommend assigning Port Pools for one environment a minimum 10 pools apart

For example- Port Pool fs1=0 fs2=10 on node=testserver1- Port Pool fs1=0 fs2=10 on node=testserver2

bull Port Pools must be unique for each EBS environment on a same server

For example- Port Pool fs1=0 fs2=10 on node=testserver3- Port Pool fs1=11 fs2=21 on node=testserver3

bull Most ports are unique to each file system

19

Oracle E-Business Suite 122 Architecture Dual File System

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS

Description Context File VariableUnique Across

Dual File SystemsExample

File System 1Example

File System 2

Port Pool s_port_pool No 0 10

Web Listener Port s_webport No 8000 8000

Web SSL Port s_webssl_port No 4443 4443

Active Web Port s_active_webport No 80004443 80004443

OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009

Node Manager Port s_nmport Yes 5556 5566

WLS Admin Server Port s_wls_adminport Yes 7001 7011

WLS oacore Application port s_wls_oacoreport Yes 7201 7211

WLS Forms Application Port s_wls_formsport Yes 7401 7411

WLS oafm Application Port s_wls_oafmport Yes 7601 7611

20

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 Dual File SystemKey Ports for OHS WLS

Description Context File VariableUnique Across

Dual File SystemsExample

File System 1Example

File System 2

Port Pool s_port_pool No 0 10

Web Listener Port s_webport No 8000 8000

Web SSL Port s_webssl_port No 4443 4443

Active Web Port s_active_webport No 80004443 80004443

OHS Administration Proxy Port s_ohs_adminport Yes 9999 10009

Node Manager Port s_nmport Yes 5556 5566

WLS Admin Server Port s_wls_adminport Yes 7001 7011

WLS oacore Application port s_wls_oacoreport Yes 7201 7211

WLS Forms Application Port s_wls_formsport Yes 7401 7411

WLS oafm Application Port s_wls_oafmport Yes 7601 7611

20

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

RUN PATCH

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

21

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemDuring Cutover File Systems Rotate

Oracle HTTP Server

WebLogic Server

File System 1

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

RUN PATCH

E Business Suite

Web Logic Admin Console

22

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

7201

7401

7601

8000

Oracle E-Business Suite 122 Architecture Dual File SystemSeparate Ports for Each File System with Common Web Entry Point

Oracle HTTP Server

WebLogic Server

File System 1

PATCH RUN

7001

oacore_server1

forms_server1

oafm_server1

Admin Server

7211

7411

7611

8000 Oracle HTTP Server

WebLogic Server

File System 2

7011

oacore_server1

forms_server1

oafm_server1

Admin Server

E Business Suite

Web Logic Admin Console

23

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WLS Domain

Why add managed servers

bull Meet load and user concurrency requirements~100-150 concurrent users per JVM

oacore jvm heap M= (N 150 ) 1 GBwhere M = total memory used by oacore VMs

N = total number of concurrent Self-Service users

Use one JVM per 1-2 CPUs (dependent on the CPU speed)

bull Provide redundancy

bull Add services to an existing node

Adding WLS Managed Servers in the EBS ClusterApplication Tier ndash Scale Up

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

24

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle (adop phase=prepare) will synchronize the PATCH file system by adding the new managed server

What to Know

bull Syntax for adProvisionEBSpl

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=ltMANAGED_SERVER_NAMEgt

-servicetype=ltSERVICE_TYPEgt

-managedsrvport=ltMANAGED_SERVER_PORTgt

-logfile=ltLOGFILEgt

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

25

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Vertical Scaling Add WLS Managed Servers

bull Add to any of the managed servers in the Oracle E-Business Suite WLS Domain oacore oafm and forms

bull Add using the Oracle E-Business Suite 122 provisionerAPI adProvisionEBSpl

bull Execute adProvisionEBSplon the RUN File System when there is no active Online Patching cycle

bull Follow naming convention which must be unique for the WLS Domain ltservice_typegt_serverltngt

bull Verify port numbers are FREE and UNIQUE across the RUN and PATCH file systems and the node

bull The next Online Patching Cycle will synchronize the PATCH file system by adding the new managed server

What to Know

bull Example add lsquooacore_server2rsquo of type oacore with port 7203

perl

$AD_TOPpatch115binadProvisionEBSpl

ebs-create-managedserver

-contextfile=ltCONTEXT_FILEgt

-managedsrvname=oacore_server2

-servicetype=oacore

-managedsrvport=7203

-logfile=ltAPPLRGFgtTXKaddMSoacore_server2log

What to Do

Section 441 Adding a New Managed Server MOS Doc ID 19055931

26

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite Application NodeApplication Tier Scale Out Add a Node and Managed Servers

Node 1

WLS DomainAdmin Server

Node 2

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server2

forms_server2

oafm_server2

27

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application NodesFile System Configuration Distributed or Shared

FilesystemConfiguration

Distributed

Shared

Section 53 Adding a New Application Tier Node to an Existing System

MOS Doc ID 13836211

Overview of Stepsbull Configure shared filesystem for

sharingbull Mount filesystem on new nodebull Perform configuration steps to

add the new node

Section 4 Adding a Node to the Shared Application Tier File System

MOS Doc ID 13757691

Overview of Stepsbull Prepare the PATCH and RUN

filesystemsbull Copy the RUN filesystems to the

new nodebull Configure the PATCH and RUN

filesystemsbull Register the new topologybull Finalize service configuration

Start Here

28

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

bull Copy the sample pairsfile to a new directory and file name For example$cd $INST_TOPappladmin

$cp $CONTEXT_NAMEtxt install_basepairsfilepatchmynewpairsfiletxt

bull Update values for specific parameters for the node being added The updated pairsfile is referenced by configuration commands

bull Make sure that the RUN and PATCH Port Pools are unique For examples_port_pool=0

patch_s_port_pool=10

Note The value of s_port_pool should match the $RUN_BASE port pool and need not be updated

Pairs File Configuration for Distributed and Shared File Systems

29

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Instance Specific]

Please provide values for the context variables listed below On the source

instance they are instantiated as shown in the comment section below

These values should only be used as reference to fill out the instance

values for the new node

s_temp=[temp_directory]

s_contextname=[context_name_for_new_node]

s_hostname=[new_node_name]

s_domainname=usexampledomaincom

s_cphost=[new_node_name]

s_webhost=[new_node_name]

s_config_home=[INST_TOP]

s_inst_base=[install_base]

s_display=[new_node_name]00

s_forms-c4ws_display=[new_node_name]00

s_ohs_instance=EBS_web_ltSIDgt_OHS[n]

s_webport=8000

s_http_listen_parameter=8000

s_https_listen_parameter=4443

Pairs File Configuration for Distributed and Shared File Systems ndash Instance

30

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Add Oracle E-Business Suite 122 Application Nodes

[Services]

Please provide values for the context variables listed below

Enter enabled without the quotes to enable the service on the new node

Enter disabled without the quotes to disable the service on the new node

The Root service include the Node Manager

The Web Application Services include the Node Manager Admin Server

Managed Servers ( oacore forms oafm formsc4-ws)

s_web_applications_status=enabled

s_web_entry_status=enabled

s_apcstatus=enabled

s_root_status=enabled

s_batch_status=enabled

s_other_service_group_status=disabled

s_adminserverstatus=disabled

s_web_admin_status=disabled`

Pairs File Configuration for Distributed and Shared File Systems - Services

31

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

Set s_shared_file_system=false

Set s_atName to the hostname of the node being added

Shared Application Tier File System

Set s_shared_file_system=true

Set s_atName to the primary node across all nodes

Set user id and group id the same across all nodes

Set absolute path of the shared file system mount point the same across all nodes

32

Add Oracle E-Business Suite 122 Application NodesPairs File Configuration

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Distributed File System

bull Configure RUN and PATCH file systems with a single command with dualfs (not currently default option)

$perl adcfgclonepl

component=appsTier

pairsfile=ltPAIRSFILEgt addnode=yes

dualfs=yes

Shared Application Tier File System

bull Execute adclonectxutility to configure both RUN and PATCH file system with dualfs (not currently default option)

$export PATH=

$IAS_ORACLE_HOMEperlbin$PATH

$perl adclonectxpl addnode

contextfile=$CONTEXT_FILE

pairsfile=install_basemypairsfiletxt

dualfs=yes

33

Add Oracle E-Business Suite 122 Application NodesUse Latest Feature to Add the Node

dualfs available as of AD-TXK Delta 7 Latest available AD-TXK Delta 10 R12ADCDelta10 (25820806) R12TXKCDelta10 (25828573)

MOS Doc ID 16174611

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ArchitectureApplication Tier Scale Up and Scale Out

Node 1

Admin Server

oacore_server1oacore_cluster 1

forms_server1forms_cluster 1

oafm_server1oafm_cluster 1

oacore_server3

forms_server3

oafm_server3

Node 2

WLS Domain

oacore_server2

forms_server2

oafm_server2

oacore_server4

forms_server4

oafm_server4

34

Node Manager Node Manager

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Delete an Oracle E-Business Suite Application Tier Node

bull If the application tier node is accessible and needs to be deleted execute the following on the node that is being deleted

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node -

contextfile=$CONTEXT_FILE -logfile=dellog

bull If the application tier node is not accessible and needs to be deleted execute the following on the primary node

$perl $AD_TOPpatch115binadProvisionEBSpl ebs-delete-node

-contextfile=$CONTEXT_FILE -hostname=ltHOSTNAME OF NODE TO BE DELETEDgt

-logfile=ltLOG_FILEgt

35

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

36

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalsh ndashmode=allnodes

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Server adadminsrvctlsh [start | stop | abort |]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

RUN Filesystem

37

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Starting and Stopping Services

Service Group Service(s) Service Control Script

NAAll Application Tier Services

on All Nodesadstrtalshndashmode=allnodes forcepatchfs

NAAll Application Tier Services

on All Nodesadstpallsh ndashmode=allnodes forcepatchfs

Web Entry Point ServicesOracle HTTP Server

Oracle Process Manageradapcctlsh [start | stop] |

adopmnctlsh [start | stop | status]

Root Service Node Manager adnodemgrctlsh [start | stop ]

Web Administration WebLogic Admin Serveradadminsrvctlsh [start forcepatchfs | stop forcepatchfs |

abort forcepatchfs|]

Web Application Servicesoacoreoafmforms

admanagedsrvctlsh [stop| start] ltmanaged_server_namegt

PATCH Filesystem

38

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the WebLogic Admin Password

bull Use the EBS defined process for changing the WLS Administration User password

bull Changing the WebLogic Admin password requires downtime

bull Change the password from the RUN file system when there is NO active Online Patching Cycle

bull The perl script txkUpdateEBSDomainpl with the action updateAdminPassword will prompt for the context file current WLS Admin password new WLS Admin password and the APPS password

What to Know

Step 1 On the Admin Server stop all application tier services EXCEPTthe Node Manager and the Admin Server

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashskipNM -skipAdmin

Step 2 In a multi-node environment run the following command on all secondary nodes (conditional)

$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh

Step 3 On the Admin Server run the following

$perl FND_TOPpatch115bintxkUpdateEBSDomainpl

-action=updateAdminPassword

Step 4 Restart all services on all nodes with the following

$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Setup Guide Changing the Oracle WebLogic Server Administration User Password

39

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Changing the APPS Password

bull Use the EBS defined process for changing the APPSpassword

bull Changing the APPS password requires downtime

bull You can use either AFPASSWD (recommended) or FNDCPASS

bull The command used will change the APPS APPLSYS and APPS_NE

bull After you change the password you MUST update the WLS Data Source

bull The final step is to run AutoConfig and then restart the applications

What to Know

Step 1 On the Admin Server stop all application tier services$EBSAPPSenv run

$$ADMIN_SCRIPTS_HOMEadstpallsh ndashmode=allnodes

Step 2 Execute AFPASSWD to change the APPS password$ AFPASSWD ndashC APPS -s APPLSYS

Step 3 Start the admin server and update the WLS Data Source$ $INST_TOPadminscriptsadadminsrvctlsh

$ perl

$FND_TOPpatch115bintxkManageDBConnectionPoolpl

Note When prompted select updateDSPassword

Step 4 Run autoconfig$sh ltINST_TOPgtadminscriptsadautocfgsh

Step 5 Restart all services on all nodes with the following$adstrtalsh ndashmode=allnodes

What to Do

Oracle E-Business Suite Maintenance Guide

40

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code level Checker (ETCC)

Ensures that required database and application tier bug fixes have been applied to your Oracle E-Business Suite Release 122 environment

Database Code Level Checker

Identifies database tier technology stack patches required by EBS 122

Application Tier Code Level Checker

Identifies application tier technology stack patches required by EBS 122

Application Tier

Forms 1012

OHS

Oracle Common

WebLogic

fs1 fs2

Application TOPs

Forms 1012

OHS

Oracle Common

WebLogic

Application TOPs

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

EBS Technology Code Level Checker (ETCC)

bull ETCC can be downloaded via Patch 17537119 from My Oracle Support

bull Oracle strongly recommends the use of this utility to ensure that all required database and middle tier bugfixes have been installed

bull Database EBS Technology Codelevel Checker (DB-ETCC)ndash checkDBpatchsh

bull Middle Tier EBS Technology Codelevel Checker (MT-ETCC)ndash checkMTpatchsh

42

MOS Doc ID 15942741

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Webtier amp Utilities (OHS)FMW Common

Oracle E-Business Suite 122 Fusion Middleware HomeDirectory Structure Under [install_base]FS1 and [install_base]FS2

FMW_Home

logs modules wlserver_103webtieroracle_common Patch_wls1036 User_projects Oracle_EBS-app1

WLS

43

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetCommonenv

Patch Inventory Command

$ opatch lsinventory

Change Directory

$cd $FMW_HOMEutilsbsu

Patch Inventory Report

$ bsush -report

-bea_home=$FMW_HOME

-output_format=texWeb Tier amp Utilities (OHS)

Set Environment (ORACLE_HOME amp Path)

$ $FMW_HOMESetWebtierenv

Patch Inventory Command

$ opatch lsinventory

Set Environment (ORACLE_HOME amp Path)

$ source EBSappsenv PATCH

Patch Inventory Command

$ opatch lsinventory

EBS FMW 11g Environment amp Patch Inventory Commands

FMW Common WebLogic Server

Web Tier amp Utilities (OHS) Forms and Reports Server

44

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

45

Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Know

bull Prepare the PATCH file system

bull Apply technology stack patches to PATCH file system

bull Apply EBS patches (optional)

bull Coordinate time for CUTOVER and complete the online patching cycle

bull Synchronize the technology stack patches between the RUN and PATCH file systems

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

FS Clone

Finalize

46

Application Tier ndash Dual File System

Applying Application Tier Technology Stack Updates

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Online PatchingCycle

Apply

Cutover

Cleanup

PatchPrepare

Apply

Finalize

Cutover

Cleanup

Prepare$FMW_HOMESetCommonenv

$ opatch apply

fs1 fs2

Oracle E-Business Suite Release 122

FMW HomeOracle CommonWebtier (OHS)Web Logic Server

1012

Oracle Common $FMW_HOMESetCommonenv

$ opatch applyWebtier (OHS)

$ cd $FMW_HOMEutilsbsu

$ bsush

Web Logic Server

$EBSappsenv

$ opatch apply1012

Synchronize

$adop phase=fs_clone

Synchronize

Prepare

Apply

Finalize

Cutover

Cleanup

FS CloneFS Clone

Run

Oracle CommonWebtier (OHS)Web Logic Server

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

47

Oracle FMW Common for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching and set the ORACLE_HOME

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetCommonenv

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

48

Webtier amp Utilities (OHS) for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Set environment and apply patches to the PATCH file system$ $FMW_HOMESetWebtierenv

$ cd [patch_directory]

$ opatch apply

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches between the RUN and PATCH file systems

$ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

source ltEBS_ROOTgtEBSappsenv3 run

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Applying Application Tier Technology Stack Updates

49

WebLogic Server for Oracle E-Business Suite 122

bull Application tier technology stack updates can be

ndash Applied to the PATCH file system while EBS is online

ndash Applied in conjunction with an EBS Online Patching cycle

or

ndash Applied as a separate Online Patching exercise

bull You should follow the instructions in the Patch README

bull A full re-clone must be performed after applying Application tier patches to synchronize the RUN and PATCH file systems

What to Knowbull Prepare the instance for patching

$ source EBSappsenv PATCH

$ adop phase=prepare

bull Apply WLS patches to the PATCH file system$ cd $FMW_HOMEutilsbsu

$ bsush

-prod_dir=$FMW_HOMEwlserver_103

-patchlist=ltpatchID1gt -verbose -install

bull Apply EBS patches (optional)$ adop phase=apply inputfile=myinputfile

bull Complete the Online Patching cycle$ adop phase=finalize

$ adop phase=cutover

$ source EBSappsenv RUN

$ adop phase=cleanup

bull Synchronize technology patches for the RUN and PATCH file systems $ adop phase=fs_clone

What to Do

Confidential ndash Oracle Internal

MOS Doc ID 13550681

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

50

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122Where to Perform OHS amp WLS Configuration Changes

Oracle Application Manager amp Autoconfig

Fusion Middleware Controlhttphostnamedomainadmin_portem

WLS Administration Consolehttphostnameadmin_portconsole

Oracle HTTP Server

Performance directives log configuration ports mod_perl mod_wl_ohs etc

WLS Admin Server

Initialization parameters All other parameters

WLS Managed Server

All parameters for oacore oafm and forms services

MOS Doc ID 19055931

51

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle E-Business Suite 122 ConfigurationWhen to Perform OHS amp WLS Configuration Changes

bull If a Patching Cycle is not open

ndash Perform Configuration Changes in Run-Edition File Systembull Otherwise changes done in Patch Edition will be lost after patching

bull If a Patching Cycle is open

ndashWait for patching cycle to finishbull Perform configuration changes in the Run Edition file system after

Cutover otherwise changes done will be lost

bull If there are post-patch configuration changes needed perform them in the Run-Edition File System after cutover

Developer 1012

COMMON_TOP

APPL_TOP

INST_TOP

Oracle HTTP Server (OHS)

WebLogic Server (WLS)

Run File System

52

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Update limited set of configuration files with AutoConfig

bull Update all other seeded configurations using Fusion Middleware Control

httphostnamedomainadmin_portem

bull Edit the relevant file and parameters

bull Synchronize the changes with adSyncContextpl

bull Update to the PATCH file system will happen with the next patching cycle (adop phase=prepare)

53

Oracle HTTP Server Configuration

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic AdminServer ConfigurationUpdating the Classpath and JVM Arguments

bull Classpath and JVM arguments are read from context variables upon startup of the WLS Admin Server

bull To update edit the following context variablesndash s_adminserver_classpath

ndash s_nm_jvm_startup_properties

54

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

WebLogic Server ConfigurationUpdating the Classpath and JVM Arguments

bull Go to WebLogic server Administration Console

bull Select Configuration Server Start

bull Click Lock amp Edit

bull Edit parameters

bull Click Release Configuration

bull Next Online Patching cycle will update Patch file system

55

MOS Doc ID 19055931

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Architecture

Administration and Maintenance

Configure

Monitor and Troubleshoot

1

2

3

4

56

Program Agenda

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Log File Locations

bull Oracle HTTP Serverndash $IAS_ORACLE_HOMEinstancesltOHS_INSTANCEgtdiagnosticslogsOHSEBS_web_ltSIDgt

bull WebLogic Serverndash $EBS_DOMAIN_HOMEserversAdminServerlogs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversforms_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoacore_server[n]logs

ndash $EBS_DOMAIN_HOMEserversoafm_server[n]logs

Note EBS_DOMAIN_HOME=$FMW_HOMEuser_projectsdomains[EBS_DOMAIN]

Oracle E-Business Suite 122

57

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Access Log

bull Default log file name access_log

bull All requests processed by OHS

bull Location and content are controlled by CustomLog directive in httpconf

bull Example from access_log

1721712244 - - [10Aug2015175352 -0400] GET pagejspp1=search

HTTP10 200 1197

Oracle E-Business Suite 122

58

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Oracle HTTP Server Error Log

bull Default log file name EBS_web_ltSIDgtlog

bull Key log file for the Oracle HTTP Server (OHS)

bull Apache httpd including ModSecurity will send diagnostic information and record any errors that it encounters in processing requests here

bull ModSecurity will log whenever it denies a request

bull Example of a blocked request[Tue May 12 001145 2015] [error] [cli ent 172171212]

mod_security Access denied with code 400 Pattern match at THE_REQUEST

[hostname appsexamplecom] [uri Ppath=] [unique_idVVF9gawReR8AAAVDA2M]

Oracle E-Business Suite 122

59

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

Service(s) Service Control Script

Oracle HTTP ServerOracle Process Manager

adapcctlsh status

adopmnctlsh status

Node Manager adnodemgrctlsh status

WebLogic Admin Server adadminsrvctlsh status

oacoreoafmforms

admanagedsrvctlsh status ltmanaged_server_namegt

Oracle E-Business Suite 122

60

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service Status

61

Execute Configuration Check Utility

bull Review the status of services on a node

bull HTML file is generated by the Check Config Utility

What to Know

bull For example

AD_TOPbinadchkcfgsh

bull Review the HTML output generated in the following

cfgcheckhtml

What to Do

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Check Service StatusExecute Configuration Check Utility

62

MOS Doc ID 3878591

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Monitor WLS Admin Server and Port

$ps ndashef | grep java

oracle 24386 24289 0 Feb28 000306

u01R122_EBSfs2EBSappscomnutiljdk64jrebinjava -

DweblogicName=AdminServer -Djavasecuritypolicy=

$ss ndashl ndashp ndashn | grep 24386

0 0 ffff10210441107001

users((java24386792))

Note WLS Admin Server Port is also located in the context variable s_wls_adminport

Command Line

63

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Use WebLogic Console to monitor JDBC connections

ndash Navigation Services (Tree Link) Data Sources (Tree Link) EBSDataSource (Page Link) Monitoring (Tab)

bull Turn on Diagnostics

ndash Level 1 ndash minimally invasive

ndash Level 2 - increased memory requirements and may affect performance

64

Data Source Connection Pool Diagnostics

MOS Doc ID 19409961

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Provides features designed to aid in detecting diagnosing and resolving problems

bull Enabled by default with EBS 122

bull Automatically captures set of diagnostics and creates an incident

bull Incidents can be packaged with ADR Command Interpreter (ADCRI)

65

Oracle Fusion Middleware Diagnostic Framework

MOS Doc ID 14280561

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Utility designed to aid in monitoring and troubleshooting EBS 122 WLS

66

Oracle Support WLS (WebLogic Server) Utility

MOS Doc ID 22302251

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Developed and maintained by Oracle Support

bull Documentation to aid troubleshooting connections issues for EBS 122

67

Oracle Support Summary of EBS Login

MOS Doc ID 19847101

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Same blog new URL

Note blogsoraclecomstevenchan will automatically redirect to blogsoraclecomebstech

bull News about EBS Technology

bull Certification announcements

bull Quarterly upgrade recommendations

bull Primers FAQs tips

bull Statements of Direction

bull Desupport reminders

Subscribe via RSS or email

68

Blog Oracle E-Business Suite Technology Bloghttpsblogsoraclecomebstech (previously blogsoraclecomstevenchan)New

URL

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Questions

69Copyright copy 2016 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Chronological Order

70

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71Copyright copy 2019 Oracle andor its affiliates All rights reserved | 71

Related SessionsSunday April 7 2019

1230 pmIntegration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

1230 pmTesting Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

145 pmGetting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

145 pmExtend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72Copyright copy 2019 Oracle andor its affiliates All rights reserved | 72

Related SessionsSunday April 7 2019

300 pmRunning Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73Copyright copy 2019 Oracle andor its affiliates All rights reserved | 73

Related SessionsMonday April 8 2019

915 amORS Oracle E-Business Suite Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A

1030 amOracle E-Business Suite Whatrsquos New in Release 122 Beyond Online Patching - [11276]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon A

1030 amORS Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74Copyright copy 2019 Oracle andor its affiliates All rights reserved | 74

Related SessionsMonday April 8 2019

315 pmMTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

430 pmWhat Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75Copyright copy 2019 Oracle andor its affiliates All rights reserved | 75

Related SessionsTuesday April 9 2019

1030 amMTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

430 pmMigrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76Copyright copy 2019 Oracle andor its affiliates All rights reserved | 76

Related SessionsWednesday April 10 2019

800 amORS Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap - [11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

915 amPlanning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

915 amDeploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

1245 pmTechnical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77Copyright copy 2019 Oracle andor its affiliates All rights reserved | 77

Related SessionsWednesday April 10 2019

200 pmOracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

330 pmTurbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 3 -

Booth 900

430 pmMTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78Copyright copy 2019 Oracle andor its affiliates All rights reserved | 78

Related SessionsThursday April 11 2019

800 amPersonalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

800 amTechnical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

800 am11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

915 am

Oracle E-Business Suite 122 Fusion Middleware (WebLogic Server) Administration ndash[11306]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Related Sessions - Ordered by Theme

79

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80Copyright copy 2019 Oracle andor its affiliates All rights reserved | 80

Related SessionsStrategy and Roadmap

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81Copyright copy 2019 Oracle andor its affiliates All rights reserved | 81

Related SessionsCloud

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

SundayApril 7

145 pm

Extend Oracle E-Business Suite with Oracle SaaS Applications Your Journey to the Cloud - [11275]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

SundayApril 7

300 pm

Running Your Oracle E-Business Suite on Oracle Cloud Infrastructure - Why What and How - [11274]Nadia Bendjedou Vice President Product Strategy Oracle E-Business Suite Oracle

GH 4TH FL Texas Salon C

MondayApril 8

915 am

Oracle E-Business Suite ndash Update Strategy and Roadmap - [11273]Clifford Godwin Sr Vice President Oracle

GH 4TH FL Texas Salon A amp C

MondayApril 8

1030 am

Oracle E-Business Suite Technology Updates and Roadmap Cloud Usability Mobile amp More - [11296]Lisa Parekh Vice President Technology Integration Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82Copyright copy 2019 Oracle andor its affiliates All rights reserved | 82

Related SessionsCloud

MondayApril 8

430 pm

What Why and How you Can Benefit from Oracle Cloud at Customer - [11309]Vasu Rao Director Product Strategy Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10

1245 pm

Technical Essentials for Running Oracle E-Business Suite on Oracle Cloud - [11297]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

WednesdayApril 10330 pm

Turbo Talk Oracle E-Business Suite Cloud Manager (OCI) - [11411]Veshaal Singh Vice President Oracle E-Business Suite Development Oracle

CC STREET FL Exhibit Hall 34

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83Copyright copy 2019 Oracle andor its affiliates All rights reserved | 83

Related SessionsCloud

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84Copyright copy 2019 Oracle andor its affiliates All rights reserved | 84

Related SessionsInstallation and Architecture

WednesdayApril 10915 am

Deploying Oracle E-Business Suite for On-Premises and Oracle Cloud ndash [11301]Santiago Bastidas Product Management Director Oracle E-Business Suite Development OracleUlhas Pinjarkar Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85Copyright copy 2019 Oracle andor its affiliates All rights reserved | 85

Related SessionsIntegration

SundayApril 7

1230 pm

Integration Options for On-Premises and Cloud with Oracle E-Business Suite - [11300]Rekha Ayothi Principal Product Manager Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86Copyright copy 2019 Oracle andor its affiliates All rights reserved | 86

Related SessionsPatching and Customizations

TuesdayApril 9

200 pm

Strategies for Maintenance and Online Patching for Oracle E-Business Suite 122 -[11303]Kevin Hudson Senior Director Oracle E-Business Suite Development OracleElke Phelps Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

TuesdayApril 9

430 pm

Migrating and Managing Customizations for Oracle E-Business Suite 122 - [11305]Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87Copyright copy 2019 Oracle andor its affiliates All rights reserved | 87

Related SessionsPerformance

SundayApril 7

145 pm

Getting Optimal Performance from Oracle E-Business Suite - [11304]Samer Barakat Senior Director Applications Performance Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88Copyright copy 2019 Oracle andor its affiliates All rights reserved | 88

Related SessionsSystem Management

ThursdayApril 11800 am

11299 - Managing and Monitoring Oracle E-Business Suite On-Premises and CloudAngelo Rosado Product Management Director Oracle E-Business Suite Development

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89Copyright copy 2019 Oracle andor its affiliates All rights reserved | 89

Related SessionsTesting

SundayApril 7

1230 pm

Testing Oracle E-Business Suite Best Practices - [11308]Gopalakrishnan Raghavan Senior Director EBS Quality Assurance Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90Copyright copy 2019 Oracle andor its affiliates All rights reserved | 90

Related SessionsUpgrade

WednesdayApril 10915 am

Planning Your Oracle E-Business Suite Upgrade from Release 121 - [11277]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon A

ThursdayApril 11800 am

Technical Upgrade Best Practices for Oracle E-Business Suite 122 ndash [11298]Samer Barakat Senior Director Applications Performance OracleUdayan Parvarte Senior Director Release Management Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91Copyright copy 2019 Oracle andor its affiliates All rights reserved | 91

Related SessionsUsability and Mobility

WednesdayApril 10800 am

Oracle E-Business Suite User Experience and Mobile Update Strategy and Roadmap -[11278]Jeanne Lowell Vice President Product Strategy Oracle

GH 4TH FL Texas Salon C

ThursdayApril 11800 am

Personalize and Extend Oracle E-Business Suite for Desktops and Mobile Devices -[11302]Maher Muhanna Group Manager Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92Copyright copy 2019 Oracle andor its affiliates All rights reserved | 92

Related SessionsHands-On-Lab

SundayApril 7

145 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11382] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

MondayApril 8

315 pm

HOLS Hands-On-Lab Oracle E-Business Suite Cloud Manager Deployment Configuration and Review of EBS Lifecycle Management Capabilities - [11383] Santiago Bastidas Product Management Director Oracle E-Business Suite Development Oracle Elke Phelps Product Management Director Oracle E-Business Suite Development Oracle

CC 1ST FL 007D

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93Copyright copy 2019 Oracle andor its affiliates All rights reserved | 93

Related SessionsMeet the Experts

MondayApril 8

315 pm

MTE Meet the Experts Oracle E-Business Suite Upgrades Best Practices -[11372]J Anne Carlson Senior Director Applications Product Strategy Oracle

GH 4TH FL Texas Salon B

TuesdayApril 9

1030 am

MTE Meet the Experts Oracle E-Business Suite Technology Stack - [11371]Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

WednesdayApril 10430 pm

MTE Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure - [11373]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon B

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94Copyright copy 2019 Oracle andor its affiliates All rights reserved | 94

Related SessionsPanel

MondayApril 8

430 pm

Applications Database Tuning Panel ndash [10940]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

WednesdayApril 10200 pm

Oracle E-Business Suite on the Oracle Cloud Infrastructure Customer and Partner Success Stories ndash [11307]Terri Noyes Senior Director Product Management Oracle E-Business Suite Development Oracle

GH 4TH FL Texas Salon C

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95Copyright copy 2019 Oracle andor its affiliates All rights reserved | 95

Related SessionsSIGs

SundayApril 7

1230 pm

Workflow SIG Panel Current Future and Cloud ndash [11164]Rusty Schmidt Senior Systems Engineer University of Phoenix

GH 4TH FL Republic A

SundayApril 7

145 pm

APEX In EBS SIG Panel on How Clients use APEX for Their EBS Environments ndash [10859]Chad Johnson DBA Polk County Florida BoCC

Sylvain Martel EBS-APEX Practice Director InsumJohn Peters Jr Principal Consultant JRPJR Inc

GH 4TH FL Republic A

SundayApril 7

300 pm

OAUG SysAdmin SIG ndash [10985]James Morrow Consultant BlueStone Solutions Group Inc

GH 4TH FL Republic A

MondayApril 8

1030 am

Upgrade SIG Meeting ndash [10903]Andrew Katz Director of IT Komori America CorporationSandra Vucinic Oracle Applications DBA VLAD Group Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96Copyright copy 2019 Oracle andor its affiliates All rights reserved | 96

Related SessionsSIGs

MondayApril 8

315 pm

OAUG Database SIG ndash [10688]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

TuesdayApril 9

1030 am

OAUG E-Business Suite Security SIG -- On-Premise and Cloud Security ndash [10775]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC Inc

GH 4TH FL Republic A

TuesdayApril 9

1245 pm

OAUG Archive amp Purge SIG ndash [10885]Michael Barone Oracle E-Business Suite ArchitectDBA OATC IncMike Miller OATC IncBrian Bent Principal Solutions Engineer Delphix

Mark Lee Sr Vice President of Services Solix Technologies Inc

GH 4TH FL Republic A

TuesdayApril 9

200 pm

OAUG Customizations amp Alternatives Special Interest Group ndash [10810]Bill Dunham Principal OATC Inc

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97Copyright copy 2019 Oracle andor its affiliates All rights reserved | 97

Related SessionsSIGs

TuesdayApril 9

200 pm

ADI (Desktop Integrator) SIG Meeting ndash [10859]Lee Briggs ERP Solution Architect Creoal Consulting LLC

GH 4TH FL Crockett D

TuesdayApril 9

430 pm

OAUG Mobile SIG for Enterprises ndash Collaboration ndash [10890]Manjula Ganapathi Operations LeadSolution Architect Johns Hopkins Univ Applied Physics LabGustavo Gonzalez Chief Technology Officer IT Convergence

GH 4TH FL Republic A

WednesdayApril 10915 am

EBS Applications Technology Stack SIG ndash [10905]Michael Barone Oracle E-Business Suite ArchitectDBA OATC Inc

GH 4TH FL Republic A

WednesdayApril 10

1030 am

OAUG Advanced Architecture and High Availability SIG ndash [10933]Michael Brown Database Administrator BlueStar

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98Copyright copy 2019 Oracle andor its affiliates All rights reserved | 98

Related SessionsSIGs

ThursdayApril 11915 am

OEM OMC Oracle Enterprise Manager and Management Cloud for Applications EM4APPS SIG ndash [10684]Erik Benner Mythics IncJames Lui Principal DBA Team Lead Metropolitan Water District of Southern California

GH 4TH FL Republic A

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Meet the Experts Demos

99

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 100

11372 - Meet the Experts Oracle E-Business Suite Upgrades Best Practices

Monday April 8 2019315 PM

GH 4TH FL Texas Salon B

J Anne Carlson Senior Director Product Strategy

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 101

11371 - Meet the Experts Oracle E-Business Suite Technology Stack

Tuesday April 9 20191030 AM

GH 4TH FL Texas Salon B

Lisa Parekh Vice President Technology Integration Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 102

11373 - Meet the Experts Running Oracle E-Business Suite on Oracle Cloud Infrastructure

Wednesday April 10 2019430 PM

GH 4TH FL Texas Salon B

Terri Noyes Senior Director Product Management Oracle E-Business Suite Development

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved |

bull Advanced Architecture

bull Configuration

bull Lift and Shift Cloning

bull Mobile Applications

bull Online Patching

bull One-Click Provision Installation

bull Patching the Technology Stack

bull Performance

bull System Administration

bull Applications Management Pack

bull Upgrades

bull User Interface

103

DemoGroundsOracle E-Business Suite Tools and Technology

for Cloud and On-Premises

Booth 2000 Exhibit Hall 3 Convention CenterMonday April 9 530-730 PM

Tuesday April 10 915 AM-315 PM 530-730 PMWednesday April 11 1130 AM-415 PM

Copyright copy 2019 Oracle andor its affiliates All rights reserved |

Copyright copy 2019 Oracle andor its affiliates All rights reserved |Copyright copy 2019 Oracle andor its affiliates All rights reserved | 105