Post on 24-Jun-2020
i
CELL-PENETRATING PEPTIDES; CHEMICAL MODIFICATION,
MECHANISM OF UPTAKE AND FORMULATION DEVELOP-
MENT
Kariem Ezzat
ii
iii
Cell-penetrating peptides; chemical
modification, mechanism of uptake
and formulation development
Kariem Ezzat
iv
©Kariem Ezzat, Stockholm 2012
ISBN 978-91-7447-464-0
Printed in Sweden by Universitetetsservice US-AB, Stockholm 2012
Distributor: Department of Neurochemistry, Stockholm University
v
To my family
vi
vii
List of publications
This thesis is based on the following publications referred to in text as
paper I, paper II, paper III and paper IV.
I. Lehto, T., Simonson, O. E., Mäger, I., Ezzat, K., Sork, H.,
Copolovici, D. M., Viola, J. R., Zaghloul, E. M., Lundin, P.,
Moreno, P. M., Mäe, M., Oskolkov, N., Suhorutsenko, J., Smith,
C. I., and El Andaloussi, S. (2011) A peptide-based vector for
efficient gene transfer in vitro and in vivo. Mol. Ther., 19,
1457-1467.
II. Ezzat, K., El Andaloussi, S., Zaghloul, E. M., Lehto, T., Lind-
berg, S., Moreno, P. M., Viola, J. R., Magdy, T., Abdo, R., Guter-
stam, P., Sillard, R., Hammond, S. M., Wood, M. J., Arzumanov,
A. A., Gait, M. J., Smith, C. I., Hällbrink, M., and Langel, Ü.
(2011) PepFect 14, a novel cell-penetrating peptide for oligo-
nucleotide delivery in solution and as solid formulation. Nu-
cleic Acids Res., 39, 5284-5298.
III. Ezzat,K., Helmfors,H., Tudoran,O., Juks,K., Lindberg,S.,
Padari,K., El Andaloussi,S., Pooga,M., and Langel,Ü. (2012)
Scavenger receptor-mediated uptake of cell-penetrating pep-
tide nanoparticles with oligonucleotides. FASEB J., 3, 1172-80.
IV. Ezzat, K., Zaghloul, E. M., El Andaloussi, S., Lehto, T., Hilal
R., Magdy, T., Smith,C. I., Langel,Ü. Solid formulation of cell-
penetrating peptide nanoparticles with siRNA and their sta-
bility in simulated gastric conditions. Resubmitted to J. Con-
trol. Release.
viii
Additional publications
1. Lehto,T., Abes,R., Oskolkov,N., Suhorutsenko,J., Copolovi-
ci,D.M., Mäger,I., Viola,J.R., Simonson,O.E., Ezzat,K., Gu-
terstam,P., et al. (2010) Delivery of nucleic acids with a stea-
rylated (RxR)4 peptide using a non-covalent co-incubation
strategy. J. Control. Release, 141, 42-51.
2. El Andaloussi,S., Lehto,T., Mäger,I., Rosenthal-Aizman,K.,
Oprea,I.I., Simonson,O.E., Sork,H., Ezzat,K., Copolovi-
ci,D.M., Kurrikoff,K., et al. (2011) Design of a peptide-based
vector, PepFect6, for efficient delivery of siRNA in cell cul-
ture and systemically in vivo. Nucleic Acids Res., 39, 3972-
3987.
3. Ezzat,K., El Andaloussi,S., Abdo,R., and Langel,Ü. (2010)
Peptide-based matrices as drug delivery vehicles. Curr.
Pharm. Des., 16, 1167-1178. Review.
4. Lehto,T., Ezzat.K., and Langel,Ü. (2011) Peptide nanoparti-
cles for oligonucleotide delivery. Prog. Mol. Biol. Transl.
Sci., 104, 397-426. Book chapter.
Patent application
Kariem Ezzat Ahmed, El Andaloussi,S., Guterstam,P., Häll-
brink, M., Johansson,H., Langel,Ü, Lehto,T., Lindgren,M.,
Mäger, I., Sillard, R., Rosenthal-Aizman,K., Tedebark,U and
Lundin,P. (2010) Chemically modified cell-penetrating pep-
tides for improved delivery of gene modulating com-
pounds. WO2010039088.
ix
Abstract
Gene therapy holds the promise of revolutionizing the way we treat
diseases. By using recombinant DNA and oligonucleotides (ONs), gene
functions can be restored, altered or silenced according to the therapeutic
need. However, gene therapy approaches require the delivery of large
and charged nucleic-acid based molecules to their intracellular targets
across the plasma membrane, which is inherently impermeable to such
molecules. In this thesis, two chemically modified cell-penetrating pep-
tides (CPPs) that have superior delivery properties for several nucleic
acid-based therapeutics are developed. These CPPs can spontaneously
form nanoparticles upon non-covalent complexation with the nucleic acid
cargo, and the formed nanoparticles mediate efficient cellular transfec-
tion. In paper I, we show that an N-terminally stearic acid-modified ver-
sion of transportan-10 (PF3) can efficiently transfect different cell types
with plasmid DNA and mediates efficient gene delivery in-vivo when
administrated intra muscularly (i.m.) or intradermaly (i.d.). In paper II, a
new peptide with ornithine modification, PF14, is shown to efficiently
deliver splice-switching oligonucleotides (SSOs) in different cell models
including mdx mouse myotubes; a cell culture model of Duchenne’s
muscular dystrophy (DMD). Additionally, we describe a method for in-
corporating the PF14-SSO nanoparticles into a solid formulation that is
active and stable even when stored at elevated temperatures for several
weeks. In paper III, we demonstrate the involvement of class-A scaven-
ger receptor subtypes (SCARA3 & SCARA5) in the uptake of PF14-SSO
nanoparticles, which possess negative surface charge, and suggest for the
first time that some CPP-based systems function through scavenger re-
ceptors. In paper IV, the ability of PF14 to deliver small interfering RNA
(siRNA) to different cell lines is shown and their stability in simulated
gastric acidic conditions is highlighted.
Taken together, these results demonstrate that certain chemical
modifications can drastically enhance the activity and stability of CPPs
for delivering nucleic acids after spontaneous nanoparticle formation
upon non-covalent complexation. Moreover, we show that CPP-based
nanoparticles can be formulated into convenient and stable solid formula-
tions that can be suitable for several therapeutic applications. Important-
ly, the involvement of scavenger receptors in the uptake of such nanopar-
ticles is presented in this thesis, which could yield novel possibilities to
understand and improve the transfection by CPPs and other gene therapy
nanoparticles.
x
Contents
1. Introduction .................................................................................. 1 1.1. Gene therapy ............................................................................ 2
1.1.1. Gene delivery .................................................................. 2 1.1.2. Silencing of disease causing genes .................................. 3 1.1.3. Modification of gene function ......................................... 5
1.2. Nanoparticles for non-viral gene delivery ............................... 6 1.2.1. Small molecules vs. nanoparticles; the uptake paradox .. 6 1.2.2. Nanoparticle-based vectors in gene-therapy ................... 9 1.2.3. Pharmacokinetics of nanoparticle-based systems for nucleic acid delivery .................................................................. 12
1.3. Cell-penetrating peptides (CPPs) ........................................... 16 1.3.1. History ........................................................................... 17 1.3.2. CPPs as drug delivery vehicles ..................................... 18 1.3.3. Uptake mechanism ........................................................ 22
1.4. Scavenger receptors (SRs) ..................................................... 26 1.4.1. Class A scavenger receptors (SCARAs) and nucleic acid binding…….. ............................................................................. 27
1.5. Pharmaceutical formulation ................................................... 29
2. Aims of the study ....................................................................... 31
3. Methodological considerations .................................................. 32 3.1. Solid phase peptide synthesis and peptide design .................. 32 3.2. Cell cultures ............................................................................. 33 3.3. Plasmid delivery (Paper I) ....................................................... 34 3.4. SSOs delivery (Paper II and III) .............................................. 34 3.5. siRNA delivery (Paper IV) ...................................................... 35 3.6. Toxicity ................................................................................... 35 3.7. Dynamic light scattering (DLS), nanoparticle tracking analysis (NTA) and zeta-potential ............................................................... 35 3.8. Solid dispersion and gastric simulation ................................... 36 3.9. Immunofluorescence and transmission electron microscopy (TEM) ............................................................................................. 37 3.10. Animal Experiments .............................................................. 38
4. Results and discussion ............................................................... 39 4.1. Delivery of plasmids via stearyl-TP10 (PF3) in-vitro and in-vivo (Paper I) .................................................................................. 39 4.2. Delivery of SSOs via PF14 and solid formulation development (Paper II) ................................................................... 40
xi
4.3. Scavenger receptor-mediated uptake of CPP nanoparticles with ONs (Paper III) ....................................................................... 42 4.4. Activity and solid formulation of PF14-siRNA nanoparticles and their stability in simulated gastric conditions (Paper IV) ........ 44
5. Conclusions ................................................................................ 47
6. Acknowledgements .................................................................... 48
7. References .................................................................................. 50
xii
Abbreviations
AMP
AntimiR BBB
CPP CQ CR DLS DMD GAPDH HPLC HPRT1 i.d i.m MBHA miRNA MR NTA ON
PAMPs PRRs
PCR PF
Poly I Poly G
qPCR RISC
RNAi RT-PCR SCARA
SGF SIF
siRNA SR
SSOs SSPS TFA TIS
Antimicrobial peptide Anti microRNA
Blood-brain barrier Cell-penetrating peptide Chloroquine Charge ratio Dynamic light scattering Duchenne’s muscular dystrophy Glyceraldehyde 3-phosphate dehydrogenase High performance liquid chromatography Hypoxanthine-guaninephosphoribosyl transferase Intradermal Intramuscular p-Methylbenzylhydralamine Micro RNA Molar ratio Nanoparticle tracking analysis Oligonucleotide Pathogen associated molecular patterns Pattern recognition receptor Polymerase chain reaction PepFect
Polyinosinic acid Polyguanilic acid Quantitative real-time PCR RNA-induced silencing complex RNA interference Reverse transcriptase PCR
Class A scavenger receptor Simulated gastric fluid Simulated intestinal fluid
Small interfering RNA Scavenger receptor
Splice-switching oligonucleotides Solid-phase peptide synthesis Trifluoroacetic acid Triisopropylsilane
xiii
1
1. Introduction
One of the major biomedical milestones in history was the com-
plete sequencing of the human genome (1), which has significantly
deepened our knowledge about the genetic causes of diseases. This led
to the emergence of several methods to interfere with disease patho-
physiology on the molecular genetics level, a field that can collective-
ly be called “gene therapy”. Using recombinant DNA and oligonucle-
otides (ONs), gene functions can be restored, altered or silenced ac-
cording to the therapeutic need. However, gene therapy approaches
require the delivery of extremely large and charged nucleic-acid based
molecules to their intracellular targets across the plasma membrane,
which is inherently impermeable to such molecules. Viral and non-
viral vectors have been developed to deliver gene therapies to their
target organs, tissues and subcellular compartments. Due to the limita-
tions and hazards of viral vectors, several non-viral drug delivery
technologies were developed in recent years mainly utilizing nanopar-
ticles as delivery vehicles (2). Despite a tremendous research invest-
ment, so far, no therapeutics based on such nanoparticles have reached
the market. Among the reasons for such a poor translational outcome
are:
1. The poor understanding of the molecular mechanisms of uptake
and biodistribution of nanoparticles.
2. The complex nature of the nanoparticle-based delivery systems,
which presents a manufactural and cost barrier for pharmaceutical
companies interested in their clinical development on large scale.
In this thesis, chemically modified cell-penetrating peptides
(CPPs) were developed, which are able to form nanoparticles with
plasmids, small interfering RNAs (siRNAs) and splice-switching ONs
(SSOs) upon non-covalent complexation and efficiently mediate their
cellular delivery. Importantly, special focus of this thesis work was
dedicated to the identification of the mechanism of uptake of such
2
nanoparticles and enhancing their translational potential via pharma-
ceutical formulation techniques.
1.1. Gene therapy
According to the American Society of Gene & Cell Therapy
(ASGCT), gene therapy is defined as “the introduction or alteration of
genetic material within a cell or organism with the intention of curing
or treating a disease” (3). Based on this definition gene therapy ap-
proaches can be roughly divided into 3 types according to their phar-
macological effect (Figure 1.):
Restoration of lost gene function by gene delivery via viral
vectors or plasmids (gene delivery). Silencing of disease causing genes by antigene, antisense or
RNAi (RNA interference) approaches. Modification of gene function by interfering with the splicing
machinery via splice-switching oligonucleotides (SSOs) or anti microRNAs (antimiRs)
1.1.1. Gene delivery
Loss of gene function is the cause of several heritable diseases
and cancers (4, 5). Thus, the delivery of functional genes that could
restore normal phenotype has been the ultimate goal of gene therapy
for decades (6). Viral vectors have been extensively utilized for gene
delivery; however, early promising results have been shadowed by
reports showing that viral insertional mutagenesis might lead to severe
leukemogenic side effects (7, 8, 9). Also, humoral immunity directed
against the viral vector particle is generally observed (10). Recently,
much progress has been accomplished in achieving clinical benefits
with viral vectors without serious side effects (11). However, safer
and efficient non-viral alternatives are still needed for the vast applica-
tions of gene delivery. Non-viral restoration of gene function can be
achieved by the delivery of plasmids carrying the desired gene. When
the plasmid enters the cell, it is transcribed and translated by the cellu-
lar machinery without the need of genome integration (Figure 1.).
Many nanoparticle-based vectors have been designed for this purpose
3
and this approach will be discussed in more detail in the following
sections.
1.1.2. Silencing of disease-causing genes
Another promising field of gene therapy is the ability to silence
disease-causing genes by utilizing ONs targeting complementary se-
quences on the DNA or the RNA levels. It can be achieved by differ-
ent methods including:
Non-catalytic blocking of certain DNA or RNA sequences
antigene and antisense. This approach relies on ONs that bind
complementary DNA (antigene) or RNA (antisense) sequenc-
es, sterically blocking the transcription or translation machin-
ery or mediating the degradation of the formed duplex via
RNase H.
Catalytic degradation of target mRNA siRNA. This ap-
proach relies on the recruitment of cellular machinery to cata-
lyze sequence-specific degradation of the target mRNA via the
RNA-induced silencing complex (RISC) complex.
1.1.2.1. Antigene and antisense
When the double-stranded DNA or genes situated in the nucleus
are targeted, the approach is called the antigene strategy (12). Howev-
er, when mRNA is the target; this is called the antisense strategy. An-
tisense activity can be achieved either by blocking the binding sites
for the 40S ribosomal subunit or by the formation of DNA/RNA du-
plexes that renders the RNA susceptible for RNase H digestion (12)
(Figure 1.). Despite the recruitment of RNase H, this strategy is not
catalytic because the antisense strand is also degraded in this reaction.
Natural DNA and RNA have been used for antigene and antisense
approaches together with several chemically modified analogues that
offer better annealing with target sequences and possess enhanced
serum stability. Examples of chemically modified ONs include: phos-
phorothioate DNA, 2’-O-methyl RNA (2’-OMe), locked nucleic acid
(LNA), peptide nucleic acid (PNA) and phosphorodiamidate morpho-
lino oligo (PMO) (13).
4
1.1.2.2. RNAi
RNAi is a fundamental pathway in eukaryotic cells, where long
pieces of double stranded RNA are cleaved by an enzyme called Dicer
into shorter fragments called siRNAs that mediate cleavage of com-
plementary mRNA sequences by the help of RISC (Figure 1.) (14,
15). The proof-of-principle study in 2001 demonstrating that synthetic
siRNA could mediate sequence-specific gene knockdown in mamma-
lian cells marked the birth of siRNA therapeutics (16). What makes
the siRNA approach more appealing than other silencing approaches
is that it cleaves target mRNA in a catalytic manner, i.e. the antisense
strand (guide strand) can recruit the RISC complex to degrade several
mRNA molecules having the complementary sequence without being
degraded itself. Thus, lower doses are required to achieve gene
knockdown compared to the conventional antisense approaches. That
is why intensive research has been carried out in the last decade to
develop delivery vectors for siRNA therapeutics (14).
Figure 1. Different gene therapy approaches. a. Viral delivery and ge-
nome integration. b. Plasmid delivery. c. Antisense steric block of trans-
lation d. Antisense DNA/RNA hybrid and RNase H degradation. e.
Antigene. f. Splice-switching ONs. g. siRNA. h. antimiR.
5
1.1.3. Modification of gene function
One of the most powerful applications of ON-based therapeutics
is their ability to modulate gene function. This can be achieved by
interfering with the splicing machinery (splice-switching) or by inter-
fering with the microRNA (miRNA) machinery using antimiRs.
1.1.3.1. Splice-switching therapeutics
Recent studies using high-throughput sequencing indicate that
95–100% of human pre-mRNAs have alternative splice forms (17).
Mutations that affect alternative pre-mRNA splicing have been linked
to a variety of cancers and genetic diseases, and SSOs can be used to
silence mutations that cause aberrant splicing, thus restoring correct
splicing and function of the defective gene (Figure 1.) (18, 19). SSOs
are antisense ONs ranging from 15 to 25 bases in length that do not
activate RNase H, which would destroy the pre-mRNA target before it
could be spliced (18, 19). One example of genetic diseases amenable
for SSO therapy that will be addressed in this thesis is Duchenne’s
muscular dystrophy (DMD). DMD is a neuromuscular genetic disor-
der that affects 1 in 3500 young boys worldwide (20). It is caused
mainly by nonsense or frame-shift mutations in the dystrophin gene.
SSOs are used to induce targeted ‘exon skipping’ in order to correct
the reading frame of mutated dystrophin pre-mRNA such that shorter,
partially-functional dystrophin forms are produced (21). SSOs target-
ing exon 51 are currently in human clinical trials in various parts of
Europe to treat DMD (22, 23). However, translating the promising
results of SSOs into drug products requires optimization of many pa-
rameters ranging from enhancement of cellular uptake and biodistribu-
tion to pharmaceutical formulation and long term stability.
1.1.3.2. AntimiRs
MiRNAs are a large family of short RNAs (~21 nucleotides)
that play a key role in post-transcriptional gene regulation (24). They
are predicted to control the activity of ~50% of all protein-coding
genes and dysfunction of individual miRNAs or entire miRNA fami-
lies was shown to be associated with several human diseases, such as
cancer and CNS disorders (24, 25). ONs designed to silence specific
miRNA, antimiRs, are used either to probe their functions or for the
development of novel miRNA-based therapeutics, an approach that
6
has demonstrated promising results in models for atherosclerosis and
cancer (25). Recently, very short (8-mer) LNAs, termed tiny LNAs,
targeting the seed region of specific miRNA families sharing the same
seeding region have been shown to directly up-regulate targets with
negligible off-target effects (26). This demonstrates the wide applica-
bility of this class of ON therapeutics.
1.2. Nanoparticles for non-viral gene delivery
Nanotechnology has attracted a lot of research interest in the
drug delivery field as a very promising method to solve drug delivery problems, especially in the field of gene therapy. This thesis is based on CPP-based vectors that form nanoparticles for delivery of several nucleic acid cargos. This section will give a brief introduction to the concept of nanoparticle gene delivery in general and highlight exam-ples of its use in the field of gene therapy and its unique pharmacoki-netic profile.
1.2.1. Small molecules vs. nanoparticles; the uptake paradox
The plasma membrane forms a barrier that separates the intra-
cellular environment from the outer environment and strictly controls
the translocation of molecules in and out of the cell. Some molecules
with certain physicochemical properties can passively diffuse across
the plasma membrane, and hence represent good drug candidates.
These physicochemical properties are called “drug-likeness”, which
describe how likely a chemical compound to be able to transfer the
intestinal membrane without the need of a carrier or active transport
processes (27, 28). They are summarized in the famous Lipinski rule
of 5 (29):
Molecular weight is less than 500 Da.
Lipophilicity, expressed as logP (the logarithm of the partition
coefficient between water and 1-octanol), is less than 5.
The number of hydrogen bond donators (usually hydroxyl and
amine groups) is less than 5.
The number of hydrogen bond acceptors (estimated by the
number of oxygen and nitrogen atoms) is less than 10.
7
Figure 2. The uptake paradox.
The rule does not apply to drugs that utilize specific transporters (ac-
tive transport via carrier proteins), which has gained extensive re-
search focus in recent years (30, 31, 32). Additionally, several refine-
ments have been introduced to the rule of 5 since its publication,
probably the most recent and prominent has been the QED (quantita-
tive estimate of drug-likeness), which is a method to quantify drug-
likeness by a score from 0 to 1 (27). Despite its limitations, the rule of
5 possesses a great predictive power and is used by pharmaceutical
companies to screen chemical libraries for drug candidates.
Looking at the gene therapy approaches discussed earlier, we
see that all of them are nucleic-acid based molecules, which are nega-
tively charged in most cases (except for PNA and PMO) and ranging
between 8 nucleotides (tiny-LNAs) up-to several kilo base-pairs
(plasmids). Applying the rules of drug-likeness to these molecules
clearly shows that they cannot cross the plasma membrane by passive
diffusion. Paradoxically, the solution to this problem was to make
these molecules even larger by incorporating them in nanoparticle-
based delivery systems, and such nanoparticles demonstrated success-
ful delivery in several in-vitro and in-vivo models. This paradox can
be explained by understanding the diverse mechanisms utilized by the
cell to control transportation across the cell membrane. Figure. 2 rep-
8
resents a rough estimate of the size ranges where molecules and parti-
cles can penetrate into the cells. According to the rule of 5, molecules
less than 500 Da, mostly less than 3 nm, possess high permeability
through the cell membrane. Exceeding 500 Da, the passive permeabil-
ity drops dramatically, and this is the range where most impermeable
molecules lie, e.g. proteins and nucleic acids. However, when such
molecules are incorporated in nanoparticles, they form a new entity of
about 10 – 500 nm in size. At this size, they are still out of the scope
of passive diffusion or interaction with small molecule transporters,
however, in the scope of endocytosis, which is the cell’s natural way
of dealing with particulate matter. Thus, the power of nanoparticle-
based delivery system lies in their capability of utilizing the cell natu-
ral endocytic mechanisms as a means of delivering their therapeutic
cargo. The endocytic process is naturally performed by all cell types
as it is crucial for cell survival. It is used to internalize nutrients and
cell-surface receptors controlling the conveyance and extent of signal-
ing (33). Additionally, while it is hijacked by bacteria (34) and viruses
(35) to cause infection, it is also used for immune responses and clear-
ance of bacteria, viruses and apoptotic cells (36). Furthermore, it is
used by the cells to internalize naturally circulating nanoparticles like
lipoproteins (LDL, HDL, etc.) (37) and exosomes (38), that are re-
sponsible for cholesterol, protein and RNA trafficking. This extensive
utilization of the endocytic processes for cellular uptake of large parti-
cles explains the success of nanoparticles in delivering therapeutics to
various cell types by exploiting various endocytic mechanisms (39).
Consequently, the process of endocytosis is the main determinant of
the activity and toxicity of the nanoparticles.
Endocytosis can be specific receptor-mediated or unspecific
non-receptor mediated with different mechanisms of internalization,
mainly: clathrin-mediated, caveolae-mediated, macropinocytosis and
phagocytosis (40) (Figure. 3). The size of the nanoparticle, its shape,
surface charge and the presence of surface antigens, all affect the
mode of interaction with the cell surface and the subsequent endoso-
mal pathway which ultimately decides the fate of the therapeutic cargo
(41). Thus, the study of the specific endocytic mechanism is very im-
portant in the design and development of nanoparticle-based delivery
systems.
9
1.2.2. Nanoparticle-based vectors in gene-therapy
For gene therapy applications, various types of inorganic and
organic nanoparticles have been investigated. Generally, the inorganic nanoparticles are synthesized then functionalized with the nucleic acid cargo. On the other hand, organic nanoparticles are usually formed using polymers that self-assemble into nanoparticles upon interaction with nucleic acids. The vast majority of inorganic and organic nano-particles used for gene therapy rely on the presence of a polycationic domain that is able to interact non-covalently with the negatively charged backbone of nucleic acids mediating its compaction and com-plexation (42). This complexation attaches the nucleic acid cargo to the nanoparticle and protects it form degradation by serum nucleases (43). That is why nanoparticles lacking polycationic domain are first functionalized with cationic groups or polycationic polymers on the surface to enable compaction and attachment of DNA (44, 44, 45, 46, 47). Table 1 demonstrates examples of the different nanoparticle-based systems used for nucleic acid delivery via non-covalent com-plexation.
Despite the vast differences in the chemistry of the nanoparticles
mentioned in Table. 1; they all have demonstrated activity in deliver-ing various gene therapeutic agents. The common features shared amongst them are:
Figure.3. Classification of endocytosis and its major mechanisms.
10
Nanoparticle-based system Cargo Ref
I. Inorganic nanoparticles
a. Ca-Mg phosphate Plasmid (48) b. Gold nanoparticles Plasmid (49) c. Carbon nanotubes & fullerenes Plasmid (47, 50) d. Quantum dots siRNA (51) e. Magnetic nanoparticles Plasmid (52) f. Silica nanoparticles ONs (53)
II. Organic nanoparticles
a. Lipid-based
Liposomes Plasmid (54) SNALPs (stable nucleic acid
lipid particles) siRNA (55)
Lipidoids siRNA (56) b. Carbohydrate-based
Dextran Plasmid (57) Cyclodextran Plasmid (58)
Chitosan Plasmid (59)
Hyaluronan Plasmid (60)
Schizophyllan ONs (61)
Pullulan Plasmid (62)
c. Peptide-based
CPPs Will be discussed in de-
tail in coming sections
Poly L-lysines siRNA (63)
Protamines ONs (64)
Histones Plasmid (65)
d. Other
Polyethylenimine (PEI) siRNA (66)
Poly(dl-lactide-co-glycolide)
(PLGA)
Plasmid (67)
Table 1. Various nanoparticle-based approaches for gene therapy and examples for the delivery of different cargos.
11
Size larger than 10 nm in most cases. The presence of a polycationic domain that is respon-
sible for nucleic acid complexation.
In this thesis (Paper III) we describe the role of the negative sur-
face charge in the uptake of CPP nanoparticles with ONs via the inter-
action with scavenger receptors that recognize nucleic acids. The
same receptors were also implicated in the uptake of oligonucleotide-
functionalized gold nanoparticles (68). Interestingly, many gene ther-
apy nanoparticles (Table 1.) are superficially functionalized by a poly-
cationic domain and consequently the complexed, negatively charged
nucleic acid is attached to the surface. Having these results in mind, it
is tempting to speculate that the nucleic acid cargo, can contribute to
the cellular uptake of the nanoparticles by interacting with certain cell
surface receptors. This interaction requires a negatively charged nucle-
ic acid in a complexed form and a certain size for endocytic uptake,
and these are the most common features among the gene therapy na-
noparticles. In this case, nucleic acids that present the delivery prob-
lem that needs to be solved, might also present a part of the solution.
This is clear in the case of scavenger receptor-mediated uptake of nu-
cleic acids, where aggregation of ONs or polyribonuceotides is a per-
quisite for receptor interaction and subsequent uptake (discussed in
detail in section 1.4.1.). If such a mechanism is general, it can explain
why systems as simple as calcium phosphate-DNA nanoprecipitates,
the first chemical transfection method ever, mediate gene transfection
(48, 69). However, this is a hypothesis and definitely needs experi-
mental verification for each delivery system separately.
Furthermore, the diversity shown in Table 1. sheds light on oth-
er problems in the field of nanoparticle-based gene delivery including:
Most of the research focus has been devoted to the development of
new systems; however, not as much focus has been given to deter-
mine the molecular mechanism of uptake of the existing systems.
Comparisons between systems from different chemistries are
scarce (groups working in certain chemistries compare systems of
the same chemistry).
12
Figure 4. Unbalanced research focus between the development of
new nanoparticle-based delivery systems, basic research and trans-
lational approaches.
Translational assessment regarding the feasibility of incorporation
into different dosage forms and the requirements for cost-effective
mass production by pharmaceutical companies are not given the
same attention.
The imbalance in research focus between the development of
new systems, molecular mechanisms and translational development is
presented schematically in Figure 4. In this thesis, work was done in
both directions trying to elucidate the molecular mechanisms behind
the uptake of CPP-based gene therapy nanoparticles and to enhance
the translational potential of such systems via pharmaceutical formula-
tion. This will be discussed in detail in the coming sections.
1.2.3. Pharmacokinetics of nanoparticle-based systems for
nucleic acid delivery
Nanoparticles are non-conventional xenobiotics with a unique
pharmacokinetic profile. It is very important to understand the phar-
13
macokinetic profile of nanoparticles intended for gene therapy, like the CPP based systems discussed in this thesis, to be able to under-stand their pharmacodynamic behavior, biodistribution and toxicity. This will help us to answer questions like: why most of the delivered cargo resides in the liver, is it possible to administer them through other routes, orally or respiratory, how can we enhance the biodistri-bution, etc.?
Any administered drug goes through 4 phases in the body that
are famously abbreviated ADME (Absorption, Distribution, Metabo-lism and Excretion). Figure 5 demonstrates a schematic representation of the pharmacokinetics of nanoparticles and their ADME phases.
Like any other xenobiotic that is not intended to act locally, na-
noparticles have to reach the blood circulation to reach its target or-gans. This can be achieved by direct intravenous or intra-arterial injec-tion. If taken via any other route of administration, they have to find their way to the blood circulation (A= Absorption). For oral admin-istration, after intestinal absorption, xenobiotics can take the hepatic pathway through the intestinal capillaries that relay to the portal vain, or the lymphatic pathway via the lymphatic capillaries that relay di-rectly to the blood circulation through the jugular vein avoiding first pass metabolism in the liver (70). The endothelial fenestrations of lymphatic capillaries are larger than those of the blood capillaries and thus more permeable to macromolecules up to several hundred na-nometers (71). Consequently, it is more likely that orally administered nanoparticles would take the lymphatic pathway. This has been shown by Aouadi et al. using glucan-encapsulated siRNA particles adminis-tered orally targeting M cells in intestinal wall Peyer’s patches to transfer micrometre-sized glucan particles to the gut-associated lym-phatic tissue (72). These orally-administered particles mediated effi-cient RNAi response in the peritoneum, spleen, liver and lung, and lowered serum TNF-αlevels. This demonstrates a proof of principle of how the administration route and the consequent pharmacokinetic profile can be utilized to achieve particular therapeutic goals.
After reaching the systemic circulation, the nanoparticles have
to distribute to the different organs and tissues (D = Distribution). Dis-tribution is highly dependent on the particle size, as nanoparticles can only extravasate in tissues with a discontinuous capillary endothelium. Liver, spleen, bone marrow, solid tumors and inflamed or infected sites harbor capillaries with the largest endothelial fenestrations
14
Fig
ure 5
. A sch
ematic rep
resentatio
n o
f the p
harm
acokin
etics of n
anop
articles.
15
(pores) (73), which explains why these tissues are easily targeted by nanoparticles. Specifically, hepatic accumulation of nanoparticles ap-pears to be the most prominent due to its high blood perfusion, fenes-trated capillary endothelium (sinusoids) that reaches up to 280 nm and the abundance of hepatic macrophages (Kupffer cells) which are situ-ated within the sinusoids and can ingest and detoxify nanoparticles at high rates (71, 73). Notably, the uptake of nanoparticles (74) and nu-cleic acids (75) by Kupffer cells is largely mediated by the scavenger receptors, a process that is facilitated by adsorption of serum proteins on the nanoparticle surface (opsonization) (76). For other tissues, the size and type (diaphragmed or non-diaphragmed) of capillary endothe-lial fenestrations determine the size of nanoparticles that can reach this organ (71). This biodistribution profile represents a problem that needs a solution for gene therapy nanoparticles to be able to target different tissues instead of just accumulating in organs with wide en-dothelial fenestrations. One solution is to add hydrophilic moieties (polyethylene glycol for example) to the surface to repel serum pro-teins that opsonize the particles for macrophages (41). Although this approach might solve the opsonization problem enhancing the circula-tory half-life of (77), it doesn’t solve the initial problem of accumula-tion in certain tissues due to extravasation. Another solution is not to depend on passive distribution but rather on active distribution by add-ing ligands that promote carrier-mediated transfer across different delivery barriers. Many studies use ligands for cellular targets to en-hance the activity of nanoparticles (78). Despite showing promise, this approach assumes homogenous distribution of the particles in all tis-sues and accessibility of the particles to the target cells. However, the particles have to pass the capillary endothelial barrier first to gain ac-cess to their cellular targets and this is strictly dependent on the size of endothelial fenestrations in this tissue. Thus, the size of the nanoparti-cles has to be carefully adjusted to enhance the distribution to differ-ent tissues or the nanoparticles should carry double ligands; one for transendothelial transport and one cell-type specific. A recent exam-ple of this approach is demonstrated by Baodo et al. by adding pep-tidomimetic monoclonal antibody (MAb) components to gene deliv-ery liposomes. These MAbs bind to specific receptors located on both the blood-brain barrier (BBB) and on brain cellular membranes (insu-lin receptor and transferrin receptor) mediating receptor-mediated transcytosis through the BBB and endocytosis into brain cells (79).
After reaching the target tissue, nanoparticles interact with the
cell membranes and gain access to the cell interior through the process of endocytosis as discussed earlier. In the endosome, two processes need to occur for a pharmacological response to take place: a. escape
16
from the endosome before being degraded in the lysosomes down-stream in the pathway, b. dissociation of the nucleic acid cargo from the carrier nanoparticle to be able to reach their target. This step also involves decomplexation of the nucleic acid cargo. Although these processes are extremely important for the activity of nucleic-acid based therapeutics, they are still poorly understood.
The final step in this long journey of the nanoparticle delivery
system is metabolism (M=Metabolism). Actually, metabolism starts from the point of administration of the nanoparticle, either at the ad-ministration site or in the circulation. However, condensation of the nucleic acid cargo with polycationic domains of the nanoparticles pro-tects it to a great extent in the circulation until it dissociates inside the cell (43). Very recently, Zuckerman et al. have demonstrated a mech-anism responsible for rapid clearance of siRNA delivery nanoparticles through the kidneys (80). They have shown that the glomerular base-ment membrane (GBM) can disassemble cationic cyclodextrin-containing polymer (CDP)-based siRNA nanoparticles facilitating their rapid elimination from circulation. However, more studies are needed focusing on the detailed metabolism of different nanoparticle-based systems.
Understanding the pharmacokinetic parameters of nanoparticles
in general is necessary to understand the properties of the CPP-based gene delivery nanoparticles that are the main focus of this thesis. The next section will be discussing CPP-based delivery in detail.
1.3. Cell-penetrating peptides (CPPs)
CPPs are polybasic and/or amphipathic peptides, usually less
than 30 amino acids in length, that possess the ability to penetrate
cells (Cell-Penetrating Peptides) or transduce (Protein Transduction
Domains) over cellular plasma membranes (81, 82). CPPs have at-
tracted much interest in recent years as promising vectors for the de-
livery of a wide variety of therapeutics ranging from small molecules
up to nanoparticles. This section will discuss CPP-based delivery in
general and focus on non-covalent nanoparticles of CPPs with nucleic
acids and their utilization in gene therapy.
17
1.3.1. History
Many peptides and proteins have desirable therapeutic effects,
but being large and often charged molecules, they have always been
thought incapable of bypassing the plasma membrane. This view was
challenged in the year 1988, when two groups independently pub-
lished results in the same issue of CELL showing that both the recom-
binant and the chemically synthesized 86 amino acids long Tat protein
are rapidly taken up by cells in tissue culture (83, 84). Few years later,
the 60 amino acid homeodomain of the Antennapedia protein in Dro-
sophila was also shown to penetrate cells (85). A very important ad-
vancement in the field came by showing that the cell penetration ca-
pability is imparted by relatively short peptide sequences. The 16-mer
peptide derived from the third helix of the homeodomain of Anten-
napedia termed penetratin (86), the 11-mer peptide derived from Tat
protein (87), the 27-mer chimeric peptide termed transportan (88) and
even simple polyarginines (R8) (89) were all shown to traverse the
plasma membrane. These discoveries marked the birth of the field of
CPPs. Since then, many CPPs have been discovered and studied as
potential drug delivery vehicles, some of which are presented in Table
2.
Table 2. Selection of CPPs and their sequences.
CPP Sequence Ref
Tat (48-60) GRKKRRQRRRPPQ (87)
Penetratin RQIKIWFQNRRMKWKK-amide (86)
pVEC LLIILRRRIRKQAHAHSK-amide (90)
bPrPp MVKSKIGSWILVLFVAMWSDVGLCKKRPKP-
amide
(91)
Transportan GWTLNSAGYLLGKINLKALAALAKKIL-amide (88)
TP10 AGYLLGKINLKALAALAKKIL-amide (92)
MAP KLALKLALKALKAALKLA-amide (93)
Pep-1 KETWWETWWTEWSQPKKKRKV- cysteamide (94)
MPG GALFLGWLGAAGSTMGAPKKKRKV-cysteamide
(95)
Poly Arg (RRR)n (89)
18
1.3.2. CPPs as drug delivery vehicles
CPPs have been shown to be efficient vectors for intracellular
delivery of various therapeutic cargos, especially for proteins and nu-
cleic acids. Two main methods have been utilized to attach the CPP
to its cargo, either via a covalent linkage or through the formation of
non-covalent complexes.
1.3.2.1. Covalent linkage to cargo
CPPs have been coupled to various cargos including proteins,
peptides, small molecules and nucleic acid analogues via covalent
attachment. One of the early applications was demonstrating their
ability to transduce full-length proteins, where the TAT peptide was
extensively studied. TAT-p27 fusion protein was shown to transduce
into cells and mediate biological function inducing cell migration (96).
Importantly, TAT fusion proteins were shown to be delivered in-vivo
to all tissues in mice, including the brain (97). This approach has been
extensively utilized to deliver a myriad of therapeutic proteins. Using
TAT-mediated transduction, Bcl-x(L), GDNF and HSP70 have been
delivered to the brain across the BBB mediating neuroprotecion in
several models (98, 99, 100). In cancer treatment, a CPP derived from
the fibroblast growth factor was conjugated to an anti-Akt single chain
Fv antibody and administrated in vivo with subsequent reduction in
tumor volume (101). Another interesting example is using undeca-
arginine (R11) expressed recombinantly with the four transcription
factors, Oct4, Klf4, Sox2, and c-Myc, to generate induced pulripotent
stem cells (iPS cells) (102). This set-up was almost 10 times more
efficient as compared to other approaches in generating iPS colonies
without the risk of chromosomal integration associated with viral vec-
tors. For peptide delivery, TAT and Penetratin (Table 1) have been
used to deliver peptides derived from the tumor suppressor p53, or
peptides that modulate p53 activity, for reduction of tumor growth and
induction of apoptosis (103, 104).
For gene therapy, covalent coupling of CPPs, which are posi-
tively charged, to negatively-charged nucleic acids has not been very
easy to achieve. Therefore, in most gene therapy approaches using the
covalent coupling strategy, neutral PNA or PMO were used instead of
natural nucleic acids. Also, they can be directly attached to the CPP
utilizing the solid phase peptide synthesis chemistry. Successful deliv-
19
ery of antisense ONs in-vivo using CPPs was for the first time demon-
strated by our group with an antisense PNA complementary to human
galanin receptor 1 (GalR1) mRNA coupled to transportan or pene-
tratin that specifically down-regulated these receptors in rat brains
(105). A number of endogenous proteins including dystrophin for
splice-switching in DMD (106, 107, 108), CD45, and the interleukin-2
(IL-2) receptor (109), have been targeted with PMOs using CPPs as
well. However, the limitation of using only PNA or PMO has led the
development of the other strategy of cargo conjugation to CPPs; non-
covalent complexation.
Small molecules, like antineoplastic agents and antibiotics, have
been coupled to CPPs to enhance biodistribution and cellular uptake.
For example, SynB peptide was utilized for the delivery of benzylpen-
icillin (B-Pc) to the brain and it was found that the brain uptake of
coupled B-Pc was increased eight-fold on average compared to free B-
Pc (110). An example of successful vectorization of chemostatics
comes from our group where two different CPPs, YTA2 and YTA4,
were utilized for the delivery of methotrexate (MTX) into MTX- re-
sistant breast cancer cells (111).
1.3.2.2. Non-covalent complexation and chemical modification of CPPs
It was the group of Gilles Divita who first showed that CPPs can
be used to deliver ONs after non-covalent complexation using the
MPG peptide (95). Having net positive charge, MPG was shown to
form nanoparticles with negatively charged single- and double-
stranded ONs, which are efficiently internalized by cells. This strategy
has drastically expanded the range of therapeutic cargos that can be
delivered via CPPs as it avoids laborious chemical conjugation and
has almost no limitation on the size of the cargo. Since the initial pub-
lication, several CPPs have been developed that can form nanoparti-
cles with various nucleic acids and efficiently mediate their delivery in
several in-vitro and in-vivo settings (112, 113, 114). However, certain
chemical modifications of the CPPs were needed to improve the na-
noparticle formation capability and enhance membrane interaction
upon non-covalent complexation (Table 3). C-terminal cysteamide
modification was shown to be crucial for CPP-mediated siRNA deliv-
20
ery using the MPG, PEP and CADY peptide families by increasing
membrane association and stabilizing particle formation by the for-
mation of peptide dimers (115, 116, 117, 118). Acetylation of these
peptides was also required to enhance stability (117). Addition of hy-
drophobic moieties to CPPs has been shown to be an efficient mean to
increase the efficiency of the nanoparticles. Cholesteryl modification
of polyarginines and MPG-8 was demonstrated to enhance their ac-
tivity for delivery of siRNA in-vivo (119). The group of Shiroh
Futaki at Kyoto university was first to demonstrate that stearylation of
polyarginines could enhance their transfection efficiency by 100-fold
(120). In recent years, our group applied stearylation and other chemi-
cal modifications to the TP10 backbone leading to the development of
the PepFect family of peptides (PFs) (121). We have shown that PF3
and PF14 are very efficient in the delivery of various nucleic acid car-
gos in different settings; both of which will be discussed in detail in
this thesis. We have also shown that PF6 is very efficient in delivering
siRNA to various cell-lines and in-vivo after intravenous administra-
tion (122). PF6 is N-terminally modified TP10 with a trifluorome-
thyl-quinoline moiety attached to one of the lysines in the backbone
via a lysine tree. The trifluoromethyl-quinoline moiety enhances the
escape of the nanoparticles from endosomes after internalization me-
diating a higher RNAi response. Furthermore, we have demonstrated
that stearylation of the (RxR)4 peptide can drastically enhance its abil-
ity to deliver plasmids and SSOs after non-covalent complexation
(123). This peptide was more efficient than stearyl-R9 for plasmid
transfection and mediated splice-switching at much lower doses than
the potent (RxR)4-PMO conjugate.
Another strategy to enhance CPP association with siRNA was to
generate TAT fusion protein with double-stranded RNA-binding do-
main (DRBD) (124). The DRBD binds siRNA with high affinity, and
thereby masks its negative charge allowing TAT-mediated cellular
uptake. This system was shown to be very efficient in delivering siR-
NA to primary cell-lines with no cytotoxicity or induction of innate
immune responses.
21
CPPs Sequence Modification Ref.
MPG peptides
MPG Ac-
GALFLGWLGAAGSTMGAP-
KKKRKV-Cya
Acetylation,
cysteamidation
(95)
MPGΔNLS
Ac-
GALFLAFLAAALSLMGLWSQPKKKR
KV-Cya
Acetylation,
cysteamidation
(115)
MPG-8 β-AFLGWLGAWGTMGWSPKKKRK-
Cya
Cysteamidation (125)
Chol-MPG-8 chol-β-
AFLGWLGAWGTMGWSPKKKRK-
Cya
Cholesterol,
cysteamidation
(125)
Pep and CADY peptides
Pep-2 Ac-KETWFETWFTEWSQPKKKRKV-
Cya
Acetylation,
cysteamidation
(126)
Pep-3 Ac-KWFETWFTEWPKKRK-Cya Acetylation,
cysteamidation
(127)
PEG-Pep-3 PEG- KWFETWFTEWPKKRK-Cya PEGylation,
cysteamidation
(127)
CADY Ac-GLWRALWRLLRSLWRLLWRA-
Cya
Acetylation,
cysteamidation
(118)
Polyarginine peptides
Stearyl-Arg8 Stearyl-RRRRRRRR-NH2 Stearylation (128)
Chol-Arg9 Chol-RRRRRRRRR-NH2 Cholesterol (119)
Stearyl-(RxR)4 Stearyl-RXRRXRRXRRXR-NH2 Stearylation (123)
Tat-DRBD
TAT-DRBD TAT fusion protein with double-stranded
RNA-binding domain
- (124)
PepFects
PF3 Stearyl-
AGYLLGKINLKALAALAKKIL-NH2
Stearylation (129)
PF6 Stearyl-
AGYLLGKaINLKALAALAKKIL-NH2
Stearylation, atrifluoromethyl-
quinoline
(122)
PF14 Stearyl-
AGYLLGKLLOOLAAAALOOLL-NH2
Stearylation (130)
NickFect1 Stearyl-AGY(PO3)LLGKTNLKALAALAKKIL
-NH2
Stearylation, phosphorylation
(131)
Table 3. Examples of CPPs and chemical modifications compatible with non-
covalent delivery of nucleic acids (adapted from our review (123)).
22
1.3.3. Uptake mechanism
Although CPPs have been discovered more than 15 years ago,
the uptake mechanism has been a matter of controversy. The mecha-
nism is thought to be receptor-free and dependent on the interaction
between the cationic residues of CPPs and the negatively charged
plasma membrane. Whether such an interaction leads to direct pene-
tration into the cell or endocytic uptake is still a matter of debate.
In the early days of CPPs, the uptake was mostly studied using
high concentrations of fluorophore-labeled CPPs with cell fixation,
and these studies led to the conclusion that CPPs directly penetrate
through cellular membranes in an energy-independent manner. Sever-
al models were suggested for such interaction, including the carpet
model, the pore formation model and the inverted micelle-mediated
model among others (132, 133). However, the view of direct translo-
cation was challenged by several studies in the late 1990’s and early
2000’s. One of the most prominent studies was a paper published by
Bernard Lebleue’s laboratory in 2003 where they demonstrated that
cell fixation, even at mild conditions, leads to the artifactual uptake of
TAT and R9 (134). Furthermore, they showed that peptide uptake was
inhibited by incubation at low temperature and cellular ATP pool de-
pletion, which strongly suggested the involvement of endocytosis in
the cellular internalization. Additionally, using fluorescence micros-
copy on living cells, they demonstrated a punctuated distribution pat-
tern of the internalized CPPs that was consistent with the distribution
of endocytic vesicles and CPPs co-localized with common endocytic
markers. Since then, endocytosis has been shown to be the main
mechanism of uptake for various CPPs, especially at low doses and
when coupled to a large molecular weight cargo (135, 136). Specifi-
cally for CPP-based nanoparticles with nucleic acids, endocytosis has
been implicated for most of the available platforms like stearyl-Arg8,
Tat-DRBD and PepFects (122, 124, 128, 130, 137). Several endocytic
pathways have been suggested for the uptake of CPPs and their cargo
including classical clathrin mediated endocytosis, caveolae-mediated
endocytosis and macropinocytosis (138). Consequently, several ap-
proaches have been devised to enhance the escape of CPPs and their
cargos out of the endosomes to avoid degradation in the lysosomal
pathway and reach their target subcellular compartments. One exam-
ple is the development of a histidine-containing endosomolytic α-
helical penetratin analogue, EB1, which was able to form complexes
23
with siRNA and promote endosomal escape (139). Other methods
utilized fusogenic peptides, like HA2-peptide, conjugated to CPPs in
order to facilitate release from endosomes (140). Recently, our group
utilized several chemical modifications to enhance endosomal escape
including stearylation and addition of endosomolytic moieties such as
trifluoromethyl-quinoline (122). Nevertheless, this has not ruled out
the fact that many CPPs are still able to gain access to the cell via di-
rect translocation mechanism in well controlled studies and without
fixation artifacts (141). Recently, Verdurmen et al. studied the uptake
mechanism of some arginine rich peptides and found that their direct
penetration depends on a CPP-induced translocation of acid sphingo-
myelinase (ASMase) to the outer leaflet of the plasma membrane and
ceramide formation (142).
1.3.3.1. Physicochemical properties and the uptake mechanism
In my opinion, the differences in the uptake mechanism of CPPs
should not be considered controversial. Controversy comes from the
notion that all CPPs are expected to have a single uptake mechanism
whatever cargos they carry, whatever concentrations are used and
whatever model they are tested in. However, such a universal mecha-
nism cannot exist because all the aforementioned factors drastically
affect the physicochemical properties of the CPP ultimately changing
the way it interacts with cells. CPP-cargo, CPP-medium and CPP-CPP
interactions can vary dramatically depending on the type of cargo and
the way it is attached to the CPP (covalent or non-covalent), the model
system (synthetic vesicles or live cells), the medium (buffer, serum-
free, serum containing) and the concentration used. These interactions
would lead to new entities with different physicochemical properties
on the molecular level and consequently different cellular interactions.
This section will discuss some examples.
An example that spans from the CPP field to their closest rela-
tives, the antimicrobial peptides (AMPs), shows how different concen-
trations can affect the cell entry mechanism and the subsequent phar-
macological effect. Many CPPs at sufficiently high concentrations are
lytic and toxic to both mammalian and bacterial cells (143, 144),
while several AMPs can penetrate into the cells without perforation or
lysis, similar to CPPs (145). Such an analogy led some researchers to
even question the reasons for the distinction between the two classes
(146). This can be understood in light of a physicochemical property
24
called the partition constant. To be able to cause lytic antimicrobial
activity, the peptide should be in a sufficiently high concentration,
called the threshold concentration, enabling the partition from the so-
lution to the membrane, increasing the local concentration and causing
perforation (147). However, at lower concentrations, when this parti-
tioning and localization is not achieved, the peptide can penetrate the
cells via other mechanisms including endocytosis. A very good exam-
ple is the SV13-PV peptide, which has been shown to enter the cell via
direct penetration at high concentrations and via endocytosis at lower
concentrations in the same study (148). Interestingly, at low concen-
trations, SV13-PV forms spherical nanoparticle-like structures upon
association with cell surface glycosaminoglycans (GAGs) on the
plasma membrane, which promote endocytic uptake (149). GAG
clustering prior endocytic internalization has been recently demon-
strated for several other CPPs as well (150, 151, 152).This example
clearly shows how physicochemical properties like the partitioning
from solution or formation of nanoparticles on the cell surface can
change the mechanism of uptake according to the used concentration.
For CPP nanoparticles with nucleic acids, the physicochemical
changes to the CPP are more prominent. The CPP condenses the nu-
cleic acid cargo forming a new entity (i.e. nanoparticle), which pos-
sesses new physicochemical properties. While nucleic acid condensa-
tion with CPPs has been shown experimentally (123), it is not known
if a reciprocal condensation occurs to the CPP as well. Furthermore,
the structure of the nanoparticle is not well characterized i.e. the dis-
tribution of components between the core and the surface is not
known, however, it is always assumed that the peptide should be on
the surface to mediate cellular delivery. Since, the surface of the na-
noparticle is the interaction plane with the cells, it is very important to
characterize its physicochemical properties, especially the surface
charge (zeta potential), which will determine the mode of interaction
with the plasma membrane. Also, surface charge determination can
shed light on the molecules that are superficially expressed.
The zeta potential is a function of the surface charge of the par-
ticle or any adsorbed layer at the interface (153). Each charged parti-
cle in a solution containing ions is surrounded by an electrical
25
double layer of ions and counter-ions (Figure 6.) (154). The first layer
of strongly bound counter-ions is commonly called Stern layer. Since
it is strongly attached, this layer moves together with the particle in
the medium. The second layer contains ions and counter-ions and is
less strongly bound to the suspended particle, thus called “diffusion
layer”. This layer is in direct contact with the bulk of the suspending
liquid, and in contrast to the stern layer, ions of this layer do not move
with the particle while moving in the medium. The potential differ-
ence across the double layer, i.e. between the edge of the Stern layer
and the edge of the diffusion layer (bulk of suspending liquid) is
called zeta potential (154, 155). Zeta potential is usually of the same
sign as the potential at the particle surface (153), however, it is greatly
affected by the dispersion medium, especially the pH and ion concen-
tration. This medium-dependence highlights the importance of meas-
uring the zeta potential of CPP nanoparticles in biorelevant media as
this will eventually affect the surface charge and hence the subsequent
membrane interaction and uptake mechanism. In this thesis (paper
III), we found that certain CPP-ON nanoparticles have negative zeta
potential when dispersed in biorelevant media. In contrary to the ex-
Figure 6. Different layers forming the zeta potential of a particle.
26
pected mode of action of CPPs, this negative charge, probably caused
by ON condensation on the surface, was responsible for the cellular
uptake by interaction with cell surface receptors called the scavenger
receptors (156), which will be discussed later in detail. This is another
example of how the cargo and the medium can drastically change the
physicochemical properties of CPPs driving them into cells by distinct
mechanisms.
1.4. Scavenger receptors (SRs)
SRs were discovered by the Nobel laureates Michael Brown and Joseph Goldstein in 1979 (157, 158). Having discovered the low-density lipoprotein receptor (LDL receptor) a few years earlier, Brown and Goldstein found that acetyl-LDL can still accumulate in macro-phages in atherosclerotic plaques of patients with familial hypercho-lesterolaemia who lack LDL receptors. This implied the presence of other receptors, which were called the scavenger receptors for their presumed role in scavenging modified forms of LDL (159). Now, there are 8 members of scavenger receptor family (A-H), all having the common feature of binding with low specificity to polyanionic ligands including chemically modified LDL despite the structural and functional differences (160, 161, 162). Unlike other receptors, SRs
Scavenger receptors
Modified LDL
Nucleic acids
Nanoparticles
Sulfated polysacharides
Amyloid-beta aggregates and
prions
Viruses
Bacteria
Apoptotic cells
Figure 7. Ligands recognized and endocytosed via scavenger receptors.
27
bind a wide range of polyanionic ligands, and thus they are sometimes referred to as promiscuous receptors (162) or cellular fly-paper (163). Besides their role in LDL metabolism, they are also pattern recogni-tion receptors (PRRs) that play an important role in innate immunity by the identification and endocytosis of wide variety of pathogen-associated molecular patterns (PAMPs). That is why they are highly expressed in macrophages and involved in several immune responses. Staphylococcus aureus bacteria (164), HCV virus (165), lipopolysac-charide (LPS) (166), PrP106–126 prion protein (167) and viral RNA (168) are examples of PAMPs recognized by scavenger receptors (Figure 7). Importantly, SRs are involved in the clearance and phago-cytosis of apoptotic cells by macrophages (159). They are also in-volved in the pathogenesis of Alzheimer’s disease by the uptake of amyloid beta aggregates via microglia (169). Furthermore, they rec-ognize several sulfated polysaccharides (dextran sulfate and fucoidan but not chondroitin sulfate) and polyribonucleotides (polyinosinic (poly I) and polyguanilic (poly G) acid but not polyadenilic nor poly-cytidylic acid (170). Interestingly, they are involved in the uptake of synthetic nanoparticles including crocidolite asbestos (171), silica (172), polystyrene (173), iron oxide (174) and gold nanoparticles ei-ther naked (175) or when functionalized with ONs (68). Therefore, they are thought to play an important role for the accumulation of as-bestos in lung macrophages after excessive inhalation (industrial worker intoxication) leading to asbestosis (171) and also for the ac-cumulation of therapeutic nanoparticles in the liver macrophages (Kupffer cells) after intravenous injection (176) helped by the extrava-sation effect.
1.4.1. Class A scavenger receptors (SCARAs) and nucleic acid
binding
SCARAs are the most well studied subgroup of scavenger re-
ceptors. To date, five different subtypes have been identified: SR-A I/II/III (SCARA1), MARCO (SCARA2), SCARA3 (CSR1 and CSR2), SCARA4 (SRCLI and SRCLII) and SCARA5 (168, 177, 178, 179, 180, 181). They share similar structural features being a trimeric type II transmembrane glycoprotein consisting of a cytoplasmic tail, transmembrane domain, spacer region and collagenous domain (177). However, some differences exist. A helical coiled-coil domain is pre-sent in SCARA1, 3 and 5 (161, 179). Additionally, while a cysteine- rich domain is present in MARCO, SR-AI and SCARA5, it is lacking in SR-AII and SCARA3 and replaced with a lectin-like domain in
28
SCARA4 (161, 177, 179). Although initially discovered in macro-phages and thought to be restricted to this type of cells, later studies showed that SCARAs possess a broader expression profile. Different SCARA subtypes were detected in endothelial cells, smooth muscle cells, splenic dendritic cells, fibroblasts and epithelial cells (168, 177). Interestingly, they are also expressed at the endothelial cells of cere-bral capillaries that form the blood-brain barrier (182). Having such a broad expression profile, their role in the uptake of nanoparticles in non-macrophage cell types might have been overlooked.
The ability of SCARAs to bind nucleic acids is of particular im-
portance to this thesis. Soon after discovery, they were shown to be involved in the uptake of polyribonuclides such as poly I and poly G (183). Poly I and poly G are known to form aggregates in solution (184, 185) and this aggregation was shown to be necessary for SCARA binding (186). Importantly, SCARAs are involved in the recognition and uptake of ON sequences containing unmethylated CG dinucleotides (CpG) from bacterial or viral DNA, which are very well known immunostimulators (187, 188, 189). CpG aggregation is also a perquisite for the receptor recognition (187, 190), a process that is enhanced by oligo G flanking (189, 191) or using phosphorothioate-based CpG which can form aggregates easier due to the more hydro-phobic backbone (190, 191, 192, 193). Double stranded RNA (168, 194, 195) and ON-functionalized gold nanoparticles (68) were also shown to be internalized via SCARA. One of the papers described in this thesis (paper III) demonstrated the role of SCARA in the uptake of CPP-nanoparticles with ONs (156).
The necessity of aggregation of nucleic acids prior to the uptake
via SCARA and the receptors’ role in the uptake of ONs complexed with CPPs or ONs displayed on the surface of gold nanoparticle high-lights the role of nucleic acid condensation in cellular delivery. The success of polycationic carriers despite their great diversity might be due to their shared ability to condense nucleic acids and to present them to certain cellular receptors that recognize particulate patterns (as discussed in sections 1.2.1. & 1.2.2.). This hypothesis can gain further support from the fact that several gene therapy nanoparticles have the polycationic domain on the surface and consequently the condensed nucleic acid cargo is also superficial (42, 43). Furthermore, many gene therapy nanoparticles have negative zeta potential especially when measured in biorelevant conditions (77, 196, 197, 198, 199). Striking-ly, even before the discovery of SCARAs, aggregation of polynucleo-tides enhanced their binding to fibroblasts by 30-fold (200) and such aggregates were used to enhance the transport albumin into sarcoma
29
cells by 75-fold (201). Unfortunately, the latter paper that is boldly titled “Polynucleotide aggregates enhance the transport of protein at the surface of cultured mammalian cells (201)” was largely ignored, having only 10 citations in more than 37 years.
Despite being rationally appealing, solid claims about this nucle-
ic acid-mediated delivery hypothesis can only be made for the systems tested so far, and to extend it to other systems thorough experimental testing should be performed. Nevertheless, the hypothesis might be useful to attract the attention of the research community to the puta-tive role of the cargo in the delivery of the vector and the role of PRRs in the delivery of gene therapy vectors.
1.5. Pharmaceutical formulation
Pharmaceutical formulation is the process of transformation of
the active drug substance into a final medicinal product, which is an
indispensable process before the drug can reach the market and be
used by patients. It has a great effect on enhancing the efficiency and
stability of active pharmaceutical ingredients. Additionally, specific
formulations have to be tailored for different therapeutic approaches.
Thus, it is of extreme importance to apply pharmaceutical formulation
techniques to gene-therapy nanoparticles to be able to enhance their
pharmacological properties and translate them into usable drug prod-
ucts. Unfortunately, as discussed in section 1.2.2., most of the re-
search in the field is focused on the development of new systems
while little attention is given to pharmaceutical formulation. However,
formulation techniques can be very useful in solving fundamental de-
livery problems in fairly simple ways, besides its consideration for
patient use and compliance that adds new dimensions to the drug de-
velopment process. Also, the development of cheap and applicable
methods to formulate nanoparticles will encourage pharmaceutical
companies to invest in the technology.
Among the different pharmaceutical forms present solid formu-
lations remain the most widely used. It is the form used in tablets,
capsules, powders for inhalation and even powders for injection. This
is because they are the most convenient dosage forms to use and also
very stable upon storage and transportation. That is why in this thesis
a method was developed to incorporate CPP nanoparticles in a solid
30
form that could be used in various therapeutic applications. For the
first time we applied the concept of solid dispersion to CPP-based
nanoparticles. Solid dispersion was invented to increase the solubility
of poorly water-soluble drugs by dispersing them over hydrophilic
solid matrices, thus decreasing the particle size and enhancing the
wettability (see details in methods) (202). Although CPP-ON nanopar-
ticles disperse well in water, this technique was still useful to obtain a
uniform distribution of the nanoparticles over a solid matrix.
Furthermore, there are several in-vitro tests that are assigned by
the different pharmacopeias to assess the suitability of a drug product
for a particular route of administration. For oral delivery for example,
there are standard in-vitro methods to test the drug product’s stability
in bench-top experiments that simulate the gastric or the intestinal
conditions. Special buffers are prepared with pH 1.2 for gastric simu-
lation and 6.8 for intestinal simulation. Hydrolytic enzymes can also
be added to these buffers to further assess the stability; pepsin for gas-
tric simulation and pancreatin for intestinal simulation. The drug
product to be tested is incubated in the simulated gastric fluid (SGF)
or the simulated intestinal fluid (SIF) with or without enzymes for
certain periods of time at 37ºC, then samples are taken and analyzed.
In this thesis (paper IV), we used a biological endpoint (RNAi re-
sponse) to test the stability of our formulation. Having a biological
endpoint is more representative of the real residual activity, and to our
knowledge, it is the first time to be applied to RNAi delivery systems.
31
2. Aims of the study
This thesis is aiming to study the activity and the properties of
two new chemically-modified CPPs; PF3 and PF14. Their activity in
the delivery of plasmids, SSOs and siRNA is assessed in different
models. Special focus was given to the elucidation of the uptake
mechanism of PF14-SSO nanoparticles. Furthermore, the thesis de-
scribes methods for formulating such nanoparticles into solid formula-
tions and testing them for the feasibility of oral administration in sim-
ulated gastric conditions.
Paper I: Studying the activity of stearic acid-modified TP10
(PF3) to deliver plasmid DNA to various cell types in-vitro and in-
vivo upon i.m. and i.d. injection.
Paper II: In this paper, ornithine, a non-standard amino acid, is
used to chemically modify a TP-10 analogue together with N-terminal
stearylation. The new peptide, named PF14, is tested in induction of
splice-switching activity in several models and a method for develop-
ing solid formulations utilizing PF14-SSO nanoparticles is decribed.
Paper III: The role of class A scavenger receptors in the uptake
of PF14-SSO nanoparticles is investigated utilizing pharmacological
inhibitors, siRNA knockdown of the receptors, immunofluorescence
and transmission electron microscopy.
Paper IV: The activity of PF14 in delivering siRNA to various
cell types is studied. Additionally, the stability of PF14-siRNA nano-
particles in solid formulation and simulated gastric conditions is in-
vestigated.
32
3. Methodological considerations
The methods used in this thesis are described in detail in the
contributing papers. This part will briefly discuss the main methods
utilized with some theoretical aspects. The selections below are valid
for all papers when nothing else is stated.
3.1. Solid-phase peptide synthesis and peptide design
All peptides in this thesis were synthesized by solid phase pep-
tide synthesis (SPPS), which was pioneered by Bruce Merrifield in
1963 (203). SPPS is based on anchoring the growing peptide chain
onto an insoluble solid matrix followed by adding an N-terminally
protected amino acid then deprotection and adding a new amino acid
in repeated cycles. This method enabled the synthesis of not only
peptide chains but also other polymers including DNA and RNA revo-
lutionizing entire fields of science.
All peptides used in this thesis were synthesized utilizing
methylbenzyl hydrylamine (MBHA) as an anchoring resin to produce
C-terminal amidated peptides, and Fmoc protection chemistry was
used. Peptides were thereafter cleaved from the resin using 95 % tri-
fluoroacetic acid (TFA), 2.5 % triisopropylsilane (TIS) and 2.5 %
H2O. Following cleavage and extraction, peptides were subsequently
freeze-dried. Crude peptides products were purified using semi-
preparative reversed-phase high performance liquid chromatography
(HPLC) and analyzed using matrix-assisted laser desorp-
tion/ionization-time of flight (MALDI-TOF) mass spectrometer. The
main peptides used in this thesis are presented in Table 4.
33
Table 4. The main peptides used in this thesis.
Stearyl-TP10 (PF3) is based on stearic acid modification of
TP10, which is a truncated version of one of the very first CPPs;
Transportan (Table 2.). Both Transportan and TP10 have earlier been
shown to be able to translocate covalently bound cargos across the
plasma membrane (88, 204). N-terminal stearic acid was added to
enhance the ability of TP10 to form non-covalent nanoparticles with
nucleic acids (137). This approach was first developed by Futaki’s
group to enhance the transfection efficiency of polyarginines (120).
On the other hand, the design of PF14 was based on switching lysines
for ornithines as the source of positive charge in the CPP together with
sequence modifications inspired by leucine zippers to enhance nucleic
acid binding. Earlier reports demonstrated that poly-L-ornithine
demonstrated superior transfection efficiency (up to 10-fold) com-
pared to equivalent poly-L-lysine-based systems (205). The superior
efficiency of poly-L-ornithines was related to the higher affinity for
DNA and the ability to make more stable complexes at lower charge
ratios (205). Furthermore, we hypothesized that ornithine, being a
nonstandard amino acid, would be less prone to serum proteases, and
thus could retain the activity in serum conditions.
3.2. Cell cultures
The first propagation of a human cell line in-vitro was the HeLa
cell-line obtained from a cervical cancer patient named Henrietta
Lacks and propagated by George O. Gey in the 1950’s. Since then, in-
vitro cell culture models are serving as indispensable tools in as-
sessing the activity of newly developed therapeutics before testing
them on animal and human subjects. Two types of cell cultures exist,
primary cultures that are obtained directly from the animal and can be
kept for a limited period of time, and permanent cultures, which are
usually of cancerous origin, and can be propagated indefinitely. Sev-
Name Sequence
Stearyl-TP10 (PF3) Stearyl-AGYLLGKINLKALAALAKKIL-NH2
PF14 Stearyl-AGYLLGKLLOOLAAAALOOLL-NH2
34
eral cell-lines were used in this thesis including primary and perma-
nent cell lines. All cell-lines were grown at 37°C, 5% CO2 in humidi-
fied environment with the appropriate culture media supplemented
with nutrients and antibiotics.
3.3. Plasmid delivery (Paper I)
Non-covalent complexation strategy between CPPs and nucleic
acids is the main strategy utilized in this thesis. pGL3 and pEGFP-C1
plasmids, expressing luciferase or EGFP respectively were used.
Plasmids were mixed with CPPs at different peptide/plasmid charge
ratios (CRs), which were calculated theoretically, taking into account
the positive charges of the peptide and negative charges of the plas-
mid. Complexes were formed for 1 h at room temperature then added
to the cells. By measuring luciferase or EGFP expression, the efficien-
cy of delivery for different peptides and CRs can be assessed for dif-
ferent cell-lines.
3.4. SSOs delivery (Paper II and III)
Two cell lines were utilized in this study, HeLa pLuc 705 and
mdx mouse myotubes. The HeLa pLuc705 cell-line is stably transfect-
ed with a luciferase-encoding gene interrupted by a mutated β-globin
intron 2. This mutation causes aberrant splicing of luciferase pre-
mRNA resulting in the synthesis of non-functional luciferase (206).
Masking the aberrant splice site with SSOs redirects splicing towards
the correct mRNA and consequently restores luciferase activity, which
can be quantified by adding luciferin substrate to the cell lysate and
measuring luminescence. Mdx mouse myotubes were obtained from
confluent H2K mdx cells, which is a myogenic cell-line derived from
transgenic mice carrying a point mutation in exon 23 of the dystrophin
gene (207). This cell-line serves as the leading cell model system for
development of drugs and drug delivery systems for treatment of
DMD. Masking the point mutation in exon 23 with SSOs leads to the
production of a shorter, partially functional dystrophin mRNA that can
be quantified with reverse-transcription PCR (RT-PCR). SSOs were
non-covalently complexed with PF14 at different MRs in water.
35
Splice-switching efficiency was calculated as the percentage of the
corrected band (exon skipping %) to the sum of corrected and aberrant
bands.
3.5. siRNA delivery (Paper IV)
In this paper, the nanoparticles were formed by mixing PF14
and siRNA in water at different molar ratios (MRs). Reporter cell-
lines stably expressing luciferase were transfected with PF14 com-
plexed with luciferase siRNA, and the decrease in luciferase expres-
sion was used to quantify the transfection efficiency. In addition, we
investigated the targeting of an endogenous gene, hypoxanthine phos-
phoribosyl transferase 1 (HPRT1), in HUH7 cell-line by measuring
mRNA levels using qPCR (real time quantitative polymerase chain
reaction). HPRT1 was chosen due to the long cellular half-life of the
protein (around 48 h) and thereby minimal impact on the vitality of
the transfected cell and limited off-target effects of the specific
HPRT1 siRNA sequence (208). In order to accurately determine the
degree of down-regulation, glyceraldehyde 3-phosphate dehydrogen-
ase (GAPDH) was used as an internal standard for quantification.
3.6. Toxicity
To exclude that the activity of the peptides in-vitro is associated
with toxicity, WST-1 assay was used. This assay measures cell viabil-
ity as a function of mitochondrial metabolic activity. It measures the
activity of the mitochondrial dehydrogenases to convert tetrazolium
salts to formazan and cell viability and proliferation is directly corre-
lated to the amount of formazan dye formed, which is quantified spec-
trophotometrically.
3.7. Dynamic light scattering (DLS), nanoparticle tracking
analysis (NTA) and zeta potential
To investigate the physicochemical characteristics of the nano-
particles formed upon complexation of the peptides and nucleic acids,
36
DLS, NTA and zeta-potential measurements were carried out. The
nanoparticles in solution after complexation can be regarded as a col-
loidal dispersion system. The DLS concept is based on shining laser
light on the dispersion system where the Brownian motion of the dis-
persed particles causes fluctuations in light-scattering intensity as a
function of time, which can be correlated to the size of the scattering
particles (155, 209). Despite being very useful, the intensity of the
scattered light is proportional to the sixth power of the particle diame-
ter makes this technique very sensitive to the presence of large parti-
cles (210). This limitation has caused differences between the particle
size measured by DLS and that seen in electron microscopy images in
paper III. In paper IV, we used the NTA system, which is dependent
on the refractive index of the nanoparticles and combines laser light
scattering microscopy with a charge-coupled device (CCD) camera
(210). This technique is more accurate than DLS and also enables
visualization of the nanoparticles in solution.
Zeta potential is determined by electrophoresis of the sample
and measuring the velocity of the particles using laser Doppler veloc-
imetry (154). Since zeta potential is highly sensitive to the type and
amount of ions in the suspension and its pH, we measured it together
with particle size in different media including: water, isotonic NaCl
solution, serum-free medium and serum-containing medium. The
measurements in biorelevant conditions help to elucidate the physico-
chemical properties that the nanoparticle possesses in the media where
it interacts with the cell surface.
3.8. Solid dispersion and gastric simulation
In paper II and IV, to test the feasibility of formulating PF14-
ON nanoparticles into solid formulation, solid dispersion technique
was utilized. The technique was developed to enhance the solubility
and wettability of poorly-water-soluble drugs, since dissolution in
gastric fluids is a perquisite for drug absorption. Otherwise, the drug
product will not be available for absorption by intestinal villi. Classi-
cally, the water-insoluble drug and a hydrophilic carrier are dissolved
in a common organic solvent that is then evaporated leaving a molecu-
lar dispersion of the drug on the hydrophilic solid matrix (202). That
is why it is sometimes called “solid solution” and it was shown to en-
37
hance the pharmacokinetic profile of many drugs that had unfavorable
dissolution properties (202). In our case, PF14-ON nanoparticles have
good dispersibility in water; however, the technique was useful to ob-
tain uniform distribution of the particles over the desired solid matri-
ces. The suspension of nanoparticles was first mixed with different
excipient solutions at different concentrations. For solvent evaporation
(in this case water), we chose speed drying under elevated temperature
(55-60ºC) and reduced pressure. Despite being a relatively stressful
drying method, it is more relevant to the widely used, cost-effective,
heat-based pharmaceutical drying techniques.
For gastric simulation experiments, the SGF was prepared accord-
ing to the US pharmacopoeia (0.2% NaCl (w/v) and 0.7% HCl (v/v))
at pH 1.2 with or without pepsin (0.32% (w/v)). The nanoparticles in
solution or in solid formulation were incubated for 30 minutes in the
fluid before addition to the cells. The residual activity was measured
as RNAi response in luciferase expressing cells.
3.9. Immunofluorescence and transmission electron microscopy
(TEM)
In paper III, besides pharmacological inhibitors and siRNA, we
used immunofluorescence and transmission electron microscopy to
further demonstrate the role of SCARA in the uptake of PF-SSO na-
noparticles. For immunofluorescence, cells were incubated with nano-
particles of Cy5-labeled (red) SSOs with PF14 for 30 min at 4 °C or
37 °C. Incubation at 4 °C drastically slows down the endocytic pro-
cesses enabling us to detect colocalization occurring at the cell surface
before internalization. The cells were fixed and permeabilized then
treated with anti-SCARA3 and anti-SCARA5 antibodies and subse-
quently labeled with fluorescently-labeled secondary antibodies. For
TEM, nanogold-labeled SSOs were complexed with PF14 to enable
TEM visualization. Cells were pretreated with SCARA inhibitors or
controls then treated with the nanoparticles for 1h. Afterwards, the
cells were washed and fixed according to standard procedure (as de-
scribed in (149)). Subsequently, ultra-thin sections were cut in parallel
with the coverslip and contrasted with 2% uranyl acetate in 50% etha-
nol for 2 min and in standard lead citrate staining solution for 2 min
and examined with the transmission electron microscope. Sections
38
from the cell surface and cell interior were compared for detection of
binding and internalization of the nanoparticles.
3.10. Animal Experiments
In-vivo animal experiments were carried out in paper I. All ani-
mal experiments were approved by The Swedish Local Board for La-
boratory Animals, and were designed to minimize the suffering and
pain of the animals. PF3-plasmid nanoparticles were injected i.d. or
i.m. into M. tibialis anterior. Gene expression was assessed by imag-
ing of the reporter gene (firefly luciferase) expression. Clinical chem-
istry parameters (alanine transaminase/aspartate transaminase, C-
reactive protein, and creatinine levels) in serum were analyzed after 24
hours post-treatments using standardized techniques. For histopatho-
logical analysis, organs were dissected after 24 hours and fixed in
formalin, embedded in paraffin, and stained with eosin and hematoxy-
lin before taking images.
39
4. Results and discussion
The four papers in this thesis cover two newly developed chem-
ically modified CPPs used for the delivery of different nucleic acid-
based therapeutics.
4.1. Delivery of plasmids via stearyl-TP10 (PF3) in-vitro and in-
vivo (Paper I)
Here, we demonstrate that stearylation of the TP10 peptide (Ta-
ble 4.) has a significant impact on plasmid delivery in different cell-
lines including Chinese hamster ovary (CHO), human embryonic kid-
ney (HEK293), human glioblastoma (U87), human osteosarcoma
(U2OS) and the hard-to-transfect primary mouse embryonal fibro-
blasts (MEF). PF3 transfection efficiency was in parity with the com-
mercial lipid-based transfection reagent Lipofectamine-2000™, with
less toxicity. In addition, PF3 was able to transfect entire cell popula-
tion in a ubiquitous manner. However, the transfection efficiency was
dependent on the CR between the peptide and the plasmid. Compared
to the unstearylated version, PF3 resulted in around 4 orders of magni-
tude increase in luciferase expression levels as compared to plasmid-
treated cells. Clearly, stearic acid renders the peptide more hydropho-
bic and presumably hydrophobicity plays an important role in particle
formation, as it enables more pronounced plasmid DNA condensation
and the formation of small, stable particles. This protects plasmid
DNA, making it more stable against the degrading capacity of serum
nucleases. The drastic increase in activity of PF3 compared to TP10
could also be a result of increased endosomal escape.
Importantly, PF3-plasmid nanoparticles facilitated efficient
gene delivery in muscle and skin, after i.m. or i.d. injections, respec-
tively. In both cases, luciferase activity was increased around 1 log as
40
compared to the background levels and these effects were shown to be
dose-dependent. We also confirmed that the gene delivery did not
trigger any immune response in-vivo and that these treatments were
not associated with any systemic toxicity. Interestingly, these effects
were only seen with the nanoparticles formed at CR1, while at other
CRs, no effect on luciferase activity was seen. The critical dependency
on certain CRs possibly emanates from the avidity of PF3 towards the
plasmid and, therefore, the stability of these nanoparticles. Probably,
at higher CRs, the release of the plasmid from the complexes is per-
turbed and the affinity of PF3 towards it is too great for in-vivo ap-
plicability. These differences between the avidity at different CRs
were confirmed by other assays in the paper.
4.2. Delivery of SSOs via PF14 and solid formulation
development (Paper II)
In this paper we present a new chemically modified CPP, PF14
(Table 4.). Ornithines were utilized as the main source of positive
charges instead of lysines (see peptide design, section 3.1). PF14 was
tested in HeLa 705 and mdx mouse myotubes cell-lines utilizing dif-
ferent MRs. Robust splice-switching was observed in both cell lines in
a dose-dependent manner. This was confirmed on the protein and
mRNA levels by measuring the amount of functional luciferase en-
zyme produced in the HeLa 705 cell-line and by measuring the inten-
sity of corrected mRNA bands via RT-PCR in the mdx cell-line re-
spectively. The activity was not significantly affected by serum condi-
tions, and at certain MRs significantly exceeded the activity of
Lipofectamine2000® without associated toxicity. In addition, PF14
elicited a fast onset of its splice-switching activity as early as 8 hours
and was able to transfect entire cell population without being very
sensitive to increasing cell densities. Co-localization with endocytosis
markers demonstrated that endocytosis is responsible for the uptake of
PF14-SSO nanoparticles and this was further corroborated by the en-
hanced splice-switching activity upon addition of CQ.
Finally, we wanted to take our delivery system a step further
by developing a suitable formulation for administration. Although
CPPs have been extensively exploited in recent years for the delivery
of various therapeutics (113), to our knowledge, formulation of CPPs
41
into different pharmaceutical forms has never been thoroughly stud-
ied. Therefore, to expand the range of therapeutic applications of CPP-
based therapeutics, there is a need for studies exploring the possibility
of incorporating CPPs in different pharmaceutical forms; especially
the solid form which is widely used in several pharmaceuticals. We
applied the solid dispersion technique by mixing the nanoparticles in
suspension with excipient solutions then drying at relatively high tem-
peratures (55 - 60 ⁰C) under vacuum. Mannitol, lactose and PEG 6000
were used as excipients at different concentrations. It was clear that
different excipients and concentrations thereof had a big impact on the
activity of the formulation, with lactose at a concentration of 3.33%
demonstrating splice-switching activity nearly identical to the freshly
prepared nanoparticles in solution. On the contrary, Lipofec-
tamine2000® almost lost its entire activity upon application of this
drying and dispersion procedure. In order to assess that the presence
of intact nanoparticles after the formulation procedure, DLS studies
were performed comparing the freshly prepared nanoparticles with the
solid formulations. We found that the particles size and particle-size
distribution are highly affected by the type of excipient used. The
formulation which mediated the highest splice-switching activity, also
had DLS profile most similar to the freshly prepared nanoparticles.
Upon measuring the zeta potential of the nanoparticles, we found that
they are negatively charged, either freshly prepared or as a solid for-
mulation.
Next, we subjected the best performing formulation (lactose at
3.33%) to stressful stability testing conditions at elevated temperatures
for 2 months. Storage at high temperatures increases the rate of degra-
dation reactions that could take years to occur (211). PF14 formula-
tions demonstrated an excellent stability profile under such conditions,
where no statistically significant loss in transfection efficiencies at any
time-point except for the 60 ⁰C-8-weeks point where the transfection
efficiency decreased to 70% of the initial value. Compared to lyophi-
lized lipoplexes (212, 213), PF14 formulations are remarkably stable
without further additives or special storage conditions.
42
4.3. Scavenger receptor-mediated uptake of CPP nanoparticles
with ONs (Paper III)
As discussed earlier in section 1.3.3., the uptake mechanism of
CPPs cannot be universal for all cargos. The CPP cargo interaction forms a new entity whose properties could be different from the naked CPP. Also, different media can affect the physicochemical properties of CPPs and their cargos, consequently affecting the uptake mecha-nism. These effects were clear when we were assessing the physico-chemical properties of PF14-SSO nanoparticles. In contrary to our expectations, the net surface charge (zeta potential) of the particles was negative and highly dependent on the dispersion medium. In wa-ter, zeta potential was dependent on the peptide/ON ratio, being nega-tive at MR3, almost neutral at MR5 and positive at MR10. However, when the dispersion medium was changed to biorelevant conditions such as isotonic NaCl, serum-free medium or serum-containing medi-um, zeta potential switched to high negative values at all MRs. This shift occurred even in the absence of serum indicating that the salt concentration and pH are mainly responsible for the change rather than serum proteins.
The effect of pH and salt concentration on zeta potential is a
very well documented for colloidal dispersions (214); however, the net negative charge of the particles was surprising. It is expected for a CPP-based vector to have a net positive charge to enable direct inter-action with the negatively-charged cell membrane or integrated GAGs. Importantly, this superficial negative charge is formed in the transfection media, which means that this negative surface is what actually interacts with the cell membrane in transfection conditions. This charge implies that the particles should repel from the cell sur-face rather than directly interact. Thus, we suspected a role of a par-ticular receptor that can mediate such interaction and act as an adapter between the nanoparticle and the cell membrane. SCARAs were very plausible candidates for being the putative receptors as they are well known for binding with low specificity to polyanionic ligands and negatively charged particles (section 1.4). A simple experiment was to study the effect of preincubation with specific SCARA ligands on the splice-switching activity of the nanoparticles. Strikingly, we found that at very low concentrations of poly I, dextran sulfate or fucoidan, the activity of the nanoparticles was abolished completely and in a dose-dependent fashion. For control, we used chemically related mol-ecules that are not SCARA ligands such as polycytidylic acid, chon-droitin sulfate and galactose, and all did not affect the activity except
43
for chondroitin sulfate which had a slight effect at higher doses. Upon pretreatment with fetuin, which is known to mediate uptake of nano-particles via SCARA (215), the activity was increased by more than 50%.
The next step was to determine which SCARA subtypes are ex-
pressed in the HeLa 705 cell-line. Using RT-PCR, we found that it
expresses SCARA3 (with its 2 splice variants) and SCARA5. SiRNA
knock-down of these receptors yielded in more than 50 % decrease in
activity. Furthermore, immunofluorescence and TEM studies were
performed to directly assess the role of SCARAs in the uptake pro-
cess. Using antibodies against SCARA3 and SCARA5, Cy-labeled
PF14-SSO nanoparticles cololocalized with the receptors both on the
cell-surface and after internalization. In the TEM images, it was clear
that the presence of the specific inhibitory ligands, such as dextran
sulfate, prevented both the binding and uptake of the nanoparticles,
while chondroitin sulfate did not. The TEM images are particularly
interesting as they demonstrate the initial concept behind this study
i.e. when the receptors are not available (in this case blocked), the
nanoparticles are not attached to the cell membrane due to electrostat-
ic repulsion.
Despite the different methods used to prove SCARA involve-
ment, the question remains about what is causing the negative surface
charge. We speculated that at least a portion of the SSO cargo is dis-
played and condensed on the surface mediating this interaction (Fig-
ure 8.). To indirectly prove the role of the SSOs, we ran transfection
experiments using the naked SSO at different concentrations. At low-
er concentrations (200 nM) they did not mediate any splice-switching
activity, however, at a much higher dose (5 μM), significant splice-
switching was observed, indicating that the SSOs can be taken by the
cells at high doses where they start to form aggregates. This necessity
of ON aggregation for SCARA mediated uptake is well documented
(section 1.4.1.). Additionally, we performed colocalization experi-
ments using naked Cy-labeled SSOs at different concentrations. Simi-
larly, at higher concentration (1μM), profound colocalization is ob-
served, while much less is observed at 200 nM. Despite not being a
direct proof, these results indicate that the activity of the peptide might
be due to efficient condensation and display of SSOs on the surface.
PF14 has a lipid tail that can form a hydrophobic core leaving the hy-
drophilic cationic residues on the surface to interact and condense the
44
SSO cargo (Figure 8.). However, direct evidence for such particle or-
ganization is still needed and cryo-electron microscopy might be a
good method to shed light on that.
4.4. Activity and solid formulation of PF14-siRNA nanoparticles
and their stability in simulated gastric conditions (Paper IV)
In paper II, we studied the activity of PF14 for SSO delivery
and developed a method for formulating PF14-SSO nanoparticles into
a solid form which preserves the activity for several weeks and can
have several applications. Here, we wanted to extend the PF14 deliv-
ery platform to siRNA. Starting with reporter cell-lines, we found that
PF14 can mediate high rates of RNAi in serum-free and serum-
containing medium in a dose-dependent matter. Around 90 % knock-
down was achieved at doses as low as 50 nM in serum-free conditions
and 100 nM in the presence of serum. We used qPCR to determine the
EC50 and the kinetic profile of PF14-siRNA nanoparticles on the
mRNA level. HPRT1 was the target gene while GAPDH was used as
Figure 8. Hypothetical representation of PF14-
SSO nanoparticle. Grey: PF14, Red: SSO.
45
a control. PF14-siRNA nanoparticles demonstrated EC50 of less than
15 nM in both serum and serum-free media. In kinetic studies, more
than 70% knock-down was observed in the first two hours, signifi-
cantly surpassing Lipofectamine RNAimax®, which the most opti-
mized commercial vector. Interestingly, the RNAi effect was main-
tained up to 4 days confirming sustainable activity of the nanoparti-
cles. Gene knock-down was also demonstrated in the hard-to-transfect
Jurkat suspension cell-line.
Next, we used the solid dispersion method developed in paper II
to formulate the siRNA nanoparticles in to a solid form. The solid
formulations based on mannitol displayed RNAi activity similar to the
freshly-prepared nanoparticles. We used a new technique called the
nanoparticle tracking analysis (NTA) to characterize the particles and
determine the effect of formulation and different media on the particle
size. This method enables tracking of individual particles and thus
overcoming the low resolution problem of DLS. In the NTA meas-
urements, the mean particle size was not significantly different be-
tween the freshly prepared formulation and after solid dispersion ei-
ther in water or serum-containing medium demonstrating that the na-
noparticles remain intact in different media and withstand the drying
and dispersion conditions. Zeta potential measurements revealed a
similar pattern to PF14-SSO complexes; i.e. positive in water and
negative in biorelevant serum-free or serum-containing media. This
indicates that SCARAs might be responsible for the uptake of PF14-
siRNA nanoparticles as well. This was supported by preliminary re-
sults of the SCARA ligands decreasing the RNAi activity of the nano-
particles (unpublished data); however, this needs to be confirmed
more thoroughly.
The most obvious use of a solid formulation is for oral delivery,
and it would be very convenient for patients if it is feasible to deliver
siRNA therapeutics in tablets and capsules. However, the extremely
acidic gastric environment will degrade the siRNA as is soon it reach-
es the stomach via acid hydrolysis. Thus, we wanted to test if the
complexation of siRNA in PF14 nanoparticles can protect it from gas-
tric acidity and whether the nanoparticles can survive gastric proteo-
lytic enzymes. To do that, we incubated the nanoparticles either fresh-
ly-prepared or in solid formulation with SGF for 30 min in the pres-
ence or absence of pepsin. To determine the residual activity, we add-
ed the nanoparticles to the cells after SGF incubation and measured
46
the RNAi response. This method is much more informative than other
analytical methods such as gel electrophoresis or mass spectroscopy
because it shows the residual biological response, which is most im-
portant for any formulation. Interestingly, the nanoparticles were able
to protect the siRNA in these conditions and mediated RNAi response
close to normal. However, when incubated for more than 30 min, pep-
sin started to deteriorate the activity (data not shown), which indicates
the requirement of further protection. Nevertheless, the ability of a
simple, one-step system like PF14 to protect siRNA from acidic deg-
radation is remarkable. This might be due to efficient complexation
and condensation of the siRNA cargo in a confirmation that protects it
from hydrolysis. To confirm the integrity of the particles in SGF,
NTA measurements were performed. The nanoparticles remained in-
tact in SGF with/without pepsin despite displaying a slightly larger
size compared to incubation in water or transfection media. These
results open the door for testing oral CPP-based siRNA therapeutics in
animal models, towards developing convenient drug products for this
new class of therapeutics.
47
5. Conclusions
This thesis describes two new chemically modified CPPs that
were used to deliver nucleic-acid based molecules in various gene
therapy approaches. We clearly demonstrate that these peptides form
stable nanoparticles with the negatively charged nucleic acid cargos
and are efficiently internalized in several cell-types. The nanoparticles
were also active in solid formulation and in simulated gastric condi-
tions and thus can be suitable for different routes of drug administra-
tion. Importantly, we demonstrated that PF14-SSO nanoparticles pos-
sess negative surface charge at biorelevant conditions and that
SCARA3 and SCARA5 are involved in their uptake, suggesting a
putative role of the nucleic acid cargo in the uptake process of such
nanoparticles.
Paper I: stearyl-TP10 (PF3) is an efficient vector for the deliv-
ery of plasmids in-vitro in various cell-lines and in-vivo after i.m. and
i.d. injection.
Paper II: Describes a new CPP, PF14, for delivery of SSOs in
different cell models including mdx mouse cell-line, an in-vitro model
for Duchenne’s muscular dystrophy. A method to formulate PF14-
SSO nanoparticles into a solid form was also developed.
Paper III: Highlights the effect of medium conditions on the
surface charge of PF14-SSO nanoparticles and demonstrates the role
of class A scavenger receptors in their uptake.
Paper IV: Demonstrates the activity of PF14 to deliver siRNA
to various cell types in solution and in solid formulation. Furthermore,
PF14-siRNA nanoparticles are shown to be stable in simulated gastric
conditions.
48
6. Acknowledgements
- First of any acknowledgements goes to God (Allah) for His in-numerable blessings and His guidance for me to the right path.
- To Ülo, my supervisor who has given me the chance to do sci-
ence and kindly and patiently helped me to figure out my way. Thank you so much.
- To my mother and father who have lived their entire lives for
me and my brother to be happy. I owe everything to them. And my brother from whom I learn endurance and perseverance.
- To my soul mate, my most beloved person, my dear wife. She
has been my friend, sister and wife since I met her, and I could never imagine my life without her beautiful face or her loving heart. We now have Yasser, our son, who has given me some-thing to work for the rest of my life.
- To Samir EL-Andaloussi, for teaching me everything from us-
ing a pipette to writing a paper. For involving me in many projects and believing in me at times I didn’t believe in myself. For his help with everything and for being a spectacular friend. Thanks a lot.
- To my mother in law, for her trust in me and her love and help.
She’s done a lot for the success of our marriage and still doing a lot to keep us happy. Thank you.
- To Dr. Hussain El Sawalhy, who made me understand phar-
maceutics and biopharmaceutics. Without his teaching I would have never been able to make this thesis. Thank you.
- To Johan Runesson, for his continuous help and cheerful face.
49
- To Staffan Lindberg, my sincere friend and colleague, we spent very nice time together and we have done nice science. I hope we can continue with that.
- To Andrés Muñoz-Alarcón, who is silent sometimes, funny all
the time and a true friend. Shokran Al Azeem Al Fattah Al Bab.
- To Henrik Helmfors, for all the nice discussions that we had and all the nice experiments we did together. I wish you the best of luck.
- To all Ülo’s group members that were here or still here includ-
ing: Peter Guterstam, Kristin Karlson and Jonas Eriksson for the team spirit and continuous help.
- To Prof. Edvard Smith for the great opportunity of collabora-tion and his help and advice.
- To Eman Zaghloul, for the work we’ve done together in two papers of this thesis and her great efforts. I hope we can con-tinue to collaborate even when we go back to Egypt.
- To all my collaborators, thanks a lot, this work couldn’t have
seen light without your crucial contributions.
- To all the people working in the department of neurochemis-try, thank you for making the best working place ever, and thank you for being part of my everyday delight.
50
7. References
1. Lander,E.S., Linton,L.M., Birren,B., Nusbaum,C., Zody,M.C.,
Baldwin,J., Devon,K., Dewar,K., Doyle,M., FitzHugh,W., et al.
(2001) Initial sequencing and analysis of the human genome. Nature,
409, 860-921.
2. Mastrobattista,E., van der Aa,M.A., Hennink,W.E. and Crom-
melin,D.J. (2006) Artificial viruses: A nanotechnological approach to
gene delivery. Nat. Rev. Drug Discov., 5, 115-121.
3. Http://www.asgct.org/about_gene_therapy/terminology.php#G.
4. O'Connor,T.P. and Crystal,R.G. (2006) Genetic medicines: Treat-
ment strategies for hereditary disorders. Nat. Rev. Genet., 7, 261-276.
5. Hanahan,D. and Weinberg,R.A. (2011) Hallmarks of cancer: The
next generation. Cell, 144, 646-674.
6. Kay,M.A. (2011) State-of-the-art gene-based therapies: The road
ahead. Nat. Rev. Genet., 12, 316-328.
7. Cavazzana-Calvo,M. (2009) Basic research tries to decrease the
risks of translational medicine. Gene Ther., 16, 309-310.
8. Hacein-Bey-Abina,S., Garrigue,A., Wang,G.P., Soulier,J., Lim,A.,
Morillon,E., Clappier,E., Caccavelli,L., Delabesse,E., Beldjord,K., et
al. (2008) Insertional oncogenesis in 4 patients after retrovirus-
mediated gene therapy of SCID-X1. J. Clin. Invest., 118, 3132-3142.
9. Howe,S.J., Mansour,M.R., Schwarzwaelder,K., Bartholomae,C.,
Hubank,M., Kempski,H., Brugman,M.H., Pike-Overzet,K., Chat-
ters,S.J., de Ridder,D., et al. (2008) Insertional mutagenesis combined
51
with acquired somatic mutations causes leukemogenesis following
gene therapy of SCID-X1 patients. J. Clin. Invest., 118, 3143-3150.
10. Kay,M.A., Glorioso,J.C. and Naldini,L. (2001) Viral vectors for
gene therapy: The art of turning infectious agents into vehicles of
therapeutics. Nat. Med., 7, 33-40.
11. Herzog,R.W., Cao,O. and Srivastava,A. (2010) Two decades of
clinical gene therapy--success is finally mounting. Discov. Med., 9,
105-111.
12. Rakoczy,P.E. (2000) Antisense DNA technology. Methods Mol
Med., 47, 89-104.
13. Bell,N.M. and Micklefield,J. (2009) Chemical modification of
oligonucleotides for therapeutic, bioanalytical and other applications.
Chembiochem, 10, 2691-2703.
14. Whitehead,K.A., Langer,R. and Anderson,D.G. (2009) Knocking
down barriers: Advances in siRNA delivery. Nat. Rev. Drug Discov.,
8, 129-138.
15. Kole,R., Krainer,A.R. and Altman,S. (2012) RNA therapeutics:
Beyond RNA interference and antisense oligonucleotides. Nat. Rev.
Drug Discov., 11, 125-140.
16. Elbashir,S.M., Harborth,J., Lendeckel,W., Yalcin,A., Weber,K.
and Tuschl,T. (2001) Duplexes of 21-nucleotide RNAs mediate RNA
interference in cultured mammalian cells. Nature, 411, 494-498.
17. Nilsen,T.W. and Graveley,B.R. (2010) Expansion of the eukaryot-
ic proteome by alternative splicing. Nature, 463, 457-463.
18. Sazani,P. and Kole,R. (2003) Therapeutic potential of antisense
oligonucleotides as modulators of alternative splicing. J. Clin. Invest.,
112, 481-486.
19. Bauman,J., Jearawiriyapaisarn,N. and Kole,R. (2009) Therapeutic
potential of splice-switching oligonucleotides. Oligonucleotides, 19,
1-13.
52
20. Wood,M.J. (2010) Toward an oligonucleotide therapy for du-
chenne muscular dystrophy: A complex development challenge Sci.
Transl. Med., 2, 25ps15.
21. Ivanova,G.D., Arzumanov,A., Abes,R., Yin,H., Wood,M.J., Le-
bleu,B. and Gait,M.J. (2008) Improved cell-penetrating peptide-PNA
conjugates for splicing redirection in HeLa cells and exon skipping in
mdx mouse muscle. Nucleic Acids Res., 36, 6418-6428.
22. van Deutekom,J.C., Janson,A.A., Ginjaar,I.B., Frankhuizen,W.S.,
Aartsma-Rus,A., Bremmer-Bout,M., den Dunnen,J.T., Koop,K., van
der Kooi,A.J., Goemans,N.M., et al. (2007) Local dystrophin restora-
tion with antisense oligonucleotide PRO051. N. Engl. J. Med., 357,
2677-2686.
23. Kinali,M., Arechavala-Gomeza,V., Feng,L., Cirak,S., Hunt,D.,
Adkin,C., Guglieri,M., Ashton,E., Abbs,S., Nihoyannopoulos,P., et al.
(2009) Local restoration of dystrophin expression with the morpholino
oligomer AVI-4658 in duchenne muscular dystrophy: A single-blind,
placebo-controlled, dose-escalation, proof-of-concept study. Lancet
Neurol., 8, 918-928.
24. Krol,J., Loedige,I. and Filipowicz,W. (2010) The widespread
regulation of microRNA biogenesis, function and decay. Nat. Rev.
Genet., 11, 597-610.
25. Stenvang,J., Petri,A., Lindow,M., Obad,S. and Kauppinen,S.
(2012) Inhibition of microRNA function by antimiR oligonucleotides.
Silence, 3, 1.
26. Obad,S., dos Santos,C.O., Petri,A., Heidenblad,M., Broom,O.,
Ruse,C., Fu,C., Lindow,M., Stenvang,J., Straarup,E.M., et al. (2011)
Silencing of microRNA families by seed-targeting tiny LNAs. Nat.
Genet., 43, 371-378.
27. Bickerton,G.R., Paolini,G.V., Besnard,J., Muresan,S. and Hop-
kins,A.L. (2012) Quantifying the chemical beauty of drugs. Nat.
Chem., 4, 90-98.
28. Leeson,P. (2012) Drug discovery: Chemical beauty contest. Na-
ture, 481, 455-456.
53
29. Lipinski,C.A., Lombardo,F., Dominy,B.W. and Feeney,P.J. (2001)
Experimental and computational approaches to estimate solubility and
permeability in drug discovery and development settings. Adv. Drug
Deliv. Rev., 46, 3-26.
30. International Transporter Consortium, Giacomini,K.M.,
Huang,S.M., Tweedie,D.J., Benet,L.Z., Brouwer,K.L., Chu,X.,
Dahlin,A., Evers,R., Fischer,V., et al. (2010) Membrane transporters
in drug development. Nat. Rev. Drug Discov., 9, 215-236.
31. Dobson,P.D. and Kell,D.B. (2008) Carrier-mediated cellular up-
take of pharmaceutical drugs: An exception or the rule? Nat. Rev.
Drug Discov., 7, 205-220.
32. Sugano,K., Kansy,M., Artursson,P., Avdeef,A., Bendels,S., Di,L.,
Ecker,G.F., Faller,B., Fischer,H., Gerebtzoff,G., et al. (2010) Coexist-
ence of passive and carrier-mediated processes in drug transport. Nat.
Rev. Drug Discov., 9, 597-614.
33. Scita,G. and Di Fiore,P.P. (2010) The endocytic matrix. Nature,
463, 464-473.
34. Veiga,E. and Cossart,P. (2006) The role of clathrin-dependent
endocytosis in bacterial internalization. Trends Cell Biol., 16, 499-
504.
35. Marsh,M. and Helenius,A. (2006) Virus entry: Open sesame. Cell,
124, 729-740.
36. Taylor,P.R., Martinez-Pomares,L., Stacey,M., Lin,H.H.,
Brown,G.D. and Gordon,S. (2005) Macrophage receptors and immune
recognition. Annu. Rev. Immunol., 23, 901-944.
37. Tulenko,T.N. and Sumner,A.E. (2002) The physiology of lipopro-
teins. J. Nucl. Cardiol., 9, 638-649.
38. Morelli,A.E., Larregina,A.T., Shufesky,W.J., Sullivan,M.L.,
Stolz,D.B., Papworth,G.D., Zahorchak,A.F., Logar,A.J., Wang,Z.,
Watkins,S.C., et al. (2004) Endocytosis, intracellular sorting, and pro-
cessing of exosomes by dendritic cells. Blood, 104, 3257-3266.
54
39. Khalil,I.A., Kogure,K., Akita,H. and Harashima,H. (2006) Uptake
pathways and subsequent intracellular trafficking in nonviral gene
delivery. Pharmacol. Rev., 58, 32-45.
40. Marsh,M. (2001) Endocytosis. Oxford University Press, .
41. Petros,R.A. and DeSimone,J.M. (2010) Strategies in the design of
nanoparticles for therapeutic applications. Nat. Rev. Drug Discov., 9,
615-627.
42. Fattal,E. and Barratt,G. (2009) Nanotechnologies and controlled
release systems for the delivery of antisense oligonucleotides and
small interfering RNA. Br. J. Pharmacol., 157, 179-194.
43. Ragusa,A., Garcia,I. and Penades,S. (2007) Nanoparticles as
nonviral gene delivery vectors. IEEE Trans. Nanobioscience, 6, 319-
330.
44. Thomas,M. and Klibanov,A.M. (2003) Conjugation to gold nano-
particles enhances polyethylenimine's transfer of plasmid DNA into
mammalian cells. Proc. Natl. Acad. Sci. U. S. A., 100, 9138-9143.
45. Kamau,S.W., Hassa,P.O., Steitz,B., Petri-Fink,A., Hofmann,H.,
Hofmann-Amtenbrink,M., von Rechenberg,B. and Hottiger,M.O.
(2006) Enhancement of the efficiency of non-viral gene delivery by
application of pulsed magnetic field. Nucleic Acids Res., 34, e40.
46. Huth,S., Lausier,J., Gersting,S.W., Rudolph,C., Plank,C.,
Welsch,U. and Rosenecker,J. (2004) Insights into the mechanism of
magnetofection using PEI-based magnetofectins for gene transfer. J.
Gene Med., 6, 923-936.
47. Isobe,H., Nakanishi,W., Tomita,N., Jinno,S., Okayama,H. and
Nakamura,E. (2006) Gene delivery by aminofullerenes: Structural
requirements for efficient transfection. Chem. Asian J., 1, 167-175.
48. Chowdhury,E.H., Kunou,M., Nagaoka,M., Kundu,A.K., Hoshi-
ba,T. and Akaike,T. (2004) High-efficiency gene delivery for expres-
sion in mammalian cells by nanoprecipitates of ca-mg phosphate.
Gene, 341, 77-82.
55
49. Sandhu,K.K., McIntosh,C.M., Simard,J.M., Smith,S.W. and Rotel-
lo,V.M. (2002) Gold nanoparticle-mediated transfection of mammali-
an cells. Bioconjug. Chem., 13, 3-6.
50. Singh,R., Pantarotto,D., McCarthy,D., Chaloin,O., Hoebeke,J.,
Partidos,C.D., Briand,J.P., Prato,M., Bianco,A. and Kostarelos,K.
(2005) Binding and condensation of plasmid DNA onto functionalized
carbon nanotubes: Toward the construction of nanotube-based gene
delivery vectors. J. Am. Chem. Soc., 127, 4388-4396.
51. Li,J.M., Wang,Y.Y., Zhao,M.X., Tan,C.P., Li,Y.Q., Le,X.Y.,
Ji,L.N. and Mao,Z.W. (2012) Multifunctional QD-based co-delivery
of siRNA and doxorubicin to HeLa cells for reversal of multidrug re-
sistance and real-time tracking. Biomaterials, 33, 2780-2790.
52. Majewski,A.P., Schallon,A., Jerome,V., Freitag,R., Muller,A.H.
and Schmalz,H. (2012) Dual-responsive magnetic core-shell nanopar-
ticles for nonviral gene delivery and cell separation. Biomacromole-
cules, .
53. Zhu,S.G., Xiang,J.J., Li,X.L., Shen,S.R., Lu,H.B., Zhou,J.,
Xiong,W., Zhang,B.C., Nie,X.M., Zhou,M., et al. (2004) Poly(L-
lysine)-modified silica nanoparticles for the delivery of antisense oli-
gonucleotides. Biotechnol. Appl. Biochem., 39, 179-187.
54. Kim,H.S., Song,I.H., Kim,J.C., Kim,E.J., Jang,D.O. and Park,Y.S.
(2006) In vitro and in vivo gene-transferring characteristics of novel
cationic lipids, DMKD (O,O'-dimyristyl-N-lysyl aspartate) and
DMKE (O,O'-dimyristyl-N-lysyl glutamate). J. Control. Release, 115,
234-241.
55. Zimmermann,T.S., Lee,A.C., Akinc,A., Bramlage,B., Bumcrot,D.,
Fedoruk,M.N., Harborth,J., Heyes,J.A., Jeffs,L.B., John,M., et al.
(2006) RNAi-mediated gene silencing in non-human primates. Na-
ture, 441, 111-114.
56. Akinc,A., Zumbuehl,A., Goldberg,M., Leshchiner,E.S., Busini,V.,
Hossain,N., Bacallado,S.A., Nguyen,D.N., Fuller,J., Alvarez,R., et al.
(2008) A combinatorial library of lipid-like materials for delivery of
RNAi therapeutics. Nat. Biotechnol., 26, 561-569.
56
57. Mack,K.D., Wei,R., Elbagarri,A., Abbey,N. and McGrath,M.S.
(1998) A novel method for DEAE-dextran mediated transfection of
adherent primary cultured human macrophages. J. Immunol. Methods,
211, 79-86.
58. Cryan,S.A., Holohan,A., Donohue,R., Darcy,R. and O'Dris-
coll,C.M. (2004) Cell transfection with polycationic cyclodextrin vec-
tors. Eur. J. Pharm. Sci., 21, 625-633.
59. Mao,H.Q., Roy,K., Troung-Le,V.L., Janes,K.A., Lin,K.Y.,
Wang,Y., August,J.T. and Leong,K.W. (2001) Chitosan-DNA nano-
particles as gene carriers: Synthesis, characterization and transfection
efficiency. J. Control. Release, 70, 399-421.
60. Yun,Y.H., Goetz,D.J., Yellen,P. and Chen,W. (2004) Hyaluronan
microspheres for sustained gene delivery and site-specific targeting.
Biomaterials, 25, 147-157.
61. Matsumoto,T., Numata,M., Anada,T., Mizu,M., Koumoto,K., Sa-
kurai,K., Nagasaki,T. and Shinkai,S. (2004) Chemically modified pol-
ysaccharide schizophyllan for antisense oligonucleotides delivery to
enhance the cellular uptake efficiency. Biochim. Biophys. Acta, 1670,
91-104.
62. Hosseinkhani,H., Aoyama,T., Ogawa,O. and Tabata,Y. (2002)
Liver targeting of plasmid DNA by pullulan conjugation based on
metal coordination. J. Control. Release, 83, 287-302.
63. Inoue,Y., Kurihara,R., Tsuchida,A., Hasegawa,M., Nagashima,T.,
Mori,T., Niidome,T., Katayama,Y. and Okitsu,O. (2008) Efficient
delivery of siRNA using dendritic poly(L-lysine) for loss-of-function
analysis. J. Control. Release, 126, 59-66.
64. Junghans,M., Kreuter,J. and Zimmer,A. (2000) Antisense delivery
using protamine-oligonucleotide particles. Nucleic Acids Res., 28,
E45.
65. Boulikas,T. and Martin,F. (1997) Histones, protamine, and polyly-
sine but not poly(E:K) enhance transfection efficiency. Int. J. Oncol.,
10, 317-322.
57
66. Grayson,A.C., Doody,A.M. and Putnam,D. (2006) Biophysical
and structural characterization of polyethylenimine-mediated siRNA
delivery in vitro. Pharm. Res., 23, 1868-1876.
67. Abbas,A.O., Donovan,M.D. and Salem,A.K. (2008) Formulating
poly(lactide-co-glycolide) particles for plasmid DNA delivery. J.
Pharm. Sci., 97, 2448-2461.
68. Patel,P.C., Giljohann,D.A., Daniel,W.L., Zheng,D.,
Prigodich,A.E. and Mirkin,C.A. (2010) Scavenger receptors mediate
cellular uptake of polyvalent oligonucleotide-functionalized gold na-
noparticles. Bioconjug. Chem., 21, 2250-2256.
69. Graham,F.L. and van der Eb,A.J. (1973) A new technique for the
assay of infectivity of human adenovirus 5 DNA. Virology, 52, 456-
467.
70. Porter,C.J., Trevaskis,N.L. and Charman,W.N. (2007) Lipids and
lipid-based formulations: Optimizing the oral delivery of lipophilic
drugs. Nat. Rev. Drug Discov., 6, 231-248.
71. Sarin,H. (2010) Physiologic upper limits of pore size of different
blood capillary types and another perspective on the dual pore theory
of microvascular permeability. J. Angiogenes Res., 2, 14.
72. Aouadi,M., Tesz,G.J., Nicoloro,S.M., Wang,M., Chouinard,M.,
Soto,E., Ostroff,G.R. and Czech,M.P. (2009) Orally delivered siRNA
targeting macrophage Map4k4 suppresses systemic inflammation.
Nature, 458, 1180-1184.
73. Barratt,G. (2003) Colloidal drug carriers: Achievements and per-
spectives. Cell Mol. Life Sci., 60, 21-37.
74. Briley-Saebo,K., Bjornerud,A., Grant,D., Ahlstrom,H., Berg,T.
and Kindberg,G.M. (2004) Hepatic cellular distribution and degrada-
tion of iron oxide nanoparticles following single intravenous injection
in rats: Implications for magnetic resonance imaging. Cell Tissue Res.,
316, 315-323.
75. Bijsterbosch,M.K., Manoharan,M., Rump,E.T., De Vrueh,R.L.,
van Veghel,R., Tivel,K.L., Biessen,E.A., Bennett,C.F., Cook,P.D. and
58
van Berkel,T.J. (1997) In vivo fate of phosphorothioate antisense oli-
godeoxynucleotides: Predominant uptake by scavenger receptors on
endothelial liver cells. Nucleic Acids Res., 25, 3290-3296.
76. Furumoto,K., Nagayama,S., Ogawara,K., Takakura,Y.,
Hashida,M., Higaki,K. and Kimura,T. (2004) Hepatic uptake of nega-
tively charged particles in rats: Possible involvement of serum pro-
teins in recognition by scavenger receptor. J. Control. Release, 97,
133-141.
77. Li,S.D. and Huang,L. (2008) Pharmacokinetics and biodistribution
of nanoparticles. Mol. Pharm., 5, 496-504.
78. Weissleder,R., Kelly,K., Sun,E.Y., Shtatland,T. and Josephson,L.
(2005) Cell-specific targeting of nanoparticles by multivalent attach-
ment of small molecules. Nat. Biotechnol., 23, 1418-1423.
79. Boado,R.J. and Pardridge,W.M. (2011) The trojan horse liposome
technology for nonviral gene transfer across the blood-brain barrier. J.
Drug Deliv., 2011, 296151.
80. Zuckerman,J.E., Choi,C.H., Han,H. and Davis,M.E. (2012) Poly-
cation-siRNA nanoparticles can disassemble at the kidney glomerular
basement membrane. Proc. Natl. Acad. Sci. U. S. A., 109, 3137-3142.
81. Ezzat,K., El Andaloussi,S., Abdo,R. and Langel,Ü. (2010) Pep-
tide-based matrices as drug delivery vehicles. Curr. Pharm. Des., 16,
1167-1178.
82. Verdurmen,W.P. and Brock,R. (2011) Biological responses to-
wards cationic peptides and drug carriers. Trends Pharmacol. Sci., 32,
116-124.
83. Green,M. and Loewenstein,P.M. (1988) Autonomous functional
domains of chemically synthesized human immunodeficiency virus tat
trans-activator protein. Cell, 55, 1179-1188.
84. Frankel,A.D. and Pabo,C.O. (1988) Cellular uptake of the tat pro-
tein from human immunodeficiency virus. Cell, 55, 1189-1193.
59
85. Joliot,A.H., Triller,A., Volovitch,M., Pernelle,C. and Prochi-
antz,A. (1991) Alpha-2,8-polysialic acid is the neuronal surface recep-
tor of antennapedia homeobox peptide. New Biol., 3, 1121-1134.
86. Derossi,D., Joliot,A.H., Chassaing,G. and Prochiantz,A. (1994)
The third helix of the antennapedia homeodomain translocates through
biological membranes. J. Biol. Chem., 269, 10444-10450.
87. Vivés,E., Brodin,P. and Lebleu,B. (1997) A truncated HIV-1 tat
protein basic domain rapidly translocates through the plasma mem-
brane and accumulates in the cell nucleus. J. Biol. Chem., 272, 16010-
16017.
88. Pooga,M., Hällbrink,M., Zorko,M. and Langel,Ü. (1998) Cell
penetration by transportan. FASEB J., 12, 67-77.
89. Futaki,S., Suzuki,T., Ohashi,W., Yagami,T., Tanaka,S., Ueda,K.
and Sugiura,Y. (2001) Arginine-rich peptides. an abundant source of
membrane-permeable peptides having potential as carriers for intracel-
lular protein delivery. J. Biol. Chem., 276, 5836-5840.
90. Elmquist,A., Lindgren,M., Bartfai,T. and Langel,Ü. (2001) VE-
cadherin-derived cell-penetrating peptide, pVEC, with carrier func-
tions. Exp. Cell Res., 269, 237-244.
91. Magzoub,M., Sandgren,S., Lundberg,P., Oglecka,K., Lilja,J.,
Wittrup,A., Eriksson,L.E., Langel,Ü., Belting,M. and Gräslund,A.
(2006) N-terminal peptides from unprocessed prion proteins enter
cells by macropinocytosis. Biochem. Biophys. Res. Commun., 348,
379-385.
92. Soomets,U., Lindgren,M., Gallet,X., Hällbrink,M., Elmquist,A.,
Balaspiri,L., Zorko,M., Pooga,M., Brasseur,R. and Langel,Ü. (2000)
Deletion analogues of transportan. Biochim. Biophys. Acta, 1467, 165-
176.
93. Oehlke,J., Scheller,A., Wiesner,B., Krause,E., Beyermann,M.,
Klauschenz,E., Melzig,M. and Bienert,M. (1998) Cellular uptake of
an alpha-helical amphipathic model peptide with the potential to de-
liver polar compounds into the cell interior non-endocytically. Bio-
chim. Biophys. Acta, 1414, 127-139.
60
94. Morris,M.C., Depollier,J., Mery,J., Heitz,F. and Divita,G. (2001)
A peptide carrier for the delivery of biologically active proteins into
mammalian cells. Nat. Biotechnol., 19, 1173-1176.
95. Morris,M.C., Vidal,P., Chaloin,L., Heitz,F. and Divita,G. (1997)
A new peptide vector for efficient delivery of oligonucleotides into
mammalian cells. Nucleic Acids Res., 25, 2730-2736.
96. Nagahara,H., Vocero-Akbani,A.M., Snyder,E.L., Ho,A., Lat-
ham,D.G., Lissy,N.A., Becker-Hapak,M., Ezhevsky,S.A. and Dow-
dy,S.F. (1998) Transduction of full-length TAT fusion proteins into
mammalian cells: TAT-p27Kip1 induces cell migration. Nat. Med., 4,
1449-1452.
97. Schwarze,S.R., Ho,A., Vocero-Akbani,A. and Dowdy,S.F. (1999)
In vivo protein transduction: Delivery of a biologically active protein
into the mouse. Science, 285, 1569-1572.
98. Ebert,S., Dietz,G.P., Mitchell,T.J., Michel,U., Bahr,M. and Nau,R.
(2005) Limited protection of TAT-bcl-X(L) against pneumolysin-
induced neuronal cell death. Neurosci. Lett., 384, 349-353.
99. Kilic,U., Kilic,E., Dietz,G.P. and Bahr,M. (2003) Intravenous
TAT-GDNF is protective after focal cerebral ischemia in mice. Stroke,
34, 1304-1310.
100. Nagel,F., Falkenburger,B.H., Tonges,L., Kowsky,S., Poppelmey-
er,C., Schulz,J.B., Bahr,M. and Dietz,G.P. (2008) Tat-Hsp70 protects
dopaminergic neurons in midbrain cultures and in the substantia nigra
in models of parkinson's disease. J. Neurochem., 105, 853-864.
101. Shin,I., Edl,J., Biswas,S., Lin,P.C., Mernaugh,R. and Arte-
aga,C.L. (2005) Proapoptotic activity of cell-permeable anti-akt sin-
gle-chain antibodies. Cancer Res., 65, 2815-2824.
102. Zhou,H., Wu,S., Joo,J.Y., Zhu,S., Han,D.W., Lin,T., Trauger,S.,
Bien,G., Yao,S., Zhu,Y., et al. (2009) Generation of induced pluripo-
tent stem cells using recombinant proteins. Cell. Stem Cell., 4, 381-
384.
61
103. Senatus,P.B., Li,Y., Mandigo,C., Nichols,G., Moise,G., Mao,Y.,
Brown,M.D., Anderson,R.C., Parsa,A.T., Brandt-Rauf,P.W., et al.
(2006) Restoration of p53 function for selective fas-mediated apopto-
sis in human and rat glioma cells in vitro and in vivo by a p53 COOH-
terminal peptide. Mol. Cancer. Ther., 5, 20-28.
104. Snyder,E.L., Meade,B.R., Saenz,C.C. and Dowdy,S.F. (2004)
Treatment of terminal peritoneal carcinomatosis by a transducible
p53-activating peptide. PLoS Biol., 2, E36.
105. Pooga,M., Soomets,U., Hällbrink,M., Valkna,A., Saar,K., Re-
zaei,K., Kahl,U., Hao,J.X., Xu,X.J., Wiesenfeld-Hallin,Z., et al.
(1998) Cell penetrating PNA constructs regulate galanin receptor lev-
els and modify pain transmission in vivo. Nat. Biotechnol., 16, 857-
861.
106. Fletcher,S., Honeyman,K., Fall,A.M., Harding,P.L., John-
sen,R.D., Steinhaus,J.P., Moulton,H.M., Iversen,P.L. and Wilton,S.D.
(2007) Morpholino oligomer-mediated exon skipping averts the onset
of dystrophic pathology in the mdx mouse. Mol. Ther., 15, 1587-1592.
107. McClorey,G., Moulton,H.M., Iversen,P.L., Fletcher,S. and Wil-
ton,S.D. (2006) Antisense oligonucleotide-induced exon skipping re-
stores dystrophin expression in vitro in a canine model of DMD. Gene
Ther., 13, 1373-1381.
108. Yin,H., Saleh,A.F., Betts,C., Camelliti,P., Seow,Y., Ashraf,S.,
Arzumanov,A., Hammond,S., Merritt,T., Gait,M.J., et al. (2011) Pip5
transduction peptides direct high efficiency oligonucleotide-mediated
dystrophin exon skipping in heart and phenotypic correction in mdx
mice. Mol. Ther., 19, 1295-1303.
109. Marshall,N.B., Oda,S.K., London,C.A., Moulton,H.M.,
Iversen,P.L., Kerkvliet,N.I. and Mourich,D.V. (2007) Arginine-rich
cell-penetrating peptides facilitate delivery of antisense oligomers into
murine leukocytes and alter pre-mRNA splicing. J. Immunol. Meth-
ods, 325, 114-126.
110. Rousselle,C., Clair,P., Temsamani,J. and Scherrmann,J.M.
(2002) Improved brain delivery of benzylpenicillin with a peptide-
vector-mediated strategy. J. Drug Target., 10, 309-315.
62
111. Lindgren,M., Rosenthal-Aizman,K., Saar,K., Eiriksdottir,E.,
Jiang,Y., Sassian,M., Ostlund,P., Hällbrink,M. and Langel,Ü. (2006)
Overcoming methotrexate resistance in breast cancer tumour cells by
the use of a new cell-penetrating peptide. Biochem. Pharmacol., 71,
416-425.
112. Mäe,M., El Andaloussi,S., Lehto,T. and Langel,Ü. (2009) Chem-
ically modified cell-penetrating peptides for the delivery of nucleic
acids. Expert Opin. Drug Deliv., 6, 1195-1205.
113. Heitz,F., Morris,M.C. and Divita,G. (2009) Twenty years of cell-
penetrating peptides: From molecular mechanisms to therapeutics. Br.
J. Pharmacol., 157, 195-206.
114. Deshayes,S., Morris,M., Heitz,F. and Divita,G. (2008) Delivery
of proteins and nucleic acids using a non-covalent peptide-based strat-
egy. Adv. Drug Deliv. Rev., 60, 537-547.
115. Simeoni,F., Morris,M.C., Heitz,F. and Divita,G. (2003) Insight
into the mechanism of the peptide-based gene delivery system MPG:
Implications for delivery of siRNA into mammalian cells. Nucleic
Acids Res., 31, 2717-2724.
116. Weller,K., Lauber,S., Lerch,M., Renaud,A., Merkle,H.P. and
Zerbe,O. (2005) Biophysical and biological studies of end-group-
modified derivatives of pep-1. Biochemistry, 44, 15799-15811.
117. Gros,E., Deshayes,S., Morris,M.C., Aldrian-Herrada,G., Depolli-
er,J., Heitz,F. and Divita,G. (2006) A non-covalent peptide-based
strategy for protein and peptide nucleic acid transduction. Biochim.
Biophys. Acta, 1758, 384-393.
118. Crombez,L., Aldrian-Herrada,G., Konate,K., Nguyen,Q.N.,
McMaster,G.K., Brasseur,R., Heitz,F. and Divita,G. (2009) A new
potent secondary amphipathic cell-penetrating peptide for siRNA de-
livery into mammalian cells. Mol. Ther., 17, 95-103.
119. Kim,W.J., Christensen,L.V., Jo,S., Yockman,J.W., Jeong,J.H.,
Kim,Y.H. and Kim,S.W. (2006) Cholesteryl oligoarginine delivering
vascular endothelial growth factor siRNA effectively inhibits tumor
growth in colon adenocarcinoma. Mol. Ther., 14, 343-350.
63
120. Futaki,S., Ohashi,W., Suzuki,T., Niwa,M., Tanaka,S., Ueda,K.,
Harashima,H. and Sugiura,Y. (2001) Stearylated arginine-rich pep-
tides: A new class of transfection systems. Bioconjug. Chem., 12,
1005-1011.
121. Lehto,T., Ezzat,K. and Langel,Ü. (2011) Peptide nanoparticles
for oligonucleotide delivery. Prog. Mol. Biol. Transl. Sci., 104, 397-
426.
122. El Andaloussi,S., Lehto,T., Mäger,I., Rosenthal-Aizman,K.,
Oprea,I.I., Simonson,O.E., Sork,H., Ezzat,K., Copolovici,D.M.,
Kurrikoff,K., et al. (2011) Design of a peptide-based vector, PepFect6,
for efficient delivery of siRNA in cell culture and systemically in vi-
vo. Nucleic Acids Res., 39, 3972-3987.
123. Lehto,T., Abes,R., Oskolkov,N., Suhorutsenko,J., Copolovi-
ci,D.M., Mäger,I., Viola,J.R., Simonson,O.E., Ezzat,K., Guterstam,P.,
et al. (2010) Delivery of nucleic acids with a stearylated (RxR)4 pep-
tide using a non-covalent co-incubation strategy. J. Control. Release,
141, 42-51.
124. Eguchi,A., Meade,B.R., Chang,Y.C., Fredrickson,C.T., Will-
ert,K., Puri,N. and Dowdy,S.F. (2009) Efficient siRNA delivery into
primary cells by a peptide transduction domain-dsRNA binding do-
main fusion protein. Nat. Biotechnol., 27, 567-571.
125. Crombez,L., Morris,M.C., Dufort,S., Aldrian-Herrada,G., Ngu-
yen,Q., Mc Master,G., Coll,J.L., Heitz,F. and Divita,G. (2009) Target-
ing cyclin B1 through peptide-based delivery of siRNA prevents tu-
mour growth. Nucleic Acids Res., 37, 4559-4569.
126. Morris,M.C., Chaloin,L., Choob,M., Archdeacon,J., Heitz,F. and
Divita,G. (2004) Combination of a new generation of PNAs with a
peptide-based carrier enables efficient targeting of cell cycle progres-
sion. Gene Ther., 11, 757-764.
127. Morris,M.C., Gros,E., Aldrian-Herrada,G., Choob,M., Archdea-
con,J., Heitz,F. and Divita,G. (2007) A non-covalent peptide-based
carrier for in vivo delivery of DNA mimics. Nucleic Acids Res., 35,
e49.
64
128. Khalil,I.A., Futaki,S., Niwa,M., Baba,Y., Kaji,N., Kamiya,H. and
Harashima,H. (2004) Mechanism of improved gene transfer by the N-
terminal stearylation of octaarginine: Enhanced cellular association by
hydrophobic core formation. Gene Ther., 11, 636-644.
129. Lehto,T., Simonson,O.E., Mäger,I., Ezzat,K., Sork,H., Copolovi-
ci,D.M., Viola,J.R., Zaghloul,E.M., Lundin,P., Moreno,P.M., et al.
(2011) A peptide-based vector for efficient gene transfer in vitro and
in vivo. Mol. Ther., 19, 1457-1467.
130. Ezzat,K., El Andaloussi,S., Zaghloul,E.M., Lehto,T., Lind-
berg,S., Moreno,P.M., Viola,J.R., Magdy,T., Abdo,R., Guterstam,P.,
et al. (2011) PepFect 14, a novel cell-penetrating peptide for oligonu-
cleotide delivery in solution and as solid formulation. Nucleic Acids
Res., 39, 5284-5298.
131. Oskolkov,N., Arukuusk,P., Copolovici,D.M., Lindberg,S., Mar-
gus,H., Padari,K., Pooga,M. and Langel,Ü. (2011) NickFects, phos-
phorylated derivatives of transportan 10 for cellular delivery of oligo-
nucleotides. Int. J. Pept. Res. Ther, 17, 147-157.
132. Oren,Z. and Shai,Y. (1998) Mode of action of linear amphipathic
alpha-helical antimicrobial peptides. Biopolymers, 47, 451-463.
133. Derossi,D., Calvet,S., Trembleau,A., Brunissen,A., Chassaing,G.
and Prochiantz,A. (1996) Cell internalization of the third helix of the
antennapedia homeodomain is receptor-independent. J. Biol. Chem.,
271, 18188-18193.
134. Richard,J.P., Melikov,K., Vivés,E., Ramos,C., Verbeure,B.,
Gait,M.J., Chernomordik,L.V. and Lebleu,B. (2003) Cell-penetrating
peptides. A reevaluation of the mechanism of cellular uptake. J. Biol.
Chem., 278, 585-590.
135. Murriel,C.L. and Dowdy,S.F. (2006) Influence of protein trans-
duction domains on intracellular delivery of macromolecules. Expert
Opin. Drug Deliv., 3, 739-746.
136. Gump,J.M. and Dowdy,S.F. (2007) TAT transduction: The mo-
lecular mechanism and therapeutic prospects. Trends Mol. Med., 13,
443-448.
65
137. Mäe,M., El Andaloussi,S., Lundin,P., Oskolkov,N., Johans-
son,H.J., Guterstam,P. and Langel,Ü. (2009) A stearylated CPP for
delivery of splice correcting oligonucleotides using a non-covalent co-
incubation strategy. J. Control. Release, 134, 221-227.
138. El Andaloussi,S., Holm,T. and Langel,Ü. (2005) Cell-penetrating
peptides: Mechanisms and applications. Curr. Pharm. Des., 11, 3597-
3611.
139. Lundberg,P., El Andaloussi,S., Sutlu,T., Johansson,H. and
Langel,Ü. (2007) Delivery of short interfering RNA using endosomo-
lytic cell-penetrating peptides. FASEB J., 21, 2664-2671.
140. El-Sayed,A., Masuda,T., Khalil,I., Akita,H. and Harashima,H.
(2009) Enhanced gene expression by a novel stearylated INF7 peptide
derivative through fusion independent endosomal escape. J. Control.
Release, 138, 160-167.
141. Palm-Apergi,C., Lorents,A., Padari,K., Pooga,M. and Häll-
brink,M. (2009) The membrane repair response masks membrane dis-
turbances caused by cell-penetrating peptide uptake. FASEB J., 23,
214-223.
142. Verdurmen,W.P., Thanos,M., Ruttekolk,I.R., Gulbins,E. and
Brock,R. (2010) Cationic cell-penetrating peptides induce ceramide
formation via acid sphingomyelinase: Implications for uptake. J. Con-
trol. Release, 147, 171-179.
143. Nekhotiaeva,N., Elmquist,A., Rajarao,G.K., Hällbrink,M.,
Langel,Ü. and Good,L. (2004) Cell entry and antimicrobial properties
of eukaryotic cell-penetrating peptides. FASEB J., 18, 394-396.
144. Palm,C., Netzereab,S. and Hällbrink,M. (2006) Quantitatively
determined uptake of cell-penetrating peptides in non-mammalian
cells with an evaluation of degradation and antimicrobial effects. Pep-
tides, 27, 1710-1716.
145. Brogden,K.A. (2005) Antimicrobial peptides: Pore formers or
metabolic inhibitors in bacteria? Nat. Rev. Microbiol., 3, 238-250.
66
146. Henriques,S.T., Melo,M.N. and Castanho,M.A. (2006) Cell-
penetrating peptides and antimicrobial peptides: How different are
they? Biochem. J., 399, 1-7.
147. Melo,M.N., Ferre,R. and Castanho,M.A. (2009) Antimicrobial
peptides: Linking partition, activity and high membrane-bound con-
centrations. Nat. Rev. Microbiol., 7, 245-250.
148. Mano,M., Teodosio,C., Paiva,A., Simoes,S. and Pedroso de Li-
ma,M.C. (2005) On the mechanisms of the internalization of S4(13)-
PV cell-penetrating peptide. Biochem. J., 390, 603-612.
149. Padari,K., Koppel,K., Lorents,A., Hällbrink,M., Mano,M.,
Pedroso de Lima,M.C. and Pooga,M. (2010) S4(13)-PV cell-
penetrating peptide forms nanoparticle-like structures to gain entry
into cells. Bioconjug. Chem., 21, 774-783.
150. Alves,I.D., Bechara,C., Walrant,A., Zaltsman,Y., Jiao,C.Y. and
Sagan,S. (2011) Relationships between membrane binding, affinity
and cell internalization efficacy of a cell-penetrating peptide: Pene-
tratin as a case study. PLoS One, 6, e24096.
151. Rullo,A., Qian,J. and Nitz,M. (2011) Peptide-glycosaminoglycan
cluster formation involving cell penetrating peptides. Biopolymers, 95,
722-731.
152. Ziegler,A. and Seelig,J. (2011) Contributions of glycosaminogly-
can binding and clustering to the biological uptake of the nonamphi-
pathic cell-penetrating peptide WR9. Biochemistry, 50, 4650-4664.
153. Borm,P.J., Robbins,D., Haubold,S., Kuhlbusch,T., Fissan,H.,
Donaldson,K., Schins,R., Stone,V., Kreyling,W., Lademann,J., et al.
(2006) The potential risks of nanomaterials: A review carried out for
ECETOC. Part Fibre Toxicol., 3, 11.
154. Shcharbin,D., Pedziwiatr,E. and Bryszewska,M. (2009) How to
study dendriplexes I: Characterization. J. Control. Release, 135, 186-
197.
67
155. Domingues,M.M., Santiago,P.S., Castanho,M.A. and Santos,N.C.
(2008) What can light scattering spectroscopy do for membrane-active
peptide studies? J. Pept. Sci., 14, 394-400.
156. Ezzat,K., Helmfors,H., Tudoran,O., Juks,C., Lindberg,S., Pa-
dari,K., El Andaloussi,S., Pooga,M. and Langel,Ü. (2012) Scavenger
receptor-mediated uptake of cell-penetrating peptide nanocomplexes
with oligonucleotides. FASEB J., 3, 1172-80.
157. Goldstein,J.L., Ho,Y.K., Basu,S.K. and Brown,M.S. (1979)
Binding site on macrophages that mediates uptake and degradation of
acetylated low density lipoprotein, producing massive cholesterol
deposition. Proc. Natl. Acad. Sci. U. S. A., 76, 333-337.
158. Brown,M.S., Goldstein,J.L., Krieger,M., Ho,Y.K. and Ander-
son,R.G. (1979) Reversible accumulation of cholesteryl esters in mac-
rophages incubated with acetylated lipoproteins. J. Cell Biol., 82, 597-
613.
159. Greaves,D.R. and Gordon,S. (2009) The macrophage scavenger
receptor at 30 years of age: Current knowledge and future challenges.
J. Lipid Res., 50 Suppl, S282-6.
160. Martinez,V.G., Moestrup,S.K., Holmskov,U., Mollenhauer,J. and
Lozano,F. (2011) The conserved scavenger receptor cysteine-rich su-
perfamily in therapy and diagnosis. Pharmacol. Rev., 63, 967-1000.
161. Bowdish,D.M. and Gordon,S. (2009) Conserved domains of the
class A scavenger receptors: Evolution and function. Immunol. Rev.,
227, 19-31.
162. Platt,N. and Gordon,S. (1998) Scavenger receptors: Diverse ac-
tivities and promiscuous binding of polyanionic ligands. Chem. Biol.,
5, R193-203.
163. Krieger,M., Acton,S., Ashkenas,J., Pearson,A., Penman,M. and
Resnick,D. (1993) Molecular flypaper, host defense, and atherosclero-
sis. structure, binding properties, and functions of macrophage scav-
enger receptors. J. Biol. Chem., 268, 4569-4572.
68
164. Dunne,D.W., Resnick,D., Greenberg,J., Krieger,M. and Join-
er,K.A. (1994) The type I macrophage scavenger receptor binds to
gram-positive bacteria and recognizes lipoteichoic acid. Proc. Natl.
Acad. Sci. U. S. A., 91, 1863-1867.
165. Barth,H., Schnober,E.K., Neumann-Haefelin,C., Thumann,C.,
Zeisel,M.B., Diepolder,H.M., Hu,Z., Liang,T.J., Blum,H.E., Thim-
me,R., et al. (2008) Scavenger receptor class B is required for hepati-
tis C virus uptake and cross-presentation by human dendritic cells. J.
Virol., 82, 3466-3479.
166. Fenton,M.J. and Golenbock,D.T. (1998) LPS-binding proteins
and receptors. J. Leukoc. Biol., 64, 25-32.
167. Kouadir,M., Yang,L., Tan,R., Shi,F., Lu,Y., Zhang,S., Yin,X.,
Zhou,X. and Zhao,D. (2012) CD36 participates in PrP(106-126)-
induced activation of microglia. PLoS One, 7, e30756.
168. DeWitte-Orr,S.J., Collins,S.E., Bauer,C.M., Bowdish,D.M. and
Mossman,K.L. (2010) An accessory to the 'trinity': SR-as are essential
pathogen sensors of extracellular dsRNA, mediating entry and leading
to subsequent type I IFN responses. PLoS Pathog., 6, e1000829.
169. Husemann,J., Loike,J.D., Anankov,R., Febbraio,M. and Silver-
stein,S.C. (2002) Scavenger receptors in neurobiology and neuropa-
thology: Their role on microglia and other cells of the nervous system.
Glia, 40, 195-205.
170. Peiser,L. and Gordon,S. (2001) The function of scavenger recep-
tors expressed by macrophages and their role in the regulation of in-
flammation. Microbes Infect., 3, 149-159.
171. Resnick,D., Freedman,N.J., Xu,S. and Krieger,M. (1993) Secret-
ed extracellular domains of macrophage scavenger receptors form
elongated trimers which specifically bind crocidolite asbestos. J. Biol.
Chem., 268, 3538-3545.
172. Iyer,R., Hamilton,R.F., Li,L. and Holian,A. (1996) Silica-
induced apoptosis mediated via scavenger receptor in human alveolar
macrophages. Toxicol. Appl. Pharmacol., 141, 84-92.
69
173. Kanno,S., Furuyama,A. and Hirano,S. (2007) A murine scaven-
ger receptor MARCO recognizes polystyrene nanoparticles. Toxicol.
Sci., 97, 398-406.
174. Raynal,I., Prigent,P., Peyramaure,S., Najid,A., Rebuzzi,C. and
Corot,C. (2004) Macrophage endocytosis of superparamagnetic iron
oxide nanoparticles: Mechanisms and comparison of ferumoxides and
ferumoxtran-10. Invest. Radiol., 39, 56-63.
175. Franca,A., Aggarwal,P., Barsov,E.V., Kozlov,S.V., Dobrovols-
kaia,M.A. and Gonzalez-Fernandez,A. (2011) Macrophage scavenger
receptor A mediates the uptake of gold colloids by macrophages in
vitro. Nanomedicine (Lond), 6, 1175-1188.
176. Moghimi,S.M., Hunter,A.C. and Murray,J.C. (2001) Long-
circulating and target-specific nanoparticles: Theory to practice.
Pharmacol. Rev., 53, 283-318.
177. Pluddemann,A., Neyen,C. and Gordon,S. (2007) Macrophage
scavenger receptors and host-derived ligands. Methods, 43, 207-217.
178. Murphy,J.E., Tedbury,P.R., Homer-Vanniasinkam,S., Walk-
er,J.H. and Ponnambalam,S. (2005) Biochemistry and cell biology of
mammalian scavenger receptors. Atherosclerosis, 182, 1-15.
179. Han,H.J., Tokino,T. and Nakamura,Y. (1998) CSR, a scavenger
receptor-like protein with a protective role against cellular damage
causedby UV irradiation and oxidative stress. Hum. Mol. Genet., 7,
1039-1046.
180. Ohtani,K., Suzuki,Y., Eda,S., Kawai,T., Kase,T., Keshi,H., Sa-
kai,Y., Fukuoh,A., Sakamoto,T., Itabe,H., et al. (2001) The mem-
brane-type collectin CL-P1 is a scavenger receptor on vascular endo-
thelial cells. J. Biol. Chem., 276, 44222-44228.
181. Jiang,Y., Oliver,P., Davies,K.E. and Platt,N. (2006) Identifica-
tion and characterization of murine SCARA5, a novel class A scaven-
ger receptor that is expressed by populations of epithelial cells. J. Biol.
Chem., 281, 11834-11845.
70
182. de Vries,H.E., Kuiper,J., de Boer,A.G., van Berkel,T.J. and
Breimer,D.D. (1993) Characterization of the scavenger receptor on
bovine cerebral endothelial cells in vitro. J. Neurochem., 61, 1813-
1821.
183. Brown,M.S. and Goldstein,J.L. (1983) Lipoprotein metabolism in
the macrophage: Implications for cholesterol deposition in atheroscle-
rosis. Annu. Rev. Biochem., 52, 223-261.
184. Rich,A. (1958) The molecular structure of polyinosinic acid. Bi-
ochim. Biophys. Acta, 29, 502-509.
185. Chen,G.C. and Yang,J.T. (1973) Some hydrodynamic and optical
properties of polyribonucleotides. Biophys. Chem., 1, 62-72.
186. Pearson,A.M., Rich,A. and Krieger,M. (1993) Polynucleotide
binding to macrophage scavenger receptors depends on the formation
of base-quartet-stabilized four-stranded helices. J. Biol. Chem., 268,
3546-3554.
187. Jozefowski,S., Sulahian,T.H., Arredouani,M. and Kobzik,L.
(2006) Role of scavenger receptor MARCO in macrophage responses
to CpG oligodeoxynucleotides. J. Leukoc. Biol., 80, 870-879.
188. Kimura,Y., Sonehara,K., Kuramoto,E., Makino,T., Yamamo-
to,S., Yamamoto,T., Kataoka,T. and Tokunaga,T. (1994) Binding of
oligoguanylate to scavenger receptors is required for oligonucleotides
to augment NK cell activity and induce IFN. J. Biochem., 116, 991-
994.
189. Lee,S.W., Song,M.K., Baek,K.H., Park,Y., Kim,J.K., Lee,C.H.,
Cheong,H.K., Cheong,C. and Sung,Y.C. (2000) Effects of a hexamer-
ic deoxyriboguanosine run conjugation into CpG oligodeoxynucleo-
tides on their immunostimulatory potentials. J. Immunol., 165, 3631-
3639.
190. Suzuki,K., Doi,T., Imanishi,T., Kodama,T. and Tanaka,T. (1999)
Oligonucleotide aggregates bind to the macrophage scavenger recep-
tor. Eur. J. Biochem., 260, 855-860.
71
191. Wu,C.C., Lee,J., Raz,E., Corr,M. and Carson,D.A. (2004) Neces-
sity of oligonucleotide aggregation for toll-like receptor 9 activation.
J. Biol. Chem., 279, 33071-33078.
192. Sester,D.P., Naik,S., Beasley,S.J., Hume,D.A. and Stacey,K.J.
(2000) Phosphorothioate backbone modification modulates macro-
phage activation by CpG DNA. J. Immunol., 165, 4165-4173.
193. Dalpke,A.H., Zimmermann,S., Albrecht,I. and Heeg,K. (2002)
Phosphodiester CpG oligonucleotides as adjuvants: Polyguanosine
runs enhance cellular uptake and improve immunostimulative activity
of phosphodiester CpG oligonucleotides in vitro and in vivo. Immu-
nology, 106, 102-112.
194. Limmon,G.V., Arredouani,M., McCann,K.L., Corn Minor,R.A.,
Kobzik,L. and Imani,F. (2008) Scavenger receptor class-A is a novel
cell surface receptor for double-stranded RNA. FASEB J., 22, 159-
167.
195. Saleh,M.C., van Rij,R.P., Hekele,A., Gillis,A., Foley,E., O'Far-
rell,P.H. and Andino,R. (2006) The endocytic pathway mediates cell
entry of dsRNA to induce RNAi silencing. Nat. Cell Biol., 8, 793-802.
196. Son,K.K., Patel,D.H., Tkach,D. and Park,A. (2000) Cationic lip-
osome and plasmid DNA complexes formed in serum-free medium
under optimum transfection condition are negatively charged. Bio-
chim. Biophys. Acta, 1466, 11-15.
197. Son,K.K., Tkach,D. and Hall,K.J. (2000) Efficient in vivo gene
delivery by the negatively charged complexes of cationic liposomes
and plasmid DNA. Biochim. Biophys. Acta, 1468, 6-10.
198. Son,K.K., Tkach,D. and Patel,D.H. (2000) Zeta potential of
transfection complexes formed in serum-free medium can predict in
vitro gene transfer efficiency of transfection reagent. Biochim. Bio-
phys. Acta, 1468, 11-14.
199. Son,K.K., Tkach,D. and Rosenblatt,J. (2001) Delipidated serum
abolishes the inhibitory effect of serum on in vitro liposome-mediated
transfection. Biochim. Biophys. Acta, 1511, 201-205.
72
200. Noronha-Blob,L. and Pitha,J. (1978) Binding of polynucleotides
to fibroblasts. effects of complex formation with vinyl analogs of nu-
cleic acids. Biochim. Biophys. Acta, 519, 285-290.
201. Ryser,H.J., Termini,T.E. and Barnes,P.R. (1975) Polynucleotide
aggregates enhance the transport of protein at the surface of cultured
mammalian cells. J. Cell. Physiol., 87, 221-228.
202. Vasconcelos,T., Sarmento,B. and Costa,P. (2007) Solid disper-
sions as strategy to improve oral bioavailability of poor water soluble
drugs. Drug Discov. Today, 12, 1068-1075.
203. Merrifield,R.B. (1963) Solid phase peptide synthesis. I. the syn-
thesis of a tetrapeptide. 85, 2154.
204. Fisher,L., Soomets,U., Cortes Toro,V., Chilton,L., Jiang,Y.,
Langel,Ü. and Iverfeldt,K. (2004) Cellular delivery of a double-
stranded oligonucleotide NFkappaB decoy by hybridization to com-
plementary PNA linked to a cell-penetrating peptide. Gene Ther., 11,
1264-1272.
205. Ramsay,E. and Gumbleton,M. (2002) Polylysine and polyorni-
thine gene transfer complexes: A study of complex stability and cellu-
lar uptake as a basis for their differential in-vitro transfection efficien-
cy. J. Drug Target., 10, 1-9.
206. Kang,S.H., Cho,M.J. and Kole,R. (1998) Up-regulation of lucif-
erase gene expression with antisense oligonucleotides: Implications
and applications in functional assay development. Biochemistry, 37,
6235-6239.
207. Morgan,J.E., Beauchamp,J.R., Pagel,C.N., Peckham,M., Atali-
otis,P., Jat,P.S., Noble,M.D., Farmer,K. and Partridge,T.A. (1994)
Myogenic cell lines derived from transgenic mice carrying a thermo-
labile T antigen: A model system for the derivation of tissue-specific
and mutation-specific cell lines. Dev. Biol., 162, 486-498.
208. Collingwood,M.A., Rose,S.D., Huang,L., Hillier,C., Amarz-
guioui,M., Wiiger,M.T., Soifer,H.S., Rossi,J.J. and Behlke,M.A.
(2008) Chemical modification patterns compatible with high potency
73
dicer-substrate small interfering RNAs. Oligonucleotides, 18, 187-
200.
209. Philo,J.S. (2006) Is any measurement method optimal for all ag-
gregate sizes and types? AAPS J., 8, E564-71.
210. Filipe,V., Hawe,A. and Jiskoot,W. (2010) Critical evaluation of
nanoparticle tracking analysis (NTA) by NanoSight for the measure-
ment of nanoparticles and protein aggregates. Pharm. Res., 27, 796-
810.
211. Ahuja,S. and Scypinski,S. (2001) Handbook of Modern Pharma-
ceutical Analysis Academic Press, San Diego.
212. Molina,M.D. and Anchordoquy,T.J. (2008) Degradation of ly-
ophilized lipid/DNA complexes during storage: The role of lipid and
reactive oxygen species. Biochim. Biophys. Acta, 1778, 2119-2126.
213. Yu,J. and Anchordoquy,T.J. (2009) Synergistic effects of surfac-
tants and sugars on lipoplex stability during freeze-drying and rehy-
dration. J. Pharm. Sci., 98, 3319-3328.
214. Hunter,R.J. (1981) Zeta Potential in Colloid Science. Academic
Press, London.
215. Nagayama,S., Ogawara,K., Minato,K., Fukuoka,Y., Takakura,Y.,
Hashida,M., Higaki,K. and Kimura,T. (2007) Fetuin mediates hepatic
uptake of negatively charged nanoparticles via scavenger receptor. Int.
J. Pharm., 329, 192-198.